Current File : /home/inlingua/www/decay_sym/root/proc/453051/root/proc/453150/root/var/lib/rpm/__db.003
�Ѓ���������������������������������������������������������������������������������,�Ñ
x����
>���������������������������� �0hP�@&�
�5����CyCyO[q	�
O���3AU�
P��$��J*&�
X!p!8!8!8���������������p�������8����������������8���������������������������������� !��������	��������
������������������������
��������������������������������������������������������������������������������P�����������������������������xo	��	����
��(�-�-������������������������ ��������!��������"��������#��������$��������%K��&hJ��'`���(�&)(�*lB+�"�V,��h+-�XY.���y/Xp0�?�r
1�'	�'	2�e�e3�Y�Y4��������5@��6���7p9��80 8�9�q �:���
;��x<�nP�=�
��>�{�X? �8�@�M�A0�H�B�8�C�
g
D�'��E��������F��������GP�h�H��������I(@Jh�K�~��L�efM�<��N��
��Oj��P2�QPLp�R����S��uTP'��U�p�V�XxW���X��������Y����ZH)�[Ȝ�Z\`�
]�70�^�@�_`5`@p	0a$XbP�`:ch�zd��
H	eWh�
f0�
g�WX	h����ix���jX�x$k8g�l��Ȏ	m��nH��loXUup�(Eq8�0�r("
(�
shX�t8� �u�R�NvXt
w@��
xP�(�y�a��zt`�{hX0;|0zH�
}���	~x1`� H��8'	�0�����	�*����{��
�y
�8�P��p����X�p��py�y��<����`��@����@U���P��`������3��� ��8��K���	Xf
��UHl������45��(��� ��(�������������x�������x������������������������������HX����������������������H��5���`&��������H����������W�L�I�
�I�
C� &�&H�����������������������H���`@у@����������������@������@	Packages@����������������������@�������������������������X�"%�
`�0j�d�$$�����������������d�d�d�meth_new.3ssl.gzEVP_PKEY_meth_get_count.3ssl.gzEVP_PKEY_meth_get_count.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_cmp.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_print_private.3ssl.gzEVP_PKEY_print_private.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_size.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_sign.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_verify.3ssl.gzEVP_PKEY_verify_recover.3ssl.gzEVP_SealInit.3ssl.gzEVP_SealInit.3ssl.gzEVP_SignInit.3ssl.gzEVP_SignInit.3ssl.gzEVP_SignInit.3ssl.gzEVP_VerifyInit.3ssl.gzEVP_VerifyInit.3ssl.gzEVP_VerifyInit.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aes.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_aria.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_blake2b512.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_chacha20.3ssl.gzOpenSSL_add_all_algorithms.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_x��������L			�8��������������� �8 	�������������������������� x����������������x�xNameictname����������������p������@�����������������0�������X��%�
П0������?��$/����������������?�@�>��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x����������������������X��#�
����������
}��$m����������������}�|�~��alues using C++ bindings.
- [module] Drop module lock command.
- [crypto] Use handle from repo in dnf.crypto.retrieve().
- [module] Assume a 'default' profile exists for all modules (RhBug:1568165)
- [base] Introduce easy installation of package, group and module specs.- [transaction] Fix 'TransactionItem not found for key' error.
- [module] Allow removing module profile without specifying a stream.
- [module] Fix 'BaseCli' object has no attribute '_yumdb' error.
- [callback] Fix TransactionDisplay.PKG_ERASE redirect to a non-existing constant.
- [spec] Change yum compat package version to 4.0.version.
- [cache] Clean transaction temp files after successfull transaction
- [log] Log messages from libdnf logger
- [transaction] Add states to report rpm transaction progress
- [transaction] Cache TransactionItem during handling of RPM callback (RhBug:1599597)
- [systemd] dnf-makecache.timer: move to multi-user to fix loop- Bug fix release- Update to 3.0.2-1- Update to 3.0.1-1
- Support of MODULES - new DNF command `module`
- Add attribute dnf.conf.Conf.proxy_auth_method
- New repoquery option `--depends` and `--whatdepends`
- Enhanced support of variables
- Enhanced documentation
- Resolves: rhbz#1565599
- Resolves: rhbz#1508839
- Resolves: rhbz#1506486
- Resolves: rhbz#1506475
- Resolves: rhbz#1505577
- Resolves: rhbz#1505574
- Resolves: rhbz#1505573
- Resolves: rhbz#1480481
- Resolves: rhbz#1496732
- Resolves: rhbz#1497272
- Resolves: rhbz#1488100
- Resolves: rhbz#1488086
- Resolves: rhbz#1488112
- Resolves: rhbz#1488105
- Resolves: rhbz#1488089
- Resolves: rhbz#1488092
- Resolves: rhbz#1486839
- Resolves: rhbz#1486839
- Resolves: rhbz#1486827
- Resolves: rhbz#1486816
- Resolves: rhbz#1565647
- Resolves: rhbz#1583834
- Resolves: rhbz#1576921
- Resolves: rhbz#1270295
- Resolves: rhbz#1361698
- Resolves: rhbz#1369847
- Resolves: rhbz#1368651
- Resolves: rhbz#1563841
- Resolves: rhbz#1387622
- Resolves: rhbz#1575998
- Resolves: rhbz#1577854
- Resolves: rhbz#1387622
- Resolves: rhbz#1542416
- Resolves: rhbz#1542416
- Resolves: rhbz#1496153
- Resolves: rhbz#1568366
- Resolves: rhbz#1539803
- Resolves: rhbz#1552576
- Resolves: rhbz#1545075
- Resolves: rhbz#1544359
- Resolves: rhbz#1547672
- Resolves: rhbz#1537957
- Resolves: rhbz#1542920
- Resolves: rhbz#1507129
- Resolves: rhbz#1512956
- Resolves: rhbz#1512663
- Resolves: rhbz#1247083
- Resolves: rhbz#1247083
- Resolves: rhbz#1247083
- Resolves: rhbz#1519325
- Resolves: rhbz#1492036
- Resolves: rhbz#1391911
- Resolves: rhbz#1391911
- Resolves: rhbz#1479330
- Resolves: rhbz#1505185
- Resolves: rhbz#1305232- Improve performance for excludes and includes handling (RHBZ #1500361)
- Fixed problem of handling checksums for local repositories (RHBZ #1502106)
- Fix traceback when using dnf.Base.close() (RHBZ #1503575)- Update to 2.7.4-1
- Enhanced performance for excludes and includes handling
- Solved memory leaks at time of closing of dnf.Base()
- Resolves: rhbz#1480979 - I thought it abnormal that dnf crashed.
- Resolves: rhbz#1461423 - Memory leak in python-dnf
- Resolves: rhbz#1499564 - dnf list installed crashes
- Resolves: rhbz#1499534 - dnf-2 is much slower than dnf-1 when handling groups
- Resolves: rhbz#1499623 - Mishandling stderr vs stdout (dnf search, dnf repoquery)- Fix URL detection (RHBZ #1472847)
- Do not remove downloaded files with --destdir option (RHBZ #1498426)
- Fix handling of conditional packages in comps (RHBZ #1427144)- Update to 2.7.2-1
- Added new option ``--comment=<comment>`` that adds a comment to transaction in history
- :meth:`dnf.Base.pre_configure_plugin` configure plugins by running their pre_configure() method
- Added pre_configure() methotd for plugins and commands to configure dnf before repos are loaded
- Resolves: rhbz#1421478 - dnf repository-packages: error: unrecognized arguments: -x rust-rpm-macros
- Resolves: rhbz#1491560 - 'dnf check' reports spurious "has missing requires of" errors
- Resolves: rhbz#1465292 - DNF remove protected duplicate package
- Resolves: rhbz#1279001 - [RFE] Missing dnf --downloaddir�x������������� ��������X��%�
�/8�.��$>����������������.�/�-��RHBZ #630667)- Fixing release number for modules- Update to 5.12.2
- Removed one hardcoded occurence of perl version in build process
- Added correct path to dtrace binary
- BuildRequires: systemtap-sdt-devel- run Configure with -Dusedtrace for systemtap support- Run tests in parallel
- Add "-Wl,--enable-new-dtags" to linker to allow to override perl's rpath by
  LD_LIBRARY_PATH used in tests. Otherwise tested perl would link to old
  in-system libperl.so.
- Normalize spec file indentation- 617956 move perlxs* docs files into perl-devel- 614662 wrong perl-suidperl version in obsolete- add temporary compat provides needed on s390(x)- Add Digest::SHA requirement to perl-CPAN and perl-CPANPLUS (bug #612563)- 607505 add another dir into Module::Build (thanks to Paul Howarth)- Address perl-Compress-Raw directory ownership (BZ 607881).- remove patch with debugging symbols, which should be now ok without it
- update to 5.12.1
- MODULE_COMPAT- packages in buildroot needs MODULE_COMPAT 5.10.1, add it back for rebuild- rebuild with tests in test buildroot- MODULE_COMPAT 5.12.0
- remove BR man
- clean configure
- fix provides/requires in IO-Compress- rebuild 5.12.0 without MODULE_COMPAT- initial 5.12.0 build- 463773 remove useless txt files from installation
- 575842 remove PERL_USE_SAFE_PUTENV, use perl putenv- package tests in their own subpackage- add noarch into correct sub-packages
- move Provides/Obsoletes into correct modules from main perl- restore missing version macros for Compress::Raw::Zlib, IO::Compress::Base
  and IO::Compress::Zlib- clean spec a little more
- rebuild with new gdbm- fix license according to advice from legal
- clean unused patches- update subpackage tests macros to handle packages with an epoch properly- add initial EXPERIMENTAL tests subpackage rpm macros to macros.perl- 547656 CVE-2009-3626 perl: regexp matcher crash on invalid UTF-8 characters  
- 549306 version::Internals should be packaged in perl-version subpackage
- Parse-CPAN-Meta updated and separate package is dead- subpackage parent and Parse-CPAN-Meta; add them to core's dep list- exclude "parent".- exclude Parse-CPAN-Meta.- do not pack Bzip2 manpages either (#544582)- do not pack Bzip2 modules (#544582)
- hack: cheat about Compress::Raw::Zlib version (#544582)- switch off check for ppc64 and s390x
- remove the hack for "make test," it is no longer needed- be more careful with the libperl.so compatibility symlink (#543936)- new upstream version
- release number must be high, because of stale version numbers of some
  of the subpackages
- drop upstreamed patches
- update the versions of bundled modules
- shorten the paths in @INC
- build without DEBUGGING
- implement compatibility measures for the above two changes, for a short
  transition period
- provide perl(:MODULE_COMPAT_5.10.0), for that transition period only- fix patch-update-Compress-Raw-Zlib.patch (did not patch Zlib.pm)
- update Compress::Raw::Zlib to 2.023
- update IO::Compress::Base, and IO::Compress::Zlib to 2.015 (#542645)- 542645 update IO-Compress-Base- back out perl-5.10.0-spamassassin.patch (#528572)- add /perl(UNIVERSAL)/d; /perl(DB)/d to perl_default_filter auto-provides
  filtering- update Storable to 2.21- update our Test-Simple update to 0.92 (patch by Iain Arnell), #519417
- update Module-Pluggable to 3.9- fix macros.perl *sigh*- Remove -DDEBUGGING=-g, we are not ready yet.- add helper filtering macros to -devel, for perl-* package invocation
  (#502402)- Add configure option -DDEBUGGING=-g (#156113)- 510127 spam assassin suffer from tainted bug- 494773 much better swap logic to support reentrancy and fix assert failure (rt #60508)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix generated .ph files so that they no longer cause warnings (#509676)
- remove PREREQ_FATAL from Makefile.PL's processed by miniperl
- update to latest Scalar-List-Utils (#507378)
- perl-skip-prereq.patch: skip more prereq declarations in Makefile.PL files- re-enable tests- move -DPERL_USE_SAFE_�x����������������������X��$�
��������P�p�$`����������������poq�-3COPYING.GPLv2COPYING.ISCCOPYING.LGPLv2.1COPYING.UCButil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.mocal.1.gzchrt.1.gzcol.1.gzcolcrt.1.gzcolrm.1.gzcolumn.1.gzdmesg.1.gzeject.1.gzfallocate.1.gzfincore.1.gzflock.1.gzgetopt.1.gzhexdump.1.gzionice.1.gzipcmk.1.gzipcrm.1.gzipcs.1.gzkill.1.gzlast.1.gzlastb.1.gzlogger.1.gzlogin.1.gzlook.1.gzlscpu.1.gzlsipc.1.gzlslogins.1.gzlsmem.1.gzmcookie.1.gzmesg.1.gzmore.1.gzmountpoint.1.gznamei.1.gznsenter.1.gzprlimit.1.gzrename.1.gzrenice.1.gzrev.1.gzrunuser.1.gzscript.1.gzscriptreplay.1.gzsetpriv.1.gzsetsid.1.gzsetterm.1.gzsu.1.gztaskset.1.gzul.1.gzunshare.1.gzutmpdump.1.gzuuidgen.1.gzuuidparse.1.gzwall.1.gzwhereis.1.gzwrite.1.gzfstab.5.gzterminal-colors.d.5.gzaddpart.8.gzagetty.8.gzblkdiscard.8.gzblkid.8.gzblkzone.8.gzblockdev.8.gzcfdisk.8.gzchcpu.8.gzchmem.8.gzclock.8.gzctrlaltdel.8.gzdelpart.8.gzfdformat.8.gzfdisk.8.gzfindfs.8.gzfindmnt.8.gzfsck.8.gzfsck.cramfs.8.gzfsck.minix.8.gzfsfreeze.8.gzfstrim.8.gzhwclock.8.gzi386.8.gzisosize.8.gzldattach.8.gzlinux32.8.gzlinux64.8.gzlosetup.8.gzlsblk.8.gzlslocks.8.gzlsns.8.gzmkfs.8.gzmkfs.cramfs.8.gzmkfs.minix.8.gzmkswap.8.gzmount.8.gznologin.8.gzpartx.8.gzpivot_root.8.gzraw.8.gzrawdevices.8.gzreadprofile.8.gzresizepart.8.gzrfkill.8.gzrtcwake.8.gzsetarch.8.gzsfdisk.8.gzsulogin.8.gzswaplabel.8.gzswapoff.8.gzswapon.8.gzswitch_root.8.gzumount.8.gzuname26.8.gzwdctl.8.gzwipefs.8.gzx86_64.8.gzzramctl.8.gz/etc//etc/pam.d//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/00//usr/lib/.build-id/01//usr/lib/.build-id/06//usr/lib/.build-id/1b//usr/lib/.build-id/1d//usr/lib/.build-id/23//usr/lib/.build-id/26//usr/lib/.build-id/29//usr/lib/.build-id/2b//usr/lib/.build-id/2d//usr/lib/.build-id/2f//usr/lib/.build-id/34//usr/lib/.build-id/35//usr/lib/.build-id/36//usr/lib/.build-id/37//usr/lib/.build-id/39//usr/lib/.build-id/3d//usr/lib/.build-id/3e//usr/lib/.build-id/43//usr/lib/.build-id/4b//usr/lib/.build-id/4f//usr/lib/.build-id/53//usr/lib/.build-id/56//usr/lib/.build-id/57//usr/lib/.build-id/5a//usr/lib/.build-id/5c//usr/lib/.build-id/5e//usr/lib/.build-id/5f//usr/lib/.build-id/6a//usr/lib/.build-id/6d//usr/lib/.build-id/6f//usr/lib/.build-id/71//usr/lib/.build-id/74//usr/lib/.build-id/78//usr/lib/.build-id/7a//usr/lib/.build-id/7f//usr/lib/.build-id/81//usr/lib/.build-id/86//usr/lib/.build-id/8a//usr/lib/.build-id/93//usr/lib/.build-id/97//usr/lib/.build-id/99//usr/lib/.build-id/9d//usr/lib/.build-id/9f//usr/lib/.build-id/a1//usr/lib/.build-id/a3//usr/lib/.build-id/a7//usr/lib/.build-id/ab//usr/lib/.build-id/ad//usr/lib/.build-id/af//usr/lib/.build-id/b2//usr/lib/.build-id/b3//usr/lib/.build-id/b4//usr/lib/.build-id/b5//usr/lib/.build-id/b7//usr/lib/.build-id/b9//usr/lib/.build-id/bb//usr/lib/.build-id/be//usr/lib/.build-id/c2//usr/lib/.build-id/c4//usr/lib/.build-id/c5//usr/lib/.build-id/c6//usr/lib/.build-id/c9//usr/lib/.build-id/cb//usr/lib/.build-id/ce//usr/lib/.build-id/cf//usr/lib/.build-id/d2//usr/lib/.build-id/d5//usr/lib/.build-id/da//usr/lib/.build-id/dd//usr/lib/.build-id/de//usr/lib/.build-id/df//usr/lib/.build-id/e0//usr/lib/.build-id/e1//usr/lib/.build-id/e9//usr/lib/.build-id/f0//usr/lib/.build-id/f5//usr/lib/.build-id/fa//usr/lib/.build-id/fc//usr/lib/.build-id/fd//usr/lib/.build-id/ff//usr/lib/systemd/system//usr/lib/udev/rules.d//usr/sbin//usr/share/bash-completion/completions//usr/share/doc//usr/share/doc/util-linux//usr/share/licenses//usr/share/licenses/util-linux//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/L�x�����ȗ�������XD�%�
ص�&�!�$�����������������!�!�!�
- update Compress::Raw::Zlib to 2.023
- update IO::Compress::Base, and IO::Compress::Zlib to 2.015 (#542645)- 542645 update IO-Compress-Base- back out perl-5.10.0-spamassassin.patch (#528572)- add /perl(UNIVERSAL)/d; /perl(DB)/d to perl_default_filter auto-provides
  filtering- update Storable to 2.21- update our Test-Simple update to 0.92 (patch by Iain Arnell), #519417
- update Module-Pluggable to 3.9- fix macros.perl *sigh*- Remove -DDEBUGGING=-g, we are not ready yet.- add helper filtering macros to -devel, for perl-* package invocation
  (#502402)- Add configure option -DDEBUGGING=-g (#156113)- 510127 spam assassin suffer from tainted bug- 494773 much better swap logic to support reentrancy and fix assert failure (rt #60508)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix generated .ph files so that they no longer cause warnings (#509676)
- remove PREREQ_FATAL from Makefile.PL's processed by miniperl
- update to latest Scalar-List-Utils (#507378)
- perl-skip-prereq.patch: skip more prereq declarations in Makefile.PL files- re-enable tests- move -DPERL_USE_SAFE_PUTENV to ccflags (#508496)- #504386 update of Compress::Raw::Zlib 2.020- update File::Spec (PathTools) to 3.30- fix #221113, $! wrongly set when EOF is reached- do not use quotes in patchlevel.h; it breaks installation from cpan (#495183)- update CGI to 3.43, dropping upstreamed perl-CGI-escape.patch- fix CGI::escape for all strings (#472571)
- perl-CGI-t-util-58.patch: Do not distort lib/CGI/t/util-58.t
  http://rt.perl.org/rt3/Ticket/Display.html?id=64502- Move the gargantuan Changes* collection to -devel (#492605)- update module autodie- update Digest::SHA (fixes 489221)- drop 26_fix_pod2man_upgrade (don't need it)
- fix typo in %define ExtUtils_CBuilder_version- apply Change 34507: Fix memory leak in single-char character class optimization
- Reorder @INC, based on b9ba2fadb18b54e35e5de54f945111a56cbcb249
- fix Archive::Extract to fix test failure caused by tar >= 1.21
- Merge useful Debian patches- remove compatibility obsolete sitelib directories
- use a better BuildRoot
- drop a redundant mkdir in %install
- call patchlevel.h only once; rm patchlevel.bak
- update modules Sys::Syslog, Module::Load::Conditional, Module::CoreList,
  Test::Harness, Test::Simple, CGI.pm (dropping the upstreamed patch),
  File::Path (that includes our perl-5.10.0-CVE-2008-2827.patch),
  constant, Pod::Simple, Archive::Tar, Archive::Extract, File::Fetch,
  File::Temp, IPC::Cmd, Time::HiRes, Module::Build, ExtUtils::CBuilder
- standardize the patches for updating embedded modules
- work around a bug in Module::Build tests bu setting TMPDIR to a directory
  inside the source tree- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add /usr/lib/perl5/site_perl to otherlibs (bz 484053)- build sparc64 without _smp_mflags- limit sparc builds to -j12- update IPC::Cmd to v 0.42- 455410 http://rt.perl.org/rt3/Public/Bug/Display.html?id=54934
  Attempt to free unreferenced scalar fiddling with the symbol table
  Keep the refcount of the globs generated by PerlIO::via balanced.- add missing XHTML.pm into Pod::Simple- 295021 CVE-2007-4829 perl-Archive-Tar directory traversal flaws
- add another source for binary files, which test untaring links- to fix Fedora bz 473223, which is really perl bug #54186 (http://rt.perl.org/rt3//Public/Bug/Display.html?id=54186)
  we apply Changes 33640, 33881, 33896, 33897- change summary according to RFC fix summary discussion at fedora-devel :)- update File::Temp to 0.20- Include fix for rt#52740 to fix a crash when using Devel::Symdump and
  Compress::Zlib together- rt#33242, rhbz#459918. Segfault after reblessing objects in Storable.
- rhbz#465728 upgrade Simple::Pod to 3.07- also preserve the timestamp of AUTHORS; move the fix to the recode
  function, which is where the stamps go wrong- give Changes*.gz the same datetime to avoid multilib conflict- remove Tar.pm from Archive-Extract
- fix version of Test::Simple in spec
- update Test::Simple
�x�������������xt�������X��%�
��8�������9��$)����������������9�:�8��r <ppisar@redhat.com> - 4:5.16.2-257Petr Pisar <ppisar@redhat.com> - 4:5.16.2-256Petr Pisar <ppisar@redhat.com> - 4:5.16.2-255Petr Pisar <ppisar@redhat.com> - 4:5.16.2-254Petr Pisar <ppisar@redhat.com> - 4:5.16.2-253Petr Pisar <ppisar@redhat.com> - 4:5.16.2-252Petr Pisar <ppisar@redhat.com> - 4:5.16.2-251Petr Pisar <ppisar@redhat.com> - 4:5.16.2-250Petr Pisar <ppisar@redhat.com> - 4:5.16.2-249Petr Pisar <ppisar@redhat.com> - 4:5.16.2-248Petr Pisar <ppisar@redhat.com> - 4:5.16.2-247Petr Pisar <ppisar@redhat.com> - 4:5.16.2-246Petr Pisar <ppisar@redhat.com> - 4:5.16.2-245Petr Pisar <ppisar@redhat.com> - 4:5.16.2-244Petr Pisar <ppisar@redhat.com> - 4:5.16.2-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.2-242Petr Pisar <ppisar@redhat.com> - 4:5.16.1-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.1-240Petr Pisar <ppisar@redhat.com> - 4:5.16.1-239Petr Pisar <ppisar@redhat.com> - 4:5.16.1-238Petr Pisar <ppisar@redhat.com> - 4:5.16.1-237Petr Pisar <ppisar@redhat.com> - 4:5.16.1-236Petr Pisar <ppisar@redhat.com> - 4:5.16.1-235Petr Pisar <ppisar@redhat.com> - 4:5.16.1-234Petr Pisar <ppisar@redhat.com> - 4:5.16.1-233Petr Pisar <ppisar@redhat.com> - 4:5.16.1-232Petr Pisar <ppisar@redhat.com> - 4:5.16.1-231Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-230Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-229Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.1-228Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.16.0-227Paul Howarth <paul@city-fan.org> 4:5.16.0-226Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.0-225Petr Pisar <ppisar@redhat.com> - 4:5.16.0-224Petr Pisar <ppisar@redhat.com> - 4:5.16.0-223Petr Pisar <ppisar@redhat.com> - 4:5.16.0-222Petr Pisar <ppisar@redhat.com> - 4:5.16.0-221Petr Pisar <ppisar@redhat.com> - 4:5.16.0-220Petr Pisar <ppisar@redhat.com> - 4:5.16.0-219Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.0-218Petr Pisar <ppisar@redhat.com> - 4:5.16.0-218Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-217Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-RC2-217Petr Pisar <ppisar@redhat.com> - 4:5.14.2-216Petr Pisar <ppisar@redhat.com> - 4:5.14.2-215Petr Pisar <ppisar@redhat.com> - 4:5.14.2-214Petr Pisar <ppisar@redhat.com> - 4:5.14.2-213Petr Pisar <ppisar@redhat.com> - 4:5.14.2-212Petr Pisar <ppisar@redhat.com> - 4:5.14.2-211Paul Howarth <paul@city-fan.org> - 4:5.14.2-210Iain Arnell <iarnell@gmail.com> -4:5.14.2-209Paul Howarth <paul@city-fan.org> - 4:5.14.2-208Petr Pisar <ppisar@redhat.com> - 4:5.14.2-207Petr Pisar <ppisar@redhat.com> - 4:5.14.2-206Petr Pisar <ppisar@redhat.com> - 4:5.14.2-205Ville Skyttä <ville.skytta@iki.fi> - 4:5.14.2-204Petr Pisar <ppisar@redhat.com> - 4:5.14.2-203Petr Pisar <ppisar@redhat.com> - 4:5.14.2-202Petr Pisar <ppisar@redhat.com> - 4:5.14.2-201Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-200Petr Pisar <ppisar@redhat.com> - 4:5.14.2-199Petr Pisar <ppisar@redhat.com> - 4:5.14.2-198Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-197Petr Pisar <ppisar@redhat.com> - 4:5.14.2-196Petr Pisar <ppisar@redhat.com> - 4:5.14.2-195Iain Arnell <iarnell@gmail.com> 4:5.14.2-194Petr Pisar <ppisar@redhat.com> - 4:5.14.2-193Petr Pisar <ppisar@redhat.com> - 4:5.14.1-192Petr Pisar <ppisar@redhat.com> - 4:5.14.1-191Petr Pisar <ppisar@redhat.com> - 4:5.14.1-190Petr Pisar <ppisar@redhat.com> - 4:5.14.1-189Petr Pisar <ppisar@redhat.com> - 4:5.14.1-188Petr Pisar <ppisar@redhat.com> - 4:5.14.1-187Iain Arnell <iarnell@gmail.com> 4:5.14.1-186Petr Sabata <contyk@redhat.com> - 4:5.14.1-185Iain Arnell <iarnell@gmail.com> 4:5.14.1-184Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-183Paul Howarth <paul@city-fan.org> - 4:5.14.1-182Petr Sabata <contyk@redhat.com> - 4:5.14.1-181Iain Arnell <iarnell@gmail.com> 4:5.14.1-180Iain Arnell <iarnell@gmail.com> 4:5.14.1-179Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-178Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-175Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-174Iain Ar�x��������������c�������X�x%�
pP��
1Y�$!����������������1Y2Y0Y��x�����>	HS�������X��%�
�>
�q������|!�$l����������������|!{!}!�se bytes" (RT#130703)
- Fix a buffer overflow when studying some regexps repeatedly
  (RT#129281, RT#129061)- Fix UTF-8 string handling in & operator (RT#129287)
- Fix recreation of *:: (RT#129869)
- Fix a memory leak in B::RHE->HASH method (RT#130504)
- Fix parsing goto statements in multicalled subroutine (RT#113938)
- Fix a heap overlow in parsing $# (RT#129274)- Fix a buffer overflow in split in scalar context (RT#130262)
- Fix a heap overflow with pack "W" (RT129149)
- Fix a use-after-free when processing scalar variables in forms (RT#129125)
- Fix a heap overflow if invalid octal or hexadecimal number is used in
  transliteration expression (RT#129342)
- Fix out-of-bound read in case of unmatched regexp backreference (RT#129377)- 5.24.1 bump (see <http://search.cpan.org/dist/perl-5.24.1/pod/perldelta.pod>
  for release notes)- Rebuild for readline 7.x- Remove bundled Math-BigInt-FastCalc (bug #1408463)
- Remove bundled Math-BigRat (bug #1408467)
- Remove bundled bignum (bug #1409585)- Fix a crash in optimized evaluation of "or ((0) x 0))" (RT#130247)
- Fix a memory leak in IO::Poll (RT#129788)
- Fix regular expression matching (RT#130307)- Fix crash in Storable when deserializing malformed code reference
  (RT#68348, RT#130098)
- Fix crash on explicit return from regular expression substitution (RT#130188)
- Tighten dependencies between architecture specific sub-packages to ISA
- Fix assigning split() return values to an array
- Fix const correctness in hv_func.h (bug #1242980)- Tie perl-Errno release to interpreter build because of kernel version check
  (bug #1393421)- Fix crash in "evalbytes S" (RT#129196)
- Fix crash in splice (RT#129164, RT#129166, RT#129167)
- Fix string overrun in Perl_gv_fetchmethod_pvn_flags (RT#129267)
- Fix crash when matching UTF-8 string with non-UTF-8 substrings (RT#129350)
- Fix parsing perl options in shell bang line (RT#129336)
- Fix firstchar bitmap under UTF-8 with prefix optimization (RT#129950)
- Avoid infinite loop in h2xs tool if enum and type have the same name
  (RT130001)
- Fix stack handling when calling chdir without an argument (RT#129130)- perl-core depends on Parse::CPAN::Meta module instead of package name to allow
  upgrading perl-CPAN-Meta to 2.150010 (bug #1370681)- Avoid loading of modules from current directory, CVE-2016-1238, (bug #1360425)- Fix handling \N{} in tr for characters in range 128--255 (RT#128734)- Fix building without perl in the build root
- Own systemtap directories by perl-devel- Fix a crash in lexical scope warnings (RT#128597)- Fix a crash in "Subroutine redefined" warning (RT#128257)- Fix a crash when vivifying a stub in a deleted package (RT#128532)- Do not let XSLoader load relative paths (CVE-2016-6185)- Fix line numbers with perl -x (RT#128508)- Do not crash when inserting a non-stash into a stash (RT#128238)- Do not use unitialized memory in $h{\const} warnings (RT#128189)
- Fix precedence in hv_ename_delete (RT#128086)
- Do not treat %: as a stash (RT#128238)- Fix compiling regular expressions like /\X*(?0)/ (RT#128109)- Do not mangle errno from failed socket calls (RT#128316)- Fix a memory leak when compiling a regular expression with a POSIX class
  (RT#128313)- Remove reflexive dependencies
- Use pregenerated dependencies on bootstrapping
- Specify more build-time dependencies- Stop providing old perl(MODULE_COMPAT_5.22.*)
- Update license tags- 5.24.0 bump (see <http://search.cpan.org/dist/perl-5.24.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages; Update or remove patches- 5.22.2 bump (see <http://search.cpan.org/dist/perl-5.22.2/pod/perldelta.pod>
  for release notes)- Weak perl-Encode-devel dependency on perl-devel to Recommends level
  (bug #1129443)
- Remove perl-ExtUtils-ParseXS dependency on perl-devel (bug #1129443)
- Require perl-devel by perl-ExtUtils-MakeMaker
- Provide MM::maybe_command independently (bug #1129443)
- Replace ExtUtils::MakeMaker dependency with ExtUtils::MM::Utils in IPC::Cmd
  (bug #1129443)
- Remove perl-ExtUtils-Install dependency on �x��������������B�������X��%�
��	�]������L��$\����������������L�M�K��f291bb2305ec9c43b9a84ad5f2342bdc8940f002512b693205da74c58474b0457c0abb5aad1039250b135335ab7103834b60336c29301695bc97f21e4ab370dbe97efb310aac6d36dc1bd979c817cc083eea34485522313b613b15bc3e4359fb18829024ac9f27f37700b481a0916eb5f2233cc8c6da3a263bd716ba020218783d2b5ac461aab6118483414afbe26afb2c3eae7e9828dccbefc4a2fac00a148187e5a8ca6f18dc6883bf401a5d88d77d2a25f41279a8597b84c62b0ed134a8b5c141643e9bef8711812d8dab39002218b35a267cc0c4dee248ff9cd67a76022a41e19541fbc63857818645c2abe1c2544e1472e4de3c789ed89db516a274a8e18b3a1e0591afb618e5df9ec688670d5e2d3c0cca7d474d447cf79e473228ab9a0826b4dd47ebfad3d503917ce737f678089010d3f91313fce38b539cb3fa3f7865b261a8b4adf6443b27aad6c5bf2c734f02b7d19f07de5f32645e5750e98cf4e7817516f83c2df5b22028b08567123f786dc7431314b0f684fa82c1395d3b4c30e8f4f6da5bcc3999ad4178274fbe4fdd933bcce0969880ce06063f838e5706d1b6b382abfea6f3fcd7f3b9e5dace6b426f8effe8e0b699862841ca46774f29162799810165265f0fc066d2200cb757a14181030c1e8a61d094d64734345a826c9838f361dbf252c711efc4472eebf39433f3a94a02e2a4f5d434978d5fa8e6124d1ec5f78007540d2234b954366012056de48c63860bc375f4a880f779dd046d2c2898c92a6980777d374755d98ce54a76fe4bad7375128cd77599411d8c25ea2deb1113494b1eeb876e95b56c86856a754ccaa2467ad527824b017736b4d2353587024fc0d76fd04adc4e10aeab2d0ee919dfa22bdf195efc67d4d960701aba4a83311b2b4cf4fe76cbdfc73380cd42da3d39df04bf69a50314e897c1802a1a932f19e333e7351bff952915799c977828aa9874a2e4dfe1044f4c5ccbfb1f0178c75be681d0437cca409b7daad495605b5e1da13ab708972979b51a5183f51e27c0584b6c84ffd5349143a26b9c68a4de3493fc08185047e85435055cb4c75e941e570072dd7b6239a6cb594f03dc4fd9a95b1f031de0d7bd51a1db06c5f7cbfe90cf02117ae3153dcaf3005a13c3a6316ea71e8253fdc55e6941769bcd30492b62358faf56c4a2374a927d403943480a0586081b042701b4ae2314f59ea8913fc3f4d84ab357cb1d8eef5bde716827fdf502681a66ae55bd789a2e1a6885545159a2d535f94b1beb8b82b22a77bf60e938485224bb9239513bc2c0fe0c2c2a49c9bf0b761c49ffb8f44108df0190177390277347167fff6b234f1b64786e9366954877597724e5d41b86abf4e79b1bf6fe7203cc60721a2cfa1dd5d1569381366039f5ff29d5158c2af6d132c7c074b8f4f122a39e3f11715780d14901705179c5ff858c96b8466afb8c66209844352e1b8c0b9d2343c853ec1bb6364ad4598b12b1f538a15d28caf942f72a0e057b4140e508374d5cc54d1b059f94058a1e3659bc95b14d842c543bd2697c4d26ae6fb2878e3549ad09490330909f81ae68dec951ed353df6e0e1ee2aa6cfd962729a14c70a734af191dd9cbaf638e38659ce21d7d6590bb6ba59b2ddf7f874acea2f403163f9ae27109b3a7a547471e64095c3eb94269beaf00c327b5b0cfff235c5a6f0b18bf97d85a8021e40c4b2f1b7a3700de22e5f5be423aa320ec9a7ddf2e63ae95eb154d9e9496b6d972400d2ce4c238bdf5326e609ba9e4cb427740bd1f65399fcd162e281dcca8f995020811ed8442850a006396233fa7ef4f1d3ad64c9180b0d3df2ac33d3c16170490fff8aef478ab77d02c93950cedf4ecd6be86794961014f5701d779205b1fbe4982d5e628bbaa5bee8d5793fefdb6a548cbf7698a1a1f2ce23832ca45a0a46674b63330807e4e9795aa95e68c84add08140f81f40ad3901408f8c64d2f858f3d61b1492e020579a46b93a9426ec51e88c476332447fb25ec766aacefd6181bfad905bba96965f19e82eec485c3d312d9ecbce9839ce32292431c920f3a1b9d7ace886ec7d07611ebcbea010e0bd4212e03813708156a3961047f3d440dc73fb39fa782034cd97a86b414a08da95c7872d15104c06a719ef3a6ef77989b83c9b273767c7c9cdd8b847e91182f0bf688acf79a0fb490e726ef8769ec6704553493acbfc0b148aeab03fe49ef17f62ceb7a772d7fc5fe3c4c540a79e627934488e1704e4233bbca8b59cfcd4ed22d8be4525bd09505bc60ecae41d76e5a369a00c9a891f6de538942cfeb4f3ee30d5d606dd0d0eeb72fc03de9260c57a8497a2ca72e921fcf8beabeacfd8e99d9f6fb5e9b9efa318c7ec96a330317445e47654f18be13f16d065847b1386c068a33334fafc6e568fd236ddd01a29e99f65b001ae57767dea4e611b8048c3780ad657cc414a86763f96866b52adac87aab5150123fcace0b68135e64240a82a122cab0ad124757a6d4d6db39284bd7b349794aaaefb20cb14907c2c4745ae4e20fe8f558e9a16a9984ddec73e43b9f481aabda6f89d9a3e221cc9ebe59b339eaec6c375bd49fe9bf4cda86c96b3f827cab53d030b4c7b65c6817a5ef6e8ec54eafae17d86ccdf33c466b7ea200b5fe30e800f510f6ea6d1fdf66d15f2b75b35e6be3b4968846f2774f3d93f54ca5f67ebb4c6aa37027c2daf38a1b88b7052b3ea0a137ab9d109aac47584996329395a5bc61faad006d0872be6d6ef6868420979c117208080f682e2fadf8288e346188ca1e3d3b4e87036f597646907627644e3d6d8fbff743f2f7�x�������������82�������X�s%�
p�P]6Y�$&����������������6Y7Y5Y�et_check_crl.3ssl.gzX509_STORE_CTX_get_check_issued.3ssl.gzX509_STORE_CTX_get_check_policy.3ssl.gzX509_STORE_CTX_get_check_revocation.3ssl.gzX509_STORE_CTX_get_cleanup.3ssl.gzX509_STORE_CTX_get_crl_fn.3ssl.gzX509_STORE_CTX_get_current_cert.3ssl.gzX509_STORE_CTX_get_error.3ssl.gzX509_STORE_CTX_get_error_depth.3ssl.gzX509_STORE_CTX_get_ex_data.3ssl.gzX509_STORE_CTX_get_ex_new_index.3ssl.gzX509_STORE_CTX_get_get_crl.3ssl.gzX509_STORE_CTX_get_get_issuer.3ssl.gzX509_STORE_CTX_get_issuer_fn.3ssl.gzX509_STORE_CTX_get_lookup_certs.3ssl.gzX509_STORE_CTX_get_lookup_crls.3ssl.gzX509_STORE_CTX_get_num_untrusted.3ssl.gzX509_STORE_CTX_get_verify.3ssl.gzX509_STORE_CTX_get_verify_cb.3ssl.gzX509_STORE_CTX_init.3ssl.gzX509_STORE_CTX_lookup_certs_fn.3ssl.gzX509_STORE_CTX_lookup_crls_fn.3ssl.gzX509_STORE_CTX_new.3ssl.gzX509_STORE_CTX_set0_crls.3ssl.gzX509_STORE_CTX_set0_param.3ssl.gzX509_STORE_CTX_set0_trusted_stack.3ssl.gzX509_STORE_CTX_set0_untrusted.3ssl.gzX509_STORE_CTX_set0_verified_chain.3ssl.gzX509_STORE_CTX_set_cert.3ssl.gzX509_STORE_CTX_set_current_cert.3ssl.gzX509_STORE_CTX_set_default.3ssl.gzX509_STORE_CTX_set_error.3ssl.gzX509_STORE_CTX_set_error_depth.3ssl.gzX509_STORE_CTX_set_ex_data.3ssl.gzX509_STORE_CTX_set_verify.3ssl.gzX509_STORE_CTX_set_verify_cb.3ssl.gzX509_STORE_CTX_verify_cb.3ssl.gzX509_STORE_CTX_verify_fn.3ssl.gzX509_STORE_add_cert.3ssl.gzX509_STORE_add_crl.3ssl.gzX509_STORE_add_lookup.3ssl.gzX509_STORE_free.3ssl.gzX509_STORE_get0_objects.3ssl.gzX509_STORE_get0_param.3ssl.gzX509_STORE_get_cert_crl.3ssl.gzX509_STORE_get_check_crl.3ssl.gzX509_STORE_get_check_issued.3ssl.gzX509_STORE_get_check_policy.3ssl.gzX509_STORE_get_check_revocation.3ssl.gzX509_STORE_get_cleanup.3ssl.gzX509_STORE_get_ex_data.3ssl.gzX509_STORE_get_ex_new_index.3ssl.gzX509_STORE_get_get_crl.3ssl.gzX509_STORE_get_get_issuer.3ssl.gzX509_STORE_get_lookup_certs.3ssl.gzX509_STORE_get_lookup_crls.3ssl.gzX509_STORE_get_verify_cb.3ssl.gzX509_STORE_load_locations.3ssl.gzX509_STORE_lock.3ssl.gzX509_STORE_new.3ssl.gzX509_STORE_set1_param.3ssl.gzX509_STORE_set_cert_crl.3ssl.gzX509_STORE_set_check_crl.3ssl.gzX509_STORE_set_check_issued.3ssl.gzX509_STORE_set_check_policy.3ssl.gzX509_STORE_set_check_revocation.3ssl.gzX509_STORE_set_cleanup.3ssl.gzX509_STORE_set_default_paths.3ssl.gzX509_STORE_set_depth.3ssl.gzX509_STORE_set_ex_data.3ssl.gzX509_STORE_set_flags.3ssl.gzX509_STORE_set_get_crl.3ssl.gzX509_STORE_set_get_issuer.3ssl.gzX509_STORE_set_lookup_certs.3ssl.gzX509_STORE_set_lookup_crls.3ssl.gzX509_STORE_set_lookup_crls_cb.3ssl.gzX509_STORE_set_purpose.3ssl.gzX509_STORE_set_trust.3ssl.gzX509_STORE_set_verify.3ssl.gzX509_STORE_set_verify_cb.3ssl.gzX509_STORE_set_verify_cb_func.3ssl.gzX509_STORE_set_verify_func.3ssl.gzX509_STORE_unlock.3ssl.gzX509_STORE_up_ref.3ssl.gzX509_VAL_free.3ssl.gzX509_VAL_new.3ssl.gzX509_VERIFY_PARAM_add0_policy.3ssl.gzX509_VERIFY_PARAM_add1_host.3ssl.gzX509_VERIFY_PARAM_clear_flags.3ssl.gzX509_VERIFY_PARAM_get0_peername.3ssl.gzX509_VERIFY_PARAM_get_auth_level.3ssl.gzX509_VERIFY_PARAM_get_depth.3ssl.gzX509_VERIFY_PARAM_get_flags.3ssl.gzX509_VERIFY_PARAM_get_hostflags.3ssl.gzX509_VERIFY_PARAM_get_inh_flags.3ssl.gzX509_VERIFY_PARAM_get_time.3ssl.gzX509_VERIFY_PARAM_set1_email.3ssl.gzX509_VERIFY_PARAM_set1_host.3ssl.gzX509_VERIFY_PARAM_set1_ip.3ssl.gzX509_VERIFY_PARAM_set1_ip_asc.3ssl.gzX509_VERIFY_PARAM_set1_policies.3ssl.gzX509_VERIFY_PARAM_set_auth_level.3ssl.gzX509_VERIFY_PARAM_set_depth.3ssl.gzX509_VERIFY_PARAM_set_flags.3ssl.gzX509_VERIFY_PARAM_set_hostflags.3ssl.gzX509_VERIFY_PARAM_set_inh_flags.3ssl.gzX509_VERIFY_PARAM_set_purpose.3ssl.gzX509_VERIFY_PARAM_set_time.3ssl.gzX509_VERIFY_PARAM_set_trust.3ssl.gzX509_add1_ext_i2d.3ssl.gzX509_add_ext.3ssl.gzX509_chain_up_ref.3ssl.gzX509_check_ca.3ssl.gzX509_check_email.3ssl.gzX509_check_host.3ssl.gzX509_check_ip.3ssl.gzX509_check_ip_asc.3ssl.gzX509_check_issued.3ssl.gzX509_check_private_key.3ssl.gzX509_check_purpose.3ssl.gzX509_cmp.3ssl.gzX509_cmp_c�x��������������!�������X��%�
�P�p!�$`����������������p!o!q!�31a656376b76c41bf043dcbdfbf61f9120612f579702c5f179f9677f4fd67aef63fa3c88ad69805564a4a8d438352335794377f689f866cd93cf215f338b1f0fe52d5912abfb4ab9f960dfea020396b05f5558a8ac448fde0b5f94e3c29623484b1b2e8e88649a85579cc6c12e32facee37ac5c311b345234a4004d720bd28a8349caae8ca82acd190abd41c3c88c13bde37158857263371248f0184311dabf6bb118226a94c198ac52281349d66d00bf6cade3e6125dc982bee68aa9d6cc8ba2a06d06867a11ab7b4cdffd6fd2b22abf0abe3b379b6a87cc168271d0e0edb8d868a50de737c3f1334742d2bdb61e0222ac57920d1b64e2035d501eb34704d9a0c312a8a3e3477eb1e309f6c976df89bb642d58fa42eaff000dde8cbad401a369a0322590d1428b71a286048ffd941d9ae3696583d5332a503a895e95f16ebdf745cc064b83edcfe8cb360e6562c3ce0041fcf54f04e4d1ca7dfd51ca0560ebd5570dfbc36fbb6514ed1d69a09f28e2ff0988661a8fd329dc95433c6998891d6228d4badbec7e0aa2ec98fcb4b727b98e1a23d7d94f975c29041775f5a3afd700f99d63d891ef9b85258a09a0e5d4c1bcbc2bebffb52e9c49359a88d1bd0de16b60667544177b40e7175c2cf5940aad6d5f46ff27b2036c3cd0c0236b7c7bc3259a8169198ab60082797dbc93485b730222b44d2ec6c868bffae0efe4ad0f51b04e09e7d4c5b22d6b0041365ad017bb3c1703b0da6e5c43897548d8b71517483f4f0c6598b499902013880d90afb071d749f3ab1c575d280c3c7abebe425832de7920089d12f1ff9f5432c7e3c18e119cda2bbc55a9094bc3bb27ba3cd41d130eaa26f77811ff7c81eb3cbb61844fa63a7b54df9e23ff5e24e0ba40b140351549a177f6244f70a7568595c449f49f5610dd90df8058b34defa7fd591bbea9bd98b1d44642e2a537bb0b973b5e65e0aff8d6655c0814752ca78d9d255be68312128acb93fbbf91a0b0ac20049ee2f3d50fff5acd161eae24b356af7b4b7ffd949141344893bb51850435239813d410e7f2e1465826b19329f038505dd5d512f5e2cfa833615211dd877e2bbf47f7a965dde51ce869d576ad276742519bec6cdcc1e006b1b03a710b7970ce8c881d35018a47aa9a371d9903e78daf9a6d2f78fd6c7b0677e29f37a64c13f2bf3e466f311ee90f0b7fbccab073a54c5790a0259619ecd0a160a8cc9974519c8aaef4940a7cdb23a48c11ad27255f28c7c9be58c4c3180ca3f899af02ea13ae4ac9e3bbb5b3a97146d5f784818ccbae5acecfa0ffeef23de3f4c1993b1def915b2e183e7e606c7005f1f7f1a374d3336c56bc0f78181e84d70b6a9502a4ac7d7419fa3296fc0e4d77c43b4715bb49fba522a6b2a3cfb1dca7639a2fb23a5364f76eb4a0ae8a585bc1bb288d298024a562b012adca85026d8739eebe8c765ff166fd79f37da37076035a9d8b1932d33a57937a66ec7612a373cb6be1b3f05c8e36e8af7f1df163c968b665034592670512fe850ca07e86b7040a77066a90f1a75eab0846ef4aadf707d15fb4b147f1206e23a5cfbf80b749fe2dcdacea63482c3a84fc3f8619a43c2e00c42581065e3459603ae69a1c97f9c204e3a00c51c643e1f984ad93d188efe99f63297ae16627086e0fd9ef0a60137501915d69cfdc9d0213f1f68895bfbeafddd7260feaca221d40487d90f85e08352621989e21dff842524d4d343ce9543bb1ff872c5ee6336a61a7c9d1182d84ac1fc635c868460e23213c38f39867146387390bf9f643c86040230015dab4e9f46a5faec141bf39e309f2ff073e87f3e1ff1eaaf51f629c389b79d2160fe8e8d765c943598d5932604a0a7117c1bc0d1b865350bba29f155827c2dee0adb9a8b83b509fc4bde4c86c791e67f7a184edb34616f310489c6bde8e110b613d15628a7d311adb97f59ba0a3b8da68930dd6039ebcb873d43e8158685179fd41758f1d688333ab358bed16d5cf109afc7ef1b3286e4feca01461fe72b1596a89843363ba07a68b84b21049719f8e51bd12efdcfabd47bf14308bf8ab87acfb1967742487c2364e399a0df015e3cef0683b825317e4de66b93fdee377fb547a23bfe525fc1dd287f29536517f7780ed37d8524d0da2a8ba8cb324087bc0071a474be404f1b7f2fecd16f002f04ae23d6a058924c960d58c9d9694d4952ff7543ef100f22438cac6eded76d2d5126564088dc308854ac6475901d7829378c256fa6ec29e57ba4a33eb299b5e947b029ca64a99d0a5bb5f2e455b35513056b5435488278cc5f04b4fac9b3f7a853d92842c6730dc449bcf54a1b3e99a4ce0ad6d7884dda17ef0c3aaaf98543fffb1a83133ad7b6de7c0f7dd03463c54e4a295636dfa440a51d2b41a2a89f887f65d342e36203166214fdd67d8187f74cd4766e25b09e6890beb86d2a24c6ca8cf1ad86df74501c303c92b7ce7f5fbe3ca7b37f27105e0bd1fa81f8fab3edcc7685b541495d3cfc1dda698543edb07a700c04bac42952b08d01b78439d4fa25f67e0123c44a00010c0e5a6aa2c95ac6b8163176a616fb7e6ff95e93eb040ab4cdb57bdce4d0cb031bdb6aa3669585fdceb9a76262a4b0fd0f98b28385bd11987598f663a1efce913bf6eee7cc5acaa0ebf55f247d409132cb6b5fcbe80204d9a317f95fdb05a3f1d3cb49e25a857d7dd9001aa62c6368bb6c2803396a7e882af71bba5528b72c2f2d18eaa433e82469716a881b59806592a8e0b147b0f1a67b0163568eb77738ad3db6f64cf402cfc4bf300f5442b1ee79c9fa2f1de738afdcbb8e72deb3b1�x�������������X�������X��$�
���������#CX�$S����������������CXBXDX� IPy- Handle more reserved port types
- Replace aliases with corresponding type names- Fix RESOURCE_LEAK coverity scan defects- sepolicy: Update to work with setools-4.2.0
- gui: Make all polgen button labels translatable- sepolicy: Fix get_real_type_name to handle query failure properly- sepolicy: search() for dontaudit rules as well- setfiles: Improve description of -d switch
- Fix typo in newrole.1 manpage
- semanage: Stop rejecting aliases in semanage commands
- sepolicy: Stop rejecting aliases in sepolicy commands
- sepolicy: Fix "info" to search aliases as well
- sepolgen: fix refpolicy parsing of "permissive"
- sepolgen: return NotImplemented instead of raising it
- semanage: fix Python syntax of catching several exceptions
- semanage: Replace bare except with specific one
- semanage: Fix logger class definition
- semanage: Stop logging loginRecords changes
- add xperms support to audit2allow
- sepolgen: fix access vector initialization
- sepolgen: print all AV rules correctly- Update translations- sandbox: Use matchbox-window-manager instead of openbox (#1568295)- selinux-autorelabel: Use plymouth --quit rather then --hide-splash (#1592221)
- selinux-autorelabel: Increment boot_indeterminate grub environment variable (#1592221)
- Do not require libcgroup - it's not used anymore- Do not use symlinks to enable selinux-autorelabel-mark.service (#1589720)- Don't build the Python 2 subpackages (#1567354)- SELinux userspace 2.8 release- selinux-autorelabel: set UEFI boot order (BootNext) same as BootCurrent
- selinux-autorelabel: synchronize cached writes before reboot (#1385272)- Move semodule_* utilities to policycoreutils package (#1562549)- semanage/seobject.py: Fix undefined store check (#1559174)- Build python only subpackages as noarch
- Move semodule_package to policycoreutils-devel- sepolicy: Fix translated strings with parameters
- sepolicy: Support non-MLS policy
- sepolicy: Initialize policy.ports as a dict in generate.py
- gui/polgengui.py: Use stop_emission_by_name instead of emit_stop_by_name
- Minor update for bash completion
- semodule_package: fix semodule_unpackage man page
- gui/semanagePage: Close "edit" and "add" dialogues when successfull
- gui/fcontextPage: Set default object class in addDialog\
- sepolgen: fix typo in PolicyGenerator
- build: follow standard semantics for DESTDIR and PREFIX- Use Fedora RPM build flags (#1548740)- Fix mangling of python shebangs- Rename the python3 subpackage to have prefix, not suffix
- Use python3 prefixes in requires where possible- Rewrite selinux-polgengui to use Gtk3
- Drop python2 and gnome-python2 from gui Requires- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Require audit-libs-python2- Remove obsolete scriptlets- semanage: bring semanageRecords.set_reload back to seobject.py (#1527745)- semanage: make seobject.py backward compatible
- Own %{pythonX_sitelib}/site-packages/sepolicy directories (#1522942)- sepolicy: Fix sepolicy manpage
- semanage: Update Infiniband code to work on python3
- semanage: Fix export of ibendport entries
- semanage: Enforce noreload only if it's requested by -N option- restorecond: check write() and daemon() results
- sepolicy: do not fail when file_contexts.local or .subs do not exist
- sepolicy: remove stray space in section "SEE ALSO"
- sepolicy: fix misspelling of _ra_content_t suffix
- gui: port to Python 3 by migrating to PyGI
- gui: remove the status bar
- gui: fix parsing of "semodule -lfull" in tab Modules
- gui: delete overridden definition of usersPage.delete()
- Enable listing file_contexts.homedirs (#1409813)
- remove semodule_deps- Also add Provides for the old name without %_isa- Python 2 binary package renamed to python2-policycoreutils
  See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3- Update to upstream release 2017-08-04
- Move DBUS API from -gui to -dbus package- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuild with binutils fix for ppc64le (#1475636)- Make 'sepolicy manpag�x���������������������X:~%�
���������4,X�����$<����������������,X-X+X��x�������������H�����X�%�
���������.
�d�$X�����������������d�d�d���g��g��g��g��g��g�wg�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g�wg��g�wg��g�wg�wg��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g�wg�wg��g�wg��g��g��g��g��g��g�wg��g��g�wg��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g�wg��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g�xg�xg��g��g��g�xg��g��g��g��g�xg�xg��g��g��g��g��g��g��g�xg��g��g�xg��g�xg��g�xg��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g�yg��g��g��g��g�yg��g��g��g��g��g��g��g�yg��g��g��g�yg��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g�zg��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g�zg��g��g��g�zg��g��g��g��g�zg��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g�zg��g�zg��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g�zg��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�{g��g��g��g��g��g��g��g��g�{g��g��g��g��g��g��g�{g��g��g�{g��g�{g��g��g�{g��g�{g��g��g�{g��g��g�{g��g��g��g�{g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g�xg��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g�yg��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g�yg��g��g��g��g�yg�yg�yg��g��g�zg��g��g�{g��g��g��g��g�{g��g��g�{g��g��g��g��g�{g�{g��g��g��g��g�{g�{g��g��g�{g��g��g��g��g��g��g��g��g�{g�{g��g��g��g��g��g�{g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g���x���������������������X&�
P���������$��������������������on- Update to 0.7.20
- new SOLVER_EXCLUDEFROMWEAK job to ignore pkgs for weak dependencies
- support for environments in comps parser
- fix misparsing of '&' in attributes with libxml2
- choice rules: treat orphaned packages as newest
- fix compatibility with Python 3.10- Update to 0.7.19
- repo_add_conda: add flag to skip v2 packages
- fix rare segfault in resolve_jobrules() that could happen if new rules are learnt
- fix error handling in solv_xfopen_fd()
- fix memory leaks- Fix rpm dependency- Update to 0.7.17
- selected bug fixes:
  * repo_write: fix handling of nested flexarray
  * improve choicerule generation a bit more to cover more cases
  * harden testcase parser against repos being added too late
  * support python-3.10
  * check /var/lib/rpm macro in rpmdb code
- new features:
  * handle default/visible/langonly attributes in comps parser
  * support multiple collections in updateinfo parser
  * add '-D' option in rpmdb2solv to set the dbpath- Enable zstd compression in libsolv- Update to 0.7.16
- selected bug fixes:
  * make testcase_mangle_repo_names deal correctly with freed repos
  [bnc#1177238]
  * fix add_complex_recommends() selecting conflicted packages in
    rare cases leading to crashes
  * improve choicerule generation so that package updates are
    prefered in more cases
  * fix deduceq2addedmap clearing bits outside of the map
  * conda: feature depriorization and fix startswith implementation
  * Fix solvable swapping messing up idarrays
  * fix ruleinfo of complex dependencies returning the wrong origin
  * fix solv_zchunk decoding error if large chunks are used
    [bnc#1159314]
- new features
  * new testcase_mangle_repo_names() function
  * new solv_fmemopen() function
  * Enable zstd compression support for sle15 and sle15-sp2
  * Support blacklisted packages in solver_findproblemrule()
    [bnc#1172135]
  * Support rules with multiple negative literals in choice rule
    generation
  * build with -DENABLE_RPMDB_LIBRPM=1 on SUSE to support
    multiple rpm database backends
  * added two new function to make libzypp independent of the rpm
    database format
  * support conda constrains dependencies- Update to 0.7.11
- selected bug fixes:
  * support arch<->noarch package changes when creating patch
    conflicts from the updateinfo data
  * also support other rpm database types
  * fixed solv_zchunk decoding error if large chunks are used
  * treat retracted pathes as irrelevant
  * made add_update_target work with multiversion installs
- new features
  * support for SOLVER_BLACKLIST jobs that block the installation of matched
    packages unless they are directly selected by an SOLVER_INSTALL job
  * libsolv now also parses the patch status in the updateinfo parser
  * new solvable_matchessolvable() function
  * support conda constrains dependencies
  * new rpm_stat_database() function
  * new rpm_hash_database_state() function- Update to 0.7.7
- selected bug fixes:
  * fix updating of too many packages in focusbest mode
  * fix handling of disabled installed packages in distupgrade
  * fix repository priority handling for multiversion packages
  * better support of inverval deps in pool_match_dep()
  * support src rpms that have non-empty provides
  * fix favorq leaking between solver runs if the solver is reused
  * fix SOLVER_FLAG_FOCUS_BEST updateing packages without reason
  * be more correct with multiversion packages that obsolete their
    own name
  * allow building with swig-4.0.0
  * lock jobs now take precedence over dup and forcebest jobs
- new features
  * new POOL_FLAG_WHATPROVIDESWITHDISABLED pool flag 
  * bindings: add get_disabled_list() and set_disabled_list()
  * bindings: add whatcontainsdep()
  * bindings: make the selection filters return the self object
  * MSVC compilation support- Backport patches: Use OpenSSL for computing hashes (RhBug:1630300)- Backport patch: Not considered excluded packages as a best candidate (RhBug:1677583)- soname bump to "1"
- incompatible API changes:
  * bindings: Selection.flags is now an attrib�x�������������(�������XS%�
��������@J�������d�$�����������������d�d�d�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw�x����������������������Xd%�
p'rd�$b����������������rdsdqd�.3ssl.gzEVP_ENCODE_CTX_copy.3ssl.gzEVP_ENCODE_CTX_free.3ssl.gzEVP_ENCODE_CTX_new.3ssl.gzEVP_ENCODE_CTX_num.3ssl.gzEVP_EncodeBlock.3ssl.gzEVP_EncodeFinal.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeUpdate.3ssl.gzEVP_EncryptFinal.3ssl.gzEVP_EncryptFinal_ex.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit_ex.3ssl.gzEVP_EncryptUpdate.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX_free.3ssl.gzEVP_KDF_CTX_new_id.3ssl.gzEVP_KDF_ctrl.3ssl.gzEVP_KDF_ctrl_str.3ssl.gzEVP_KDF_derive.3ssl.gzEVP_KDF_reset.3ssl.gzEVP_KDF_size.3ssl.gzEVP_KDF_vctrl.3ssl.gzEVP_MD_CTX_block_size.3ssl.gzEVP_MD_CTX_clear_flags.3ssl.gzEVP_MD_CTX_copy.3ssl.gzEVP_MD_CTX_copy_ex.3ssl.gzEVP_MD_CTX_ctrl.3ssl.gzEVP_MD_CTX_free.3ssl.gzEVP_MD_CTX_md.3ssl.gzEVP_MD_CTX_md_data.3ssl.gzEVP_MD_CTX_new.3ssl.gzEVP_MD_CTX_pkey_ctx.3ssl.gzEVP_MD_CTX_reset.3ssl.gzEVP_MD_CTX_set_flags.3ssl.gzEVP_MD_CTX_set_pkey_ctx.3ssl.gzEVP_MD_CTX_set_update_fn.3ssl.gzEVP_MD_CTX_size.3ssl.gzEVP_MD_CTX_test_flags.3ssl.gzEVP_MD_CTX_type.3ssl.gzEVP_MD_CTX_update_fn.3ssl.gzEVP_MD_block_size.3ssl.gzEVP_MD_flags.3ssl.gzEVP_MD_meth_dup.3ssl.gzEVP_MD_meth_free.3ssl.gzEVP_MD_meth_get_app_datasize.3ssl.gzEVP_MD_meth_get_cleanup.3ssl.gzEVP_MD_meth_get_copy.3ssl.gzEVP_MD_meth_get_ctrl.3ssl.gzEVP_MD_meth_get_final.3ssl.gzEVP_MD_meth_get_flags.3ssl.gzEVP_MD_meth_get_init.3ssl.gzEVP_MD_meth_get_input_blocksize.3ssl.gzEVP_MD_meth_get_result_size.3ssl.gzEVP_MD_meth_get_update.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_set_app_datasize.3ssl.gzEVP_MD_meth_set_cleanup.3ssl.gzEVP_MD_meth_set_copy.3ssl.gzEVP_MD_meth_set_ctrl.3ssl.gzEVP_MD_meth_set_final.3ssl.gzEVP_MD_meth_set_flags.3ssl.gzEVP_MD_meth_set_init.3ssl.gzEVP_MD_meth_set_input_blocksize.3ssl.gzEVP_MD_meth_set_result_size.3ssl.gzEVP_MD_meth_set_update.3ssl.gzEVP_MD_pkey_type.3ssl.gzEVP_MD_size.3ssl.gzEVP_MD_type.3ssl.gzEVP_OpenFinal.3ssl.gzEVP_OpenInit.3ssl.gzEVP_OpenUpdate.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_CTX_add1_hkdf_info.3ssl.gzEVP_PKEY_CTX_add1_tls1_prf_seed.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl_str.3ssl.gzEVP_PKEY_CTX_ctrl_uint64.3ssl.gzEVP_PKEY_CTX_dup.3ssl.gzEVP_PKEY_CTX_free.3ssl.gzEVP_PKEY_CTX_get0_dh_kdf_oid.3ssl.gzEVP_PKEY_CTX_get0_dh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_get0_ecdh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_get0_rsa_oaep_label.3ssl.gzEVP_PKEY_CTX_get1_id.3ssl.gzEVP_PKEY_CTX_get1_id_len.3ssl.gzEVP_PKEY_CTX_get_app_data.3ssl.gzEVP_PKEY_CTX_get_cb.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_md.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_type.3ssl.gzEVP_PKEY_CTX_get_ecdh_cofactor_mode.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_md.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_type.3ssl.gzEVP_PKEY_CTX_get_keygen_info.3ssl.gzEVP_PKEY_CTX_get_rsa_mgf1_md.3ssl.gzEVP_PKEY_CTX_get_rsa_oaep_md.3ssl.gzEVP_PKEY_CTX_get_rsa_padding.3ssl.gzEVP_PKEY_CTX_get_rsa_pss_saltlen.3ssl.gzEVP_PKEY_CTX_get_signature_md.3ssl.gzEVP_PKEY_CTX_hkdf_mode.3ssl.gzEVP_PKEY_CTX_md.3ssl.gzEVP_PKEY_CTX_new.3ssl.gzEVP_PKEY_CTX_new_id.3ssl.gzEVP_PKEY_CTX_set0_dh_kdf_oid.3ssl.gzEVP_PKEY_CTX_set0_dh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_set0_ecdh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_set0_rsa_oaep_label.3ssl.gzEVP_PKEY_CTX_set1_hkdf_key.3ssl.gzEVP_PKEY_CTX_set1_hkdf_salt.3ssl.gzEVP_PKEY_CTX_set1_id.3ssl.gzEVP_PKEY_CTX_set1_pbe_pass.3ssl.gzEVP_PKEY_CTX_set1_scrypt_salt.3ssl.gzEVP_PKEY_CTX_set1_tls1_prf_secret.3ssl.gzEVP_PKEY_CTX_set_app_data.3ssl.gzEVP_PKEY_CTX_set_cb.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_md.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_type.3ssl.gzEVP_PKEY_CTX_set_dh_nid.3ssl.gzEVP_PKEY_CTX_set_dh_pad.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_generator.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_prime_len.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_subprime_len.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_type.3ssl.gzEVP_PKEY_CTX_set_dh_rfc5114.3ssl.gzEVP_PKEY_CTX_set_dhx_rfc5114.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_bits.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_md.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_q_bits.3ssl.gzEVP_PKEY_CTX�x���������������������X�$�
�������� O]X�$M����������������]X\X^X�managed policy, as libsemanage does not yet support it.- Update to match NSA
        * Merged genhomedircon bug fix from Dan Walsh.
        * Revised semodule* man pages to refer to checkmodule and
          to include example sections.- Update to match NSA
        * Merged audit2allow --tefile and --fcfile support from Dan Walsh.
        * Merged genhomedircon fix from Dan Walsh.
        * Merged semodule* man pages from Dan Walsh, and edited them.
        * Changed setfiles to set the MATCHPATHCON_VALIDATE flag to
          retain validation/canonicalization of contexts during init.- Update to match NSA
        * Changed genhomedircon to always use user_r for the role in the
          managed case since user_get_defrole is broken.
- Add te file capabilities to audit2allow
- Add man pages for semodule- Update to match NSA
        * Merged sestatus, audit2allow, and semanage patch from Dan Walsh.
        * Fixed semodule -v option.- Update to match NSA
        * Merged audit2allow python script from Dan Walsh.
          (old script moved to audit2allow.perl, will be removed later).
        * Merged genhomedircon fixes from Dan Walsh.
        * Merged semodule quieting patch from Dan Walsh
          (inverts default, use -v to restore original behavior).- Audit2allow
        * Add more error checking
        * Add gen policy package
        * Add gen requires- Update to match NSA
        * Merged genhomedircon rewrite from Dan Walsh.
- Rewrite audit2allow to python- Fix genhomedircon to work with non libsemanage systems- Patch genhomedircon to use libsemanage.py stuff- Update to match NSA
        * Merged setsebool cleanup patch from Ivan Gyurdiev.- Fix genhomedircon to use seusers file, temporary fix until swigified semanage* Added -B (--build) option to semodule to force a rebuild.
        * Reverted setsebool patch to call semanage_set_reload_bools().
        * Changed setsebool to disable policy reload and to call
          security_set_boolean_list to update the runtime booleans.
        * Changed setfiles -c to use new flag to set_matchpathcon_flags()
          to disable context translation by matchpathcon_init().- Update to match NSA
        * Changed setfiles for the context canonicalization support.
        * Changed setsebool to call semanage_is_managed() interface
          and fall back to security_set_boolean_list() if policy is
          not managed.
        * Merged setsebool memory leak fix from Ivan Gyurdiev.
        * Merged setsebool patch to call semanage_set_reload_bools()
          interface from Ivan Gyurdiev.- Update to match NSA
        * Merged setsebool patch from Ivan Gyurdiev.
          This moves setsebool from libselinux/utils to policycoreutils,
          and rewrites it to use libsemanage for permanent boolean changes.- Rebuild to use latest libselinux, libsemanage, and libsepol- Update to match NSA
        * Merged semodule support for reload, noreload, and store options
          from Joshua Brindle.
        * Merged semodule_package rewrite from Joshua Brindle.- Update to match NSA
        * Cleaned up usage and error messages and releasing of memory by
        semodule utilities.
        * Corrected error reporting by semodule.
        * Updated semodule_expand for change to sepol interface.
        * Merged fixes for make DESTDIR= builds from Joshua Brindle.- Update to match NSA
        * Updated semodule_package for sepol interface changes.- Update to match NSA
        * Updated semodule_expand/link for sepol interface changes.- Update to match NSA
        * Merged non-PAM Makefile support for newrole and run_init from Timothy Wood.- Update to match NSA
        * Updated semodule_expand to use get interfaces for hidden sepol_module_package type.
        * Merged newrole and run_init pam config patches from Dan Walsh (Red Hat).
        * Merged fixfiles patch from Dan Walsh (Red Hat).
        * Updated semodule for removal of semanage_strerror.- Fix run_init.pamd and spec file- Update to match NSA
        * Updated semodule_link and se�x�������������p��������X4�%�
���������<�!�����$�����������������!�!�!��������5.26.30.271.010.341.111.191.374:5.26.3-423.el8_104:5.26.3-423.el8_10	








 !"##########$%&'())))))))))))))*****+,,,,,,,,--------------------------------./01234555555555555555556666666666667777777777777777777778888888888888888899999::::::::::::::::::::;<==>>??@@AAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCDEEEEEEEEEEEEEEEEEEEEEEFGGGGGGGGGGGGHIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLMNOOOOOOOOOOOPQ.build-id622685f0db1f52fc83bfea6f0f78f27bafb41eb12d7ea2fd7cae12140a00da756abe0c14597flibperl.so.5.26libperl.so.5.26.3perl5CORElibperl.soautorere.sore.pmvendor_perlautoperl-libsAUTHORSChangesREADMEperl-libsArtisticCopyingXSLoader.3pm.gzinteger.3pm.gzre.3pm.gzstrict.3pm.gzutf8.3pm.gzwarnings.3pm.gzperl5XSLoader.pminteger.pmstrict.pmunicoreBlocks.txtCombiningClass.plDecomposition.plHeavy.plName.plName.pmNamedSequences.txtSpecialCasing.txtToAge.plBc.plBmg.plBpb.plBpt.plCf.plDigit.plEa.plFold.plGCB.plGc.plHst.plInPC.plInSC.plIsc.plJg.plJt.plLb.plLc.plLower.plNFCQC.plNFDQC.plNFKCCF.plNFKCQC.plNFKDQC.plNa1.plNameAlia.plNt.plNv.plPerlDeci.plSB.plSc.plScx.plTc.plTitle.plUc.plUpper.plWB.pl_PerlLB.pl_PerlWB.plUCD.pllibAgeNA.plV11.plV20.plV30.plV31.plV32.plV40.plV41.plV50.plV51.plV52.plV60.plV61.plV70.plV80.plV90.plAlphaY.plBcAL.plAN.plB.plBN.plCS.plEN.plES.plET.plL.plNSM.plON.plR.plWS.plBidiCY.plBidiMY.plBlkNB.plBptC.plN.plO.plCEY.plCIY.plCWCFY.plCWCMY.plCWKCFY.plCWLY.plCWTY.plCWUY.plCasedY.plCccA.plAR.plATAR.plB.plBR.plDB.plNK.plNR.plOV.plVR.plCompExY.plDIY.plDashY.plDepY.plDiaY.plDtCom.plEnc.plFin.plFont.plInit.plIso.plMed.plNar.plNb.plNonCanon.plSqr.plSub.plSup.plVert.plEaA.plH.plN.pl�x����������������������XI%�
��������(��������d�$�����������������d�d�d�l on hmac integrity check if the .hmac file is empty- pull in upstream patch for CVE-2014-0160
- removed CHANGES file portion from patch for expediency- add support for ppc64le architecture (#1072633)- properly detect encryption failure in BIO
- use 2048 bit RSA key in FIPS selftests- use the key length from configuration file if req -newkey rsa is invoked- print ephemeral key size negotiated in TLS handshake (#1057715)
- add DH_compute_key_padded needed for FIPS CAVS testing- make expiration and key length changeable by DAYS and KEYLEN
  variables in the certificate Makefile (#1058108)
- change default hash to sha256 (#1062325)- make 3des strength to be 128 bits instead of 168 (#1056616)- fix CVE-2013-4353 - Invalid TLS handshake crash
- fix CVE-2013-6450 - possible MiTM attack on DTLS1- fix CVE-2013-6449 - crash when version in SSL structure is incorrect
- more FIPS validation requirement changes- drop weak ciphers from the default TLS ciphersuite list
- add back some symbols that were dropped with update to 1.0.1 branch
- more FIPS validation requirement changes- fix locking and reseeding problems with FIPS drbg- additional changes required for FIPS validation- disable verification of certificate, CRL, and OCSP signatures
  using MD5 if OPENSSL_ENABLE_MD5_VERIFY environment variable
  is not set- add back support for secp521r1 EC curve
- add aarch64 to Configure (#969692)- fix misdetection of RDRAND support on Cyrix CPUS (from upstream) (#1022346)- do not advertise ECC curves we do not support (#1022493)- only ECC NIST Suite B curves support
- drop -fips subpackage- resolve bugzilla 319901 (phew! only took 6 years & 9 days)- make DTLS1 work in FIPS mode
- avoid RSA and DSA 512 bits and Whirlpool in 'openssl speed' in FIPS mode- avoid dlopening libssl.so from libcrypto (#1010357)- fix small memory leak in FIPS aes selftest- fix segfault in openssl speed hmac in the FIPS mode- document the nextprotoneg option in manual pages
  original patch by Hubert Kario- [arm] use elf auxv to figure out armcap.c instead of playing silly
  games with SIGILL handlers. (#1006474)- try to avoid some races when updating the -fips subpackage- use version-release in .hmac suffix to avoid overwrite
  during upgrade- allow deinitialization of the FIPS mode- always perform the FIPS selftests in library constructor
  if FIPS module is installed- add -fips subpackage that contains the FIPS module files- fix use of rdrand if available
- more commits cherry picked from upstream
- documentation fixes- Perl 5.18 rebuild- additional manual page fix
- use symbol versioning also for the textual version- additional manual page fixes- use _prefix macro- Perl 5.18 rebuild- add openssl.cnf.5 manpage symlink to config.5- add relro linking flag- add support for the -trusted_first option for certificate chain verification- fix build of manual pages with current pod2man (#959439)- Enable ARM optimised build- fix random bad record mac errors (#918981)- fix up the SHLIB_VERSION_NUMBER- disable ZLIB loading by default (due to CRIME attack)- new upstream version- more fixes from upstream
- fix errors in manual causing build failure (#904777)- add script for renewal of a self-signed cert by Philip Prindeville (#871566)
- allow X509_issuer_and_serial_hash() produce correct result in
  the FIPS mode (#881336)- do not load default verify paths if CApath or CAfile specified (#884305)- more fixes from upstream CVS
- fix DSA key pairwise check (#878597)- use 1024 bit DH parameters in s_server as 512 bit is not allowed
  in FIPS mode and it is quite weak anyway- add missing initialization of str in aes_ccm_init_key (#853963)
- add important patches from upstream CVS
- use the secure_getenv() with new glibc- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- use __getenv_secure() instead of __libc_enable_secure- do not move libcrypto to /lib
- do not use environment variables if __libc_enable_secure is on
- fix strict aliasing problems in modes- fix DSA key generation in FIPS mx�����X�������0|������NNN����������������� X�`	������������������������C.&�������������������Providename@x����������������z������@��������������Pz�������X	�$�
P�8���$n������������������Bfa09927c6637149932fc?�����H��!�<���Q�d~���e-
	Q�d~�����H�Ա�W{1��&�Q;�H�l��z^����)��=ޕ��6?%��fB�Y}�i@<�&󰀘��lJ�J��~"��k'<��c�S��1~�)��$s+��_qԖt���MY�sn���oYщ�u̙\�����������o��c��#�5�ϊ��[�r��B��N*3���=��Ɛ_�_^�ԼL���^F��Rɨ�cl���|P�g�ju�$7�54B�����T2j�6���1!»���/i�;G�ISy���.�}z�6�%�E|
��LY�(�;*�.�B��xA�A��÷������`�a�Hfi�-�)
�pn��`�u���ޗ��L� |�?����P(i�ާ�lX�'%��e�we�s~���~߼�p���)�@��g>���!�<��ΰ��Q�d~���e-
	Q�d~�����N%6���h1c(�����5�)ӟ�1���{/��$����`xk�Wk�ҵz�[�؅����k�����(>��1H)<��]w|r�����z"I�o��w��p(�@z���m�A�ji����i������8�#󗟢ԃUv(�Oo�
�;�qA
"��}r���&SN�=�A9"���M��"#uO?��5Q��$ !x�vޑ�m�[�`��U�\x0Y�#K}(X�

$m�*�|&����*�c5_�W���c֘]�,�H'@
V0��r��Vm89��)��o4(9��/1���X��8�������q#�-S�Ɩ�Y�lr2��:�x���:���'�y�/�+	h�&|��KE.�(	�)�]��N�ڈ�싪���Ia53c58830532c330d37e6e8d024a4cd39368aa6a40a340cac62e4cf04ae7b2aed41c3660b279d1134d437b515c53cdd8a9103e85fX�, �fX� function (#1734787)
- shared/cpu-set-util: make transfer of cpu_set_t over bus endian safe (#1734787)
- test-cpu-set-util: add test for dbus conversions (#1734787)
- shared/cpu-set-util: introduce cpu_set_to_range() (#1734787)
- systemctl: present CPUAffinity mask as a list of CPU index ranges (#1734787)
- shared/cpu-set-util: only force range printing one time (#1734787)
- execute: dump CPUAffinity as a range string instead of a list of CPUs (#1734787)
- cpu-set-util: use %d-%d format in  cpu_set_to_range_string() only for actual ranges (#1734787)
- core: introduce NUMAPolicy and NUMAMask options (#1734787)
- core: disable CPUAccounting by default (#1734787)
- set kptr_restrict=1 (#1689346)
- cryptsetup: reduce the chance that we will be OOM killed (#1696602)
- core, job: fix breakage of ordering dependencies by systemctl reload command (#1766417)
- debug-generator: enable custom systemd.debug_shell tty (#1723722)- core: never propagate reload failure to service result (#1735787)
- man: document systemd-analyze security (#1750343)
- man: reorder and add examples to systemd-analyze(1) (#1750343)
- travis: move to CentOS 8 docker images (#1761519)
- travis: drop SCL remains (#1761519)
- syslog: fix segfault in syslog_parse_priority() (#1761519)
- sd-bus: make strict asan shut up (#1761519)
- travis: don't run slow tests under ASan/UBSan (#1761519)
- kernel-install: do not require non-empty kernel cmdline (#1701454)
- ask-password: prevent buffer overrow when reading from keyring (#1752050)
- core: try to reopen /dev/kmsg again right after mounting /dev (#1749212)
- buildsys: don't garbage collect sections while linking (#1748258)
- udev: introduce CONST key name (#1762679)
- Call getgroups() to know size of supplementary groups array to allocate (#1743230256 KB
- Consider smb3 as remote filesystem (#1757257)
- process-util: introduce pid_is_my_child() helper (#1744972)
- core: reduce the number of stalled PIDs from the watched processes list when possible (#1744972)
- core: only watch processes when it's really necessary (#1744972)
- core: implement per unit journal rate limiting (#1719577)
- path: stop watching path specs once we triggered the target unit (#1763161)
- journald: fixed assertion failure when system journal rotation fails (#9893) (#1763619)
- test: use PBKDF2 instead of Argon2 in cryptsetup... (#1761519)
- test: mask several unnecessary services (#1761519)
- test: bump the second partition's size to 50M (#1761519)
- shared/sleep-config: exclude zram devices from hibernation candidates (#1763617)
- selinux: don't log SELINUX_INFO and SELINUX_WARNING messages to audit (#1763612)
- sd-device: introduce log_device_*() macros (#1753369)
- udev: Add id program and rule for FIDO security tokens (#1753369)
- shared/but-util: drop trusted annotation from bus_open_system_watch_bind_with_description() (#1746857)
- sd-bus: adjust indentation of comments (#1746857)
- resolved: do not run loop twice (#1746857)
- resolved: al�x�������������j�������X
 %�
f�7�������d�$&�����������������d�d�d�E_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzBIO_get_ex_new_index.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzERR_GET_LIB.3ssl.gzERR_GET_LIB.3ssl.gzERR_GET_LIB.3ssl.gzERR_load_strings.3ssl.gzERR_put_error.3ssl.gzERR_put_error.3ssl.gzERR_error_string.3ssl.gzERR_load_crypto_strings.3ssl.gzERR_error_string.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_load_strings.3ssl.gzERR_error_string.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_get_error.3ssl.gzERR_set_mark.3ssl.gzERR_print_errors.3ssl.gzERR_print_errors.3ssl.gzERR_error_string.3ssl.gzERR_remove_state.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_CIPHER_CTX_get_cipher_data.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestSignInit.3ssl.gzEVP_DigestSignInit.3ssl.gzEVP_DigestSignInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestVerifyInit.3ssl.gzEVP_DigestVerifyInit.3ssl.gzEVP_DigestVerifyInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3�x��������������Y�������X_$�
���������!X��$H����������������X�W�Y�� more patches for db 4.1.24 from sleepycat's updates page
- use openssl pkgconfig data, if any is available- add patches for db 4.1.24 from sleepycat's updates page- add a sample TLSCACertificateFile directive to the default slapd.conf- update to 2.0.27- update to 2.0.26, db 4.1.24.NC- change LD_FLAGS to refer to /usr/kerberos/_libdir instead of
  /usr/kerberos/lib, which might not be right on some arches- update to 2.0.25 "stable", ldbm-over-gdbm (putting off migration of LDBM
  slapd databases until we move to 2.1.x)
- use %{_smp_mflags} when running make
- update to MigrationTools 44
- enable dynamic module support in slapd- rebuild in new environment- use the gdbm backend again- make slapd.conf read/write by root, read by ldap- fix corner case in sendbuf fix
- 2.0.23 now marked "stable"- update to 2.0.23- switch to an internalized Berkeley DB as the ldbm back-end  (NOTE: this breaks
  access to existing on-disk directory data)
- add slapcat/slapadd with gdbm for migration purposes
- remove Kerberos dependency in client libs (the direct Kerberos dependency
  is used by the server for checking {kerberos} passwords)- update to 2.0.22- prereq chkconfig for server subpackage- update migration tools to version 40- free ride through the build system- update to 2.0.21, now earmarked as STABLE- temporarily disable optimizations for ia64 arches
- specify pthreads at configure-time instead of letting configure guess- and one for Raw Hide- build for RHL 7/7.1- update to 2.0.20 (security errata)- update to 2.0.19- fix the commented-out replication example in slapd.conf- update to 2.0.18- update to 2.0.17- disable kbind support (deprecated, and I suspect unused)
- configure with --with-kerberos=k5only instead of --with-kerberos=k5
- build slapd with threads- rebuild, 2.0.15 is now designated stable- update to 2.0.15- update to 2.0.14- update to 2.0.12 to pull in fixes for setting of default TLS options, among
  other things
- update to migration tools 39
- drop tls patch, which was fixed better in this release- install saucer correctly- try to fix ldap_set_options not being able to set global options related
  to TLS correctly- don't attempt to create a cert at install-time, it's usually going
  to get the wrong CN (#51352)- add a build-time requirement on pam-devel
- add a build-time requirement on a sufficiently-new libtool to link
  shared libraries to other shared libraries (which is needed in order
  for prelinking to work)- require cyrus-sasl-md5 (support for DIGEST-MD5 is required for RFC
  compliance) by name (follows from #43079, which split cyrus-sasl's
  cram-md5 and digest-md5 modules out into cyrus-sasl-md5)- enable passwd back-end (noted by Alan Sparks and Sergio Kessler)- start to prep for errata release- link libldap with liblber- add symlink liblber.so libldap.so and libldap_r.so in /usr/lib- move shared libraries to /lib
- redo init script for better internationalization (#26154)
- don't use ldaprc files in the current directory (#38402) (patch from
  hps@intermeta.de)
- add BuildPrereq on tcp wrappers since we configure with
  --enable-wrappers (#43707)
- don't overflow debug buffer in mail500 (#41751)
- don't call krb5_free_creds instead of krb5_free_cred_contents any
  more (#43159)- make config files noreplace (#42831)- actually change the default config to use the dummy cert
- update to MigrationTools 38- build dummy certificate in %post, use it in default config
- configure-time shenanigans to help a confused configure script- tweak migrate_automount and friends so that they can be run from anywhere- update to 2.0.11- update to 2.0.10- update to 2.0.9- update to 2.0.8
- drop patch which came from upstream- rebuild in new environment- back out pidfile patches, which interact weirdly with Linux threads
- mark non-standard schema as such by moving them to a different directory- update to MigrationTools 36, adds netgroup support- fix thinko in that last patch- try to work around some buffering problems- gettextize the init script- �x�������������I�������X��$�
��������ȍu�$e����������������utv�ed, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=294a1d143ea2871f3e2ed5bc2e04db32ea290e36, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2d39ebe7f4ca2cdb365cc5a9aa9e356b3c96a85e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ce34def152f881519c765b46024774fb683e6b8d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6a6192bd2f4c30996dcb35762ecf1c698cdff89d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5ef5ac1ac892946bc8cadb66581180a4347370a0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dd2260f83c64d31340e6ff303536baeee3ad3d6e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d28b3f9244508ae76bc04688df8f87b9a3d5920b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1d9b4e45afe837c7eb4c53548b75df2f8d0705cb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c404a72a5e288660385fe49b742944655db6d74b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c486b11b07132b49f87c7e7602328c0a83d2bb5e, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5a939fcd2197a7cb8e3ccee3cb41b0992027c77e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e9877f48f78170c2497b43896d06a8651763c62, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=816283987d0b228cec0ba938a9b9e4859f0b9dbc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ff01a3c56d3a7efabd91adc77e85ffe263f4657b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c26d5789f1d97e366f0433bbe17df5dd6a2a50f7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5c808cf19b002989ce568c9557a920e439e27225, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=be996082d88f066ec094fae776c071f390bcee01, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ad7cf017285518aa5a8c533f25dc88710d6f5442, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=be8bfd55776adcead76028863b9f66a824be3db9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4306ce1f6ad3ce18ecc219a303d336ea5f77810e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamical�x��������������8�������X��$�
�T�N������W�$G����������������WVX������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootttyrootrootrootrootrootrootrootrootroot�x��������������'�������Xr%�
P-�7Y�$'����������������7Y8Y6Y�_method_data.3ssl.gzX509_LOOKUP_get_store.3ssl.gzX509_LOOKUP_hash_dir.3ssl.gzX509_LOOKUP_init.3ssl.gzX509_LOOKUP_load_file.3ssl.gzX509_LOOKUP_meth_free.3ssl.gzX509_LOOKUP_meth_get_ctrl.3ssl.gzX509_LOOKUP_meth_get_free.3ssl.gzX509_LOOKUP_meth_get_get_by_alias.3ssl.gzX509_LOOKUP_meth_get_get_by_fingerprint.3ssl.gzX509_LOOKUP_meth_get_get_by_issuer_serial.3ssl.gzX509_LOOKUP_meth_get_get_by_subject.3ssl.gzX509_LOOKUP_meth_get_init.3ssl.gzX509_LOOKUP_meth_get_new_item.3ssl.gzX509_LOOKUP_meth_get_shutdown.3ssl.gzX509_LOOKUP_meth_new.3ssl.gzX509_LOOKUP_meth_set_ctrl.3ssl.gzX509_LOOKUP_meth_set_free.3ssl.gzX509_LOOKUP_meth_set_get_by_alias.3ssl.gzX509_LOOKUP_meth_set_get_by_fingerprint.3ssl.gzX509_LOOKUP_meth_set_get_by_issuer_serial.3ssl.gzX509_LOOKUP_meth_set_get_by_subject.3ssl.gzX509_LOOKUP_meth_set_init.3ssl.gzX509_LOOKUP_meth_set_new_item.3ssl.gzX509_LOOKUP_meth_set_shutdown.3ssl.gzX509_LOOKUP_new.3ssl.gzX509_LOOKUP_set_method_data.3ssl.gzX509_LOOKUP_shutdown.3ssl.gzX509_NAME_ENTRY_create_by_NID.3ssl.gzX509_NAME_ENTRY_create_by_OBJ.3ssl.gzX509_NAME_ENTRY_create_by_txt.3ssl.gzX509_NAME_ENTRY_dup.3ssl.gzX509_NAME_ENTRY_free.3ssl.gzX509_NAME_ENTRY_get_data.3ssl.gzX509_NAME_ENTRY_get_object.3ssl.gzX509_NAME_ENTRY_new.3ssl.gzX509_NAME_ENTRY_set_data.3ssl.gzX509_NAME_ENTRY_set_object.3ssl.gzX509_NAME_add_entry.3ssl.gzX509_NAME_add_entry_by_NID.3ssl.gzX509_NAME_add_entry_by_OBJ.3ssl.gzX509_NAME_add_entry_by_txt.3ssl.gzX509_NAME_cmp.3ssl.gzX509_NAME_delete_entry.3ssl.gzX509_NAME_digest.3ssl.gzX509_NAME_dup.3ssl.gzX509_NAME_entry_count.3ssl.gzX509_NAME_free.3ssl.gzX509_NAME_get0_der.3ssl.gzX509_NAME_get_entry.3ssl.gzX509_NAME_get_index_by_NID.3ssl.gzX509_NAME_get_index_by_OBJ.3ssl.gzX509_NAME_get_text_by_NID.3ssl.gzX509_NAME_get_text_by_OBJ.3ssl.gzX509_NAME_new.3ssl.gzX509_NAME_oneline.3ssl.gzX509_NAME_print.3ssl.gzX509_NAME_print_ex.3ssl.gzX509_NAME_print_ex_fp.3ssl.gzX509_OBJECT_set1_X509.3ssl.gzX509_OBJECT_set1_X509_CRL.3ssl.gzX509_PUBKEY_free.3ssl.gzX509_PUBKEY_get.3ssl.gzX509_PUBKEY_get0.3ssl.gzX509_PUBKEY_get0_param.3ssl.gzX509_PUBKEY_new.3ssl.gzX509_PUBKEY_set.3ssl.gzX509_PUBKEY_set0_param.3ssl.gzX509_REQ_INFO_free.3ssl.gzX509_REQ_INFO_new.3ssl.gzX509_REQ_check_private_key.3ssl.gzX509_REQ_digest.3ssl.gzX509_REQ_dup.3ssl.gzX509_REQ_free.3ssl.gzX509_REQ_get0_pubkey.3ssl.gzX509_REQ_get0_signature.3ssl.gzX509_REQ_get_X509_PUBKEY.3ssl.gzX509_REQ_get_pubkey.3ssl.gzX509_REQ_get_signature_nid.3ssl.gzX509_REQ_get_subject_name.3ssl.gzX509_REQ_get_version.3ssl.gzX509_REQ_new.3ssl.gzX509_REQ_set0_signature.3ssl.gzX509_REQ_set1_signature_algo.3ssl.gzX509_REQ_set_pubkey.3ssl.gzX509_REQ_set_subject_name.3ssl.gzX509_REQ_set_version.3ssl.gzX509_REQ_sign.3ssl.gzX509_REQ_sign_ctx.3ssl.gzX509_REQ_verify.3ssl.gzX509_REVOKED_add1_ext_i2d.3ssl.gzX509_REVOKED_add_ext.3ssl.gzX509_REVOKED_delete_ext.3ssl.gzX509_REVOKED_dup.3ssl.gzX509_REVOKED_free.3ssl.gzX509_REVOKED_get0_extensions.3ssl.gzX509_REVOKED_get0_revocationDate.3ssl.gzX509_REVOKED_get0_serialNumber.3ssl.gzX509_REVOKED_get_ext.3ssl.gzX509_REVOKED_get_ext_by_NID.3ssl.gzX509_REVOKED_get_ext_by_OBJ.3ssl.gzX509_REVOKED_get_ext_by_critical.3ssl.gzX509_REVOKED_get_ext_count.3ssl.gzX509_REVOKED_get_ext_d2i.3ssl.gzX509_REVOKED_new.3ssl.gzX509_REVOKED_set_revocationDate.3ssl.gzX509_REVOKED_set_serialNumber.3ssl.gzX509_SIG_INFO_get.3ssl.gzX509_SIG_INFO_set.3ssl.gzX509_SIG_free.3ssl.gzX509_SIG_get0.3ssl.gzX509_SIG_getm.3ssl.gzX509_SIG_new.3ssl.gzX509_STORE.3ssl.gzX509_STORE_CTX_cert_crl_fn.3ssl.gzX509_STORE_CTX_check_crl_fn.3ssl.gzX509_STORE_CTX_check_issued_fn.3ssl.gzX509_STORE_CTX_check_policy_fn.3ssl.gzX509_STORE_CTX_check_revocation_fn.3ssl.gzX509_STORE_CTX_cleanup.3ssl.gzX509_STORE_CTX_cleanup_fn.3ssl.gzX509_STORE_CTX_free.3ssl.gzX509_STORE_CTX_get0_cert.3ssl.gzX509_STORE_CTX_get0_chain.3ssl.gzX509_STORE_CTX_get0_param.3ssl.gzX509_STORE_CTX_get0_untrusted.3ssl.gzX509_STORE_CTX_get1_chain.3ssl.gzX509_STORE_CTX_get_cert_crl.3ssl.gzX509_STORE_CTX_g�x�������������p�������X�%�
���������$��$-�������������������N�0?��d��
��	�	[�������������	M�_������P���		6�

���6m�
9��=�A�E.EP�H�H�$I\$L�$MMM(M!8M(�9P �:pS�>�J?�RG�\�H���I���X�lY�|\���]���^��Nbɡd��e�f�l�t��u�X�vќ+w�L�x��y��W��0��4��:��|������3�C�
�����L�P��$g�(h�,Cgettext0.19.8.117.el8GNU libraries and utilities for producing multi-lingual messagesThe GNU gettext package provides a set of tools and documentation for
producing multi-lingual messages in programs. Tools include a set of
conventions about how programs should be written to support message
catalogs, a directory and file naming organization for the message
catalogs, a runtime library which supports the retrieval of translated
messages, and stand-alone programs for handling the translatable and
the already translated strings. Gettext provides an easy to use
library and tools for creating, using, and modifying natural language
catalogs and is a powerful and simple method for internationalizing
programs.]�ҝbuild.cloudlinux.comO:ACloudLinuxCloudLinuxGPLv3+ and LGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Development/Toolshttp://www.gnu.org/software/gettext/linuxx86_64/sbin/install-info /usr/share/info/gettext.info.gz /usr/share/info/dir || :if [ "$1" = 0 ]; then
  /sbin/install-info --delete /usr/share/info/gettext.info.gz /usr/share/info/dir || :
fi���fPf8hxf8V8V0V8� i0�hh��8f@��G�o�#$&*x�F(
�F88����Kg�	�9		A������Ij����o<D�
0��9����)�j���
��e1.�G�%��K&��#�fI&���S'$��$H��$&���s��&��%!��$�\�%j'� ph$���#���&J�$O�$����4uI%�����%��
��/:*�&��j#�Ǧ.�A$H�O$�P�0{NG)���&�#���y��6����l[S�t�|�	����������������������A�A�A���A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A������A큤��������������������A�A�A큤����������������A�A큤����������������A큤��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������]��)]��)]���]��)]��)]��)]��)]��)]��)]҈x��������������X�%�
��������(�&X�$6����������������&X'X%X��x�������������P��������X�&�
��P
��������$=��������������������om> - 1.4.12-3Tomáš Mráz <tmraz@redhat.com> - 1.4.12-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.12-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-9Tom Callaway <spot@fedoraproject.org> - 1.4.11-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-7Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-6Ville Skyttä <ville.skytta@iki.fi> - 1.4.11-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-1Tomáš Mráz <tmraz@redhat.com> - 1.4.10-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.10-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.9-1Václav Pavlín <vpavlin@redhat.com> - 1.4.8-13Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-10Tomáš Mráz <tmraz@redhat.com> - 1.4.8-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-8Karsten Hopp <karsten@redhat.com> 1.4.8-7Rex Dieter <rdieter@fedoraproject.org> 1.4.8-6Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-5Tomáš Mráz <tmraz@redhat.com> - 1.4.8-4Tomáš Mráz <tmraz@redhat.com> - 1.4.8-3Tomáš Mráz <tmraz@redhat.com> - 1.4.8-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-3Tomáš Mráz <tmraz@redhat.com> - 1.4.7-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.6-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-8Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-7Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-6Tomas Mraz <tmraz@redhat.com> - 1.4.6-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.4-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-1Tomas Mraz <tmraz@redhat.com> - 1.4.1-3Tomas Mraz <tmraz@redhat.com> - 1.4.1-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.1-1Tomas Mraz <tmraz@redhat.com> - 1.4-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.2-8Tomas Mraz <tmraz@redhat.com> - 1.2-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2-6Marcela Mašláňová <mmaslano@redhat.com> - 1.2-5Marcela Mašláňová <mmaslano@redhat.com> - 1.2-4Marcela Maslanova <mmaslano@redhat.com> - 1.2-3Marcela Maslanova <mmaslano@redhat.com> - 1.2-2Marcela Maslanova <mmaslano@redhat.com> - 1.2-1Tomas Mraz <tmraz@redhat.com> - 1.1-3Marcela Maslanova <mmaslano@redhat.com> - 1.1-2Marcela Maslanova <mmaslano@redhat.com> - 1.1-1Marcela Maslanova <mmaslano@redhat.com> - 1.0-6Marcela Maslanova <mmaslano@redhat.com> - 1.0-5Marcela Maslanova <mmaslano@redhat.com> - 1.0-4Marcela Maslanova <mmaslano@redhat.com> - 1.0-3Marcela Maslanova <mmaslano@redhat.com> - 1.0-2Marcela Maslanova <mmaslano@redhat.com> - 1.0-1- Bump release because of CI issues
- Related: RHEL-2609- Add `optimization_to_close_fds.patch`
- Resolv�x��������������������X�$�
���������Z�$J����������������ZY[�.2-1bash-completioncoreutilse2fsprogsfilesysteminitscriptssysvinit-tools1:2.1-18.201.41.8-539.79-42.88-144.14.3e��@e��e���d��@d%y�c�&@c��cn9@co�b�V�b�@b'E@a�Z@a�Z@a�q@a��@a�L�`�
@`�_��_��^��@^��]��@]��@]��@]��@]�q�]��]��@]y@]nU�]H@]@1@\�]@\��\~d�\��\��[�s�[qr�[m~@[j�@[b�@[M�@[��[�@Z�2@Z�I@Z�
�Z��@Z}�@Zc/@ZL�Y�@Y��Y�d�Y�d�Y��Y�@Y�@Y���Y�a�Y���Yy�Yp�@Y1S@Y;@X� @X���X���XW�X!�@X`@W�S�W�@W��@W�@W^�@WX@W�@V���V�n@V�3�V���V��VLh@VA�@V7P@U�|@U�@Ŭ�U�5@U�c@U���U�@UB@T�s@T��@T��T�[@T��@T���Tw@TJ?@T�S��@S��S��S�@S�R@S��@S���S��S�P@S��Sp��Sp��Sj @SX��R�>�R��R�@Rg�@REs@R-�@R-�@Q�M�Q��@Q��@Q�(@Q��@Qy�Qk�Qk�Qg�@QeT@QR�@QR�@QLG�Q$��Q#i@QE�QQ@P�D�P��@P�@P�*�P�d@P�d@Puc@Pl(�PH�@P,�P��O؀�O�t@Ou�@OG{�O3�@O1@O�On@Nˎ�N��@N�
@N[@NK�@N7�N�@M��M��Mt�MS�@MQ0@MO�M>�@M>�@M6�@M$]@L��Lk�@LZ��LV�@L+1�L_�L0�K�@K��@K�q�Kz��Kz��KuB�KG@KG@K&(�K�@K�@K
y@J�U�J�T�J��J��@Ję�J��@J�0@J�#�J�/@J�@Jyt@Jq�@Jm��Jj�J/�@J,�@J'�@IԨ�IÅ@IÅ@I�3�I�2�I��@I��I��Ix_�IO�@I&��H�HǶ�HǶ�H�@H�n�Hj@HM@H1k�H
�@H;�H��G�u@G�:�G��G��G{|�G_�@G_�@G[�G(n@G��G�F�@F��@F�%@Fɂ@Fɂ@Fɂ@Fɂ@F��F�G�F6@E�c@E�&�E�1@E��@E�<�E�@E..@E��E-@E
��D�@D�q@D��D��DȪ�DȪ�D�Y@D��@D�{�D��@D���D�A@D�L�D��@D�4�D��@D�W@DtJ�DtJ�DWI�DU�@D�D�D�@C�R@C�@C��@C�C�@C�g@C�f@C�q�C���CoA�Cb�C_o�CW��CW��CS�@CFc@CFc@C>�C�@BӰ�B�i�Bx�@Bv@Bv@Bl�BR}�BK�@BC�@B8�B@Aʳ@A���A��@A��@A�@Anj@Am�Am�Am�Aju�Ac�@AZ��AYR@AH.�AH.�A4h@A-�A
@A
@A
@A!@@�@��@��@�c@@���@�@@�@`&�@\2@@V�@@V�@@R��@R��@PT�@O@@O@@K�@?1@@9�@@5��@,�@@+j�@�@@@@@@��?�C@?��@?�@?�Y@?r�?j�?a�@?a�@?Xz�?Xz�?W)@?7�@?&a�?x�>�@>��@>��@>��@>��@>�\�>�h@>�9@>�D�>pr�>Z	@>Sq�>K��>>Y�>>Y�>=@>7�@>.��>"�@>"�@=��=�x@=��=�1@=���=0@=o^@=Q�=Jt@=>��==E@=;�=!��=O�=�@=�@=�@=@=�=�@<��<�M�<�5�<�K�<��@<��@<��<���<���<��<{x�<U=@<,^�<)��<��;��@;֭@;֭@;�[�;ʼn�;��;�f@;��;g�@;eL@;eL@;]c@;\�;M�@;L?�;-�@;(�@;
T�:�1@:��@:�_@:�$�:�0@:�R�:�F@:��:�E@:�P�:��@:�8�:�@:mr@:b�@:4��:�9�@9��@9��@9��9x;@9x;@9u�@9m�@9i��9`�@9SQ@9:D�96P@9
q�8���8�d@8��@8���8�(�8��8��@8�@8�m�8��8���8�>�8���8y�8L��8L��83�@8(�8 #�8�@7��@7�@7�r@7�}�7�,@7�@7�+@7��7��7�Y@7��7��7so@7O�7�7�7�@7=@7@6�k@6�v�6�%@6�%@6��6��@6�0�6��@6��6�@6���6�9@6��6��6��6i @6f}@6R��68X�6#@�6!�@6?�5��5�J@5�@5���5�R�5�@5r��5K
�5@~�5/[@4���4��4�a�4��@4M�4GS@4>�43��4*R@4��3�Z�3�@3\�@3�@3�@Karel Zak <kzak@redhat.com> 2.32.1-46Karel Zak <kzak@redhat.com> 2.32.1-45Karel Zak <kzak@redhat.com> 2.32.1-44Karel Zak <kzak@redhat.com> 2.32.1-43Karel Zak <kzak@redhat.com> 2.32.1-42Karel Zak <kzak@redhat.com> 2.32.1-41Karel Zak <kzak@redhat.com> 2.32.1-40Karel Zak <kzak@redhat.com> 2.32.1-39Karel Zak <kzak@redhat.com> 2.32.1-38Karel Zak <kzak@redhat.com> 2.32.1-37Karel Zak <kzak@redhat.com> 2.32.1-36Karel Zak <kzak@redhat.com> 2.32.1-35Karel Zak <kzak@redhat.com> 2.32.1-34Karel Zak <kzak@redhat.com> 2.32.1-32Karel Zak <kzak@redhat.com> 2.32.1-31Karel Zak <kzak@redhat.com> 2.32.1-30Karel Zak <kzak@redhat.com> 2.32.1-29Karel Zak <kzak@redhat.com> 2.32.1-28Karel Zak <kzak@redhat.com> 2.32.1-27Karel Zak <kzak@redhat.com> 2.32.1-26Karel Zak <kzak@redhat.com> 2.32.1-25Karel Zak <kzak@redhat.com> 2.32.1-24Karel Zak <kzak@redhat.com> 2.32.1-23Karel Zak <kzak@redhat.com> 2.32.1-22Karel Zak <kzak@redhat.com> 2.32.1-21Karel Zak <kzak@redhat.com> 2.32.1-20Karel Zak <kzak@redhat.com> 2.32.1-19Karel Zak <kzak@redhat.com> 2.32.1-18Karel Zak <kzak@redhat.com> 2.32.1-17Karel Zak <kzak@redhat.com> 2.32.1-16Karel Zak <kzak@redhat.com> 2.32.1-15Karel Zak <kzak@redhat.com> 2.32.1-14Karel Zak <kzak@redhat.com> 2.32.1-13Karel Zak <kzak@redhat.com> 2.32.1-12Karel Zak <kzak@redhat.com> 2.32.1-11Karel Zak <kzak@redhat.com> 2.32.1-10Karel Zak <kzak@redhat.com> 2.32.1-9Karel Zak <kzak@redhat.com> 2.32.1-8Karel Zak <kzak@redhat.com> 2.32.1-7Karel Zak <kzak@redhat.com> 2.32.1-6Karel Zak <kzak@redhat.com> 2.32.1-5Karel Zak <kzak@redhat.com> 2.32.1-4Karel Zak <kzak@redhat.com> 2.32�x�������������@�������X
�%�
Ȣ������8�����6��$&����������������6�7�5��com> - 4:5.10.0-1Robin Norwood <rnorwood@redhat.com> - 4:5.10.0_RC2-0.1- Fix CVE-2025-40909 - Clone dirhandles without fchdir
- Fix test broken by update in zlib on s390x- Add definition of OPTIMIZE to .ph files, if optimizing is used
  (bug#2152012)- Fix a memory leak when compiling a regular expression with a non-word
  class (bug #2014981)- Fix _resolv return value in Net-Ping (bug #1973030)- Fix CVE-2020-10543 (bug #1839273)
- Fix CVE-2020-10878 (bug #1839276)
- Fix a file mode of a perl-example.stp example (bug #1913693)- Fix CVE-2020-12723 (bug #1839279)- Fix Time-Local tests to pass after year 2019 (bug #1807120)
- Run-require perl(Encode) by perl-libs (bug #1903503)- 5.26.3 bump (bug #1655526)
- Fix CVE-2018-18311 (integer overflow leading to buffer overflow) (bug #1654920)
- Fix CVE-2018-18312 (heap buffer overflow in regcomp.c) (bug #1654922)
- Fix CVE-2018-18313 (heap buffer overflow read in regcomp.c) (bug #1654924)
- Fix CVE-2018-18314 (heap based buffer overflow) (bug #1654925)- Install Encode developmental files when installing complete Perl
  (bug #1645225)- Fix annocheck failure by passing CFLAGS to dtrace (bug #1630617)- Adjust tests to gdbm-1.15 (RT#133295)
- Fix an integer wrap when allocating memory for an environment variable
  (RT#133204)
- Fix printing a warning about a wide character when matching a regular
  expression while ISO-8859-1 locale is in effect
- Fix invoking a check for wide characters while ISO-8859-1 locale is in effect- perl-devel requires redhat-rpm-config because of hardened compiler profiles
  (bug #1557667)
- Do not clobber file bytes in :encoding layer (RT#132833)
- Fix line numbers in multi-line s/// (RT#131930)
- Fix parsing extended bracketed character classes (RT#132167)
- Fix a possibly unitialized memory read in the Perl parser (RT#133074)
- Fix an infinite loop in the regular expression compiler (RT#133185)- Correct license tags of perl-libs (bug #1579524)- 5.26.2 bump
- Fix CVE-2018-6913 (heap buffer overflow in pp_pack.c) (bug #1567776)
- Fix CVE-2018-6798 (heap read overflow in regexec.c) (bug #1567777)
- Fix CVE-2018-6797 (heap write overflow in regcomp.c) (bug #1567778)- Rebuild to pick up new build flags from redhat-rpm-config- Escape macros in %changelog- Fix parsing braced subscript after parentheses (RT#8045)
- Fix a heap use after free when moving a stack (RT#131954)
- Call ldconfig scriptlets using a macro- Correct shell bangs in tests- Link XS modules to pthread library to fix linking with -z defs- Add patch to conditionalize a fix for an old and long fixed bug
  in libcrypt / glibc (rhbz#1536752)- Rebuild against glibc without nsl library- Remove invalid macro definitions from macros.perl (bug #1532539)
- Fix an overflow in the lexer when reading a new line (RT#131793)
- Fix Term::ReadLine not to create spurious &STDERR files (RT#132008)
- Fix a crash when a match for inversely repeated group fails (RT#132017)
- Fix an overflow when parsing a character range with no preceding character
  (RT#132245)
- Fix walking symbol table for ISA in Carp
- Fix handling file names with null bytes in stat and lstat functions
  (RT#131895)
- Fix a crash when untying an object witout a stash
- Fix deparsing of transliterations with unprintable characters (RT#132405)
- Fix error reporting on do() on a directory (RT#125774)
- Fix stack manipulation when a lexical subroutine is defined in a do block in
  a member of an iteration list (RT#132442)
- Fix setting $! when statting a closed file handle (RT#108288)
- Fix tainting of s/// with overloaded replacement (RT#115266)
- Expand system() arguments before a fork (RT#121105)
- Avoid undefined behavior when copying memory in Glob and pp_caller (RT#131746)- Update perl(:MODULE_COMPAT)- 5.26.1 bump (see <http://search.cpan.org/dist/perl-5.26.1/pod/perldelta.pod>
  for release notes)- Fix unreliable Time-HiRes tests (CPAN RT#122819)
- Do not require $Config{libs} providers by perl-devel package (bug #1481324)- Fix reporting malformed UTF-8 character (RT#131646)
- Fix File::Glob r�x���������������������X�$�
 �������\�$L����������������\[]�2-5Karel Zak <kzak@redhat.com> 2.22.2-4Karel Zak <kzak@redhat.com> 2.22.2-3Karel Zak <kzak@redhat.com> 2.22.2-2Karel Zak <kzak@redhat.com> 2.22.2-1Karel Zak <kzak@redhat.com> 2.22.1-5Karel Zak <kzak@redhat.com> 2.22.1-4Karel Zak <kzak@redhat.com> 2.22.1-3Karel Zak <kzak@redhat.com> 2.22.1-2Karel Zak <kzak@redhat.com> 2.22.1-1Karel Zak <kzak@redhat.com> 2.22-2Karel Zak <kzak@redhat.com> 2.22-1Karel Zak <kzak@redhat.com> 2.22-0.1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.21.2-3Karel Zak <kzak@redhat.com> 2.21.2-2Karel Zak <kzak@redhat.com> 2.21.2-1Karel Zak <kzak@redhat.com> 2.21.1-1Karel Zak <kzak@redhat.com> 2.21-1Karel Zak <kzak@redhat.com> 2.21-0.2Karel Zak <kzak@redhat.com> 2.21-0.1Harald Hoyer <harald@redhat.com> 2.20.1-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.20.1-4Karel Zak <kzak@redhat.com> 2.20.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.20.1-2Karel Zak <kzak@redhat.com> 2.20.1-1Karel Zak <kzak@redhat.com> 2.20-1Karel Zak <kzak@redhat.com> 2.20-0.2Karel Zak <kzak@redhat.com> 2.20-0.1Karel Zak <kzak@redhat.com> 2.19.1-2Karel Zak <kzak@redhat.com> 2.19.1-1Karel Zak <kzak@redhat.com> 2.19.1-0.1Karel Zak <kzak@redhat.com> 2.19-2Karel Zak <kzak@redhat.com> 2.19-1Karel Zak <kzak@redhat.com> 2.19-0.6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.19-0.5Karel Zak <kzak@redhat.com> 2.19-0.4Karel Zak <kzak@redhat.com> 2.19-0.3Karel Zak <kzak@redhat.com> 2.19-0.2Karel Zak <kzak@redhat.com> 2.19-0.1Karel Zak <kzak@redhat.com> 2.18-5Karel Zak <kzak@redhat.com> 2.18-4Karel Zak <kzak@redhat.com> 2.18-3Karel Zak <kzak@redhat.com> 2.18-2Karel Zak <kzak@redhat.com> 2.18-1Karel Zak <kzak@redhat.com> 2.18-0.2Karel Zak <kzak@redhat.com> 2.18-0.1Karel Zak <kzak@redhat.com> 2.17.2-1Karel Zak <kzak@redhat.com> 2.17.1-2Karel Zak <kzak@redhat.com> 2.17.1-1Karel Zak <kzak@redhat.com> 2.17.1-0.1Karel Zak <kzak@redhat.com> 2.17-4Karel Zak <kzak@redhat.com> 2.17-3Karel Zak <kzak@redhat.com> 2.17-2Karel Zak <kzak@redhat.com> 2.17-1Karel Zak <kzak@redhat.com> 2.17-0.6Karel Zak <kzak@redhat.com> 2.17-0.5Karel Zak <kzak@redhat.com> 2.17-0.4Karel Zak <kzak@redhat.com> 2.17-0.3Karel Zak <kzak@redhat.com> 2.17-0.2.git10dfc39Karel Zak <kzak@redhat.com> 2.17-0.1.git5e51568Karel Zak <kzak@redhat.com> 2.16-13Karel Zak <kzak@redhat.com> 2.16-12Karel Zak <kzak@redhat.com> 2.16-11Tomas Mraz <tmraz@redhat.com> - 2.16-10Karel Zak <kzak@redhat.com> 2.16-9Tomas Mraz <tmraz@redhat.com> - 2.16-8Karel Zak <kzak@redhat.com> 2.16-7Karel Zak <kzak@redhat.com> 2.16-5Stepan Kasal <skasal@redhat.com> 2.16-4Karel Zak <kzak@redhat.com> 2.16-3Karel Zak <kzak@redhat.com> 2.16-2Karel Zak <kzak@redhat.com> 2.16-1Karel Zak <kzak@redhat.com> 2.15.1-1Karel Zak <kzak@redhat.com> 2.15.1-0.2Karel Zak <kzak@redhat.com> 2.15.1-0.1Karel Zak <kzak@redhat.com> 2.14.2-8Karel Zak <kzak@redhat.com> 2.14.2-7Karel Zak <kzak@redhat.com> 2.14.2-6Karel Zak <kzak@redhat.com> 2.14.2-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.14.2-4Karel Zak <kzak@redhat.com> 2.14.2-3Karel Zak <kzak@redhat.com> 2.14.2-2Karel Zak <kzak@redhat.com> 2.14.2-1Karel Zak <kzak@redhat.com> 2.14.2-0.2Karel Zak <kzak@redhat.com> 2.14.2-0.1Karel Zak <kzak@redhat.com> 2.14.1-5Karel Zak <kzak@redhat.com> 2.14.1-3Karel Zak <kzak@redhat.com> 2.14.1-2Karel Zak <kzak@redhat.com> 2.14.1-1Karel Zak <kzak@redhat.com> 2.14.1-0.1Karel Zak <kzak@redhat.com> 2.14-3Karel Zak <kzak@redhat.com> 2.14-2Karel Zak <kzak@redhat.com> 2.14-1Karel Zak <kzak@redhat.com> 2.14-0.1Karel Zak <kzak@redhat.com> 2.13.1-9Karel Zak <kzak@redhat.com> 2.13.1-8Karel Zak <kzak@redhat.com> 2.13.1-7Karel Zak <kzak@redhat.com> 2.13.1-6Tom "spot" Callaway <tcallawa@redhat.com> - 2.13.1-5Fedora Release Engineering <rel-eng@fedoraproject.org> - 2.13.1-4Karel Zak <kzak@redhat.com> 2.13.1-3Karel Zak <kzak@redhat.com> 2.13.1-2Dan Walsh <dwalsh@redhat.com> 2.13.1-1Karel Zak <kzak@redhat.com> 2.13.1-0.2Karel Zak <kzak@redhat.com> 2.13.�x�������������0��������Xa$�
���������fZ��$J����������������Z�Y�[��them in in.xfingerd (bug #11111)- update to 1.2.10
- add revamped version of patch from kos@bastard.net to allow execution as
  any non-root user
- remove test suite from %build because of weirdness in the build system- move the defaults for databases and whatnot to /var/lib/ldap (bug #10714)
- fix some possible string-handling problems- start earlier, stop later.- auto rebuild in new environment (release 4)- add -D_REENTRANT to make threaded stuff more stable, even though it looks
  like the sources define it, too
- mark *.ph files in migration tools as config files- update to 1.2.9- strip files- update to 1.2.7
- fix some bugs from bugzilla (#4885, #4887, #4888, #4967)
- take include files out of base package- missing ;; in init script reload) (#4734).- move stuff from /usr/libexec to /usr/sbin
- relocate config dirs to /etc/openldap- initscript munging- add the migration tools to the package- upgrade to 1.2.6
- add rc.d script
- split -devel package- upgrade to latest stable (1.1.4), it now uses configure macro.- build on arm, glibc2.1- initial cut.
- patches for signal handling on the alpha	

����2.4.46-21.el8_102.4.46-21.el8_102.4.46-21.el8_10	


openldapcertsldap.conf.build-id03c7187f0fb72501aa0d05547d2c6de6985235960d9b65c5f354ea05158a36e1e05cb3495be3e6083c29055271a39fada4390a38c546d5f632e884d2eaf46fb2e45a8ba49996f7880fa4b50b4bbff763liblber-2.4.so.2liblber-2.4.so.2.10.9libldap-2.4.so.2libldap-2.4.so.2.10.9libldap_r-2.4.so.2libldap_r-2.4.so.2.10.9libslapi-2.4.so.2libslapi-2.4.so.2.10.9openldapopenldapANNOUNCEMENTCHANGESREADMEopenldapCOPYRIGHTLICENSEldap.conf.5.gzldif.5.gz/etc//etc/openldap//usr/lib//usr/lib/.build-id//usr/lib/.build-id/03//usr/lib/.build-id/0d//usr/lib/.build-id/3c//usr/lib/.build-id/ea//usr/lib64//usr/libexec//usr/share/doc//usr/share/doc/openldap//usr/share/licenses//usr/share/licenses/openldap//usr/share/man/man5/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryAlgol 68 source, ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c29055271a39fada4390a38c546d5f632e884d2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=eaf46fb2e45a8ba49996f7880fa4b50b4bbff763, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=03c7187f0fb72501aa0d05547d2c6de698523596, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0d9b65c5f354ea05158a36e1e05cb3495be3e608, strippedASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)	.	PRRRRRRRRPRRRRRRRRR	R
RRRRRRPRRRRRRRR
RRR	R
RR�x����������������������X�$�
(�
�"v�$f����������������vuw�ly linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e0854b60cad226cc3ed52f43d4f8203d9042d7af, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=97d0b5268255ba27200ddf72bccb258832c3079f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f0f4940279f64c38e521f600de54375574981886, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=df99eb05d945c091ebfc154d1ed7996830bd7b7f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8ac46885133b90b5ac96db282dbd8e23ab1f51ea, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=86850f8fe55fe6305ce17a125cb40fbcaf615715, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=009219e358382627110aa2873705f9e5a571b03b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3d099729d0d03eabf8e79d4d6afdd25194be2cf4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fc2c0fb1e115d76b511ae38f66c0caaad53e2f58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c484531b844a0b317106361c53c3bd908dc14714, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=360912916f7247ca72648ef4304ab0c46f4b0d50, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c4ea00b9942cb3728d1c8082cd643518eab69821, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a1288eb1fb957104ca8e6d376e9112386f2c48dc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b97c8c466d1ddc6b71e29d259d33c46ad2a24560, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=93f4b11ddf3fae0a72e8593c06493368fd264cd9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=df0453255752205f9890f0982d45006e56f14db9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b707be9885f8ced7c5780a4945a1785861d70ef, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ce36c791489c85a18ac5e216f149d3d0fe02e7ee, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=00cd2682bb03f2fd95d69809b4885cca619ab7d3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f5cc522634a0585e3a3d2b328e7b66a21f0bb4e3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked,�x��������������������X(^%�
@�
��xd�����$h����������������xdydwd�.gzBIO_meth_set_destroy.3ssl.gzBIO_meth_set_gets.3ssl.gzBIO_meth_set_puts.3ssl.gzBIO_meth_set_read.3ssl.gzBIO_meth_set_read_ex.3ssl.gzBIO_meth_set_write.3ssl.gzBIO_meth_set_write_ex.3ssl.gzBIO_method_type.3ssl.gzBIO_new.3ssl.gzBIO_new_CMS.3ssl.gzBIO_new_accept.3ssl.gzBIO_new_bio_pair.3ssl.gzBIO_new_buffer_ssl_connect.3ssl.gzBIO_new_connect.3ssl.gzBIO_new_fd.3ssl.gzBIO_new_file.3ssl.gzBIO_new_fp.3ssl.gzBIO_new_mem_buf.3ssl.gzBIO_new_socket.3ssl.gzBIO_new_ssl.3ssl.gzBIO_new_ssl_connect.3ssl.gzBIO_next.3ssl.gzBIO_parse_hostserv.3ssl.gzBIO_pending.3ssl.gzBIO_pop.3ssl.gzBIO_printf.3ssl.gzBIO_ptr_ctrl.3ssl.gzBIO_push.3ssl.gzBIO_puts.3ssl.gzBIO_read.3ssl.gzBIO_read_ex.3ssl.gzBIO_read_filename.3ssl.gzBIO_reset.3ssl.gzBIO_retry_type.3ssl.gzBIO_rw_filename.3ssl.gzBIO_s_accept.3ssl.gzBIO_s_bio.3ssl.gzBIO_s_connect.3ssl.gzBIO_s_fd.3ssl.gzBIO_s_file.3ssl.gzBIO_s_mem.3ssl.gzBIO_s_null.3ssl.gzBIO_s_secmem.3ssl.gzBIO_s_socket.3ssl.gzBIO_seek.3ssl.gzBIO_set_accept_bios.3ssl.gzBIO_set_accept_ip_family.3ssl.gzBIO_set_accept_name.3ssl.gzBIO_set_accept_port.3ssl.gzBIO_set_bind_mode.3ssl.gzBIO_set_buffer_read_data.3ssl.gzBIO_set_buffer_size.3ssl.gzBIO_set_callback.3ssl.gzBIO_set_callback_arg.3ssl.gzBIO_set_callback_ex.3ssl.gzBIO_set_cipher.3ssl.gzBIO_set_close.3ssl.gzBIO_set_conn_address.3ssl.gzBIO_set_conn_hostname.3ssl.gzBIO_set_conn_ip_family.3ssl.gzBIO_set_conn_port.3ssl.gzBIO_set_data.3ssl.gzBIO_set_ex_data.3ssl.gzBIO_set_fd.3ssl.gzBIO_set_fp.3ssl.gzBIO_set_info_callback.3ssl.gzBIO_set_init.3ssl.gzBIO_set_md.3ssl.gzBIO_set_mem_buf.3ssl.gzBIO_set_mem_eof_return.3ssl.gzBIO_set_nbio.3ssl.gzBIO_set_nbio_accept.3ssl.gzBIO_set_next.3ssl.gzBIO_set_read_buffer_size.3ssl.gzBIO_set_retry_reason.3ssl.gzBIO_set_shutdown.3ssl.gzBIO_set_ssl.3ssl.gzBIO_set_ssl_mode.3ssl.gzBIO_set_ssl_renegotiate_bytes.3ssl.gzBIO_set_ssl_renegotiate_timeout.3ssl.gzBIO_set_write_buf_size.3ssl.gzBIO_set_write_buffer_size.3ssl.gzBIO_should_io_special.3ssl.gzBIO_should_read.3ssl.gzBIO_should_retry.3ssl.gzBIO_should_write.3ssl.gzBIO_shutdown_wr.3ssl.gzBIO_snprintf.3ssl.gzBIO_socket.3ssl.gzBIO_ssl_copy_session_id.3ssl.gzBIO_ssl_shutdown.3ssl.gzBIO_tell.3ssl.gzBIO_up_ref.3ssl.gzBIO_vfree.3ssl.gzBIO_vprintf.3ssl.gzBIO_vsnprintf.3ssl.gzBIO_wpending.3ssl.gzBIO_write.3ssl.gzBIO_write_ex.3ssl.gzBIO_write_filename.3ssl.gzBN_BLINDING_convert.3ssl.gzBN_BLINDING_convert_ex.3ssl.gzBN_BLINDING_create_param.3ssl.gzBN_BLINDING_free.3ssl.gzBN_BLINDING_get_flags.3ssl.gzBN_BLINDING_invert.3ssl.gzBN_BLINDING_invert_ex.3ssl.gzBN_BLINDING_is_current_thread.3ssl.gzBN_BLINDING_lock.3ssl.gzBN_BLINDING_new.3ssl.gzBN_BLINDING_set_current_thread.3ssl.gzBN_BLINDING_set_flags.3ssl.gzBN_BLINDING_unlock.3ssl.gzBN_BLINDING_update.3ssl.gzBN_CTX_end.3ssl.gzBN_CTX_free.3ssl.gzBN_CTX_get.3ssl.gzBN_CTX_new.3ssl.gzBN_CTX_secure_new.3ssl.gzBN_CTX_start.3ssl.gzBN_GENCB_call.3ssl.gzBN_GENCB_free.3ssl.gzBN_GENCB_get_arg.3ssl.gzBN_GENCB_new.3ssl.gzBN_GENCB_set.3ssl.gzBN_GENCB_set_old.3ssl.gzBN_MONT_CTX_copy.3ssl.gzBN_MONT_CTX_free.3ssl.gzBN_MONT_CTX_new.3ssl.gzBN_MONT_CTX_set.3ssl.gzBN_RECP_CTX_free.3ssl.gzBN_RECP_CTX_new.3ssl.gzBN_RECP_CTX_set.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_bin2bn.3ssl.gzBN_bn2bin.3ssl.gzBN_bn2binpad.3ssl.gzBN_bn2dec.3ssl.gzBN_bn2hex.3ssl.gzBN_bn2lebinpad.3ssl.gzBN_bn2mpi.3ssl.gzBN_clear.3ssl.gzBN_clear_bit.3ssl.gzBN_clear_free.3ssl.gzBN_cmp.3ssl.gzBN_copy.3ssl.gzBN_dec2bn.3ssl.gzBN_div.3ssl.gzBN_div_recp.3ssl.gzBN_div_word.3ssl.gzBN_dup.3ssl.gzBN_exp.3ssl.gzBN_free.3ssl.gzBN_from_montgomery.3ssl.gzBN_gcd.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime_ex.3ssl.gzBN_get0_nist_prime_192.3ssl.gzBN_get0_nist_prime_224.3ssl.gzBN_get0_nist_prime_256.3ssl.gzBN_get0_nist_prime_384.3ssl.gzBN_get0_nist_prime_521.3ssl.gzBN_get_rfc2409_prime_1024.3ssl.gzBN_get_rfc2409_prime_768.3ssl.gzBN_get_rfc3526_prime_1536.3ssl.gzBN_get_rfc3526_prime_2048.3ssl.gzBN_get_rfc3526_prime_3072.3ssl.gzBN_get_rfc3526_prime_409�x����������������������X�%�
�2�����*��$:����������������*�+�)����LUXYZ[\]^_`abklmn�����������������������������������				�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�








z

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
����������mnops���
t
u
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�UVWX[rsz{|}��������������������������������������������������������������������������������������������������������
 !"#$%&'()*+,-./0123456789:;<=>ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghklmnopqrsv���������������������������������������������������������������������������������������������������������������������������������������������������������1.015.741.061.680.9991.405.0260031.051.071.061.220.655.0260030.011.080.060.030.030.030.030.031.041.181.421.100.230.050.080.030.031.132.851.10062.321.121.341.281.071.092.031.511.151.120.221.191.020.421.060.390.131.041.201.140.671.011.001.001.011.011.141.391.761.100.260.0160.260.171.111.142.401.071.021.081.201.4031.171.023.042.131.061.024.21.050.101.11.391.044.41.001.031.021.001.130.691.011.001.450.120.291.112.261.061.051.450.031.360.131.472.231.030.06060.030.641.091.201.021.280.021.082.021.021.031.041.044:5.26.3-423.el8_104:5.26.3-423.el8_10
4:5.26.0-3954:5.12.2	

 !"#$%&'()*+,-�x�������������r�������Xq%�
��8Y�$(����������������8Yfd7Y�ck.3ssl.gzUI_add_error_string.3ssl.gzUI_add_info_string.3ssl.gzUI_add_input_boolean.3ssl.gzUI_add_input_string.3ssl.gzUI_add_user_data.3ssl.gzUI_add_verify_string.3ssl.gzUI_construct_prompt.3ssl.gzUI_create_method.3ssl.gzUI_ctrl.3ssl.gzUI_destroy_method.3ssl.gzUI_dup_error_string.3ssl.gzUI_dup_info_string.3ssl.gzUI_dup_input_boolean.3ssl.gzUI_dup_input_string.3ssl.gzUI_dup_user_data.3ssl.gzUI_dup_verify_string.3ssl.gzUI_free.3ssl.gzUI_get0_action_string.3ssl.gzUI_get0_output_string.3ssl.gzUI_get0_result.3ssl.gzUI_get0_result_string.3ssl.gzUI_get0_test_string.3ssl.gzUI_get0_user_data.3ssl.gzUI_get_default_method.3ssl.gzUI_get_ex_data.3ssl.gzUI_get_ex_new_index.3ssl.gzUI_get_input_flags.3ssl.gzUI_get_method.3ssl.gzUI_get_result_length.3ssl.gzUI_get_result_maxsize.3ssl.gzUI_get_result_minsize.3ssl.gzUI_get_result_string_length.3ssl.gzUI_get_string_type.3ssl.gzUI_method_get_closer.3ssl.gzUI_method_get_data_destructor.3ssl.gzUI_method_get_data_duplicator.3ssl.gzUI_method_get_ex_data.3ssl.gzUI_method_get_flusher.3ssl.gzUI_method_get_opener.3ssl.gzUI_method_get_prompt_constructor.3ssl.gzUI_method_get_reader.3ssl.gzUI_method_get_writer.3ssl.gzUI_method_set_closer.3ssl.gzUI_method_set_data_duplicator.3ssl.gzUI_method_set_ex_data.3ssl.gzUI_method_set_flusher.3ssl.gzUI_method_set_opener.3ssl.gzUI_method_set_prompt_constructor.3ssl.gzUI_method_set_reader.3ssl.gzUI_method_set_writer.3ssl.gzUI_new.3ssl.gzUI_new_method.3ssl.gzUI_null.3ssl.gzUI_process.3ssl.gzUI_set_default_method.3ssl.gzUI_set_ex_data.3ssl.gzUI_set_method.3ssl.gzUI_set_result.3ssl.gzUI_set_result_ex.3ssl.gzUI_string_types.3ssl.gzUSERNOTICE_free.3ssl.gzUSERNOTICE_new.3ssl.gzX509V3_EXT_d2i.3ssl.gzX509V3_EXT_i2d.3ssl.gzX509V3_add1_i2d.3ssl.gzX509V3_get_d2i.3ssl.gzX509_ALGOR_cmp.3ssl.gzX509_ALGOR_copy.3ssl.gzX509_ALGOR_dup.3ssl.gzX509_ALGOR_free.3ssl.gzX509_ALGOR_get0.3ssl.gzX509_ALGOR_new.3ssl.gzX509_ALGOR_set0.3ssl.gzX509_ALGOR_set_md.3ssl.gzX509_ATTRIBUTE_dup.3ssl.gzX509_ATTRIBUTE_free.3ssl.gzX509_ATTRIBUTE_new.3ssl.gzX509_CERT_AUX_free.3ssl.gzX509_CERT_AUX_new.3ssl.gzX509_CINF_free.3ssl.gzX509_CINF_new.3ssl.gzX509_CRL_INFO_free.3ssl.gzX509_CRL_INFO_new.3ssl.gzX509_CRL_add0_revoked.3ssl.gzX509_CRL_add1_ext_i2d.3ssl.gzX509_CRL_add_ext.3ssl.gzX509_CRL_cmp.3ssl.gzX509_CRL_delete_ext.3ssl.gzX509_CRL_digest.3ssl.gzX509_CRL_dup.3ssl.gzX509_CRL_free.3ssl.gzX509_CRL_get0_by_cert.3ssl.gzX509_CRL_get0_by_serial.3ssl.gzX509_CRL_get0_extensions.3ssl.gzX509_CRL_get0_lastUpdate.3ssl.gzX509_CRL_get0_nextUpdate.3ssl.gzX509_CRL_get0_signature.3ssl.gzX509_CRL_get_REVOKED.3ssl.gzX509_CRL_get_ext.3ssl.gzX509_CRL_get_ext_by_NID.3ssl.gzX509_CRL_get_ext_by_OBJ.3ssl.gzX509_CRL_get_ext_by_critical.3ssl.gzX509_CRL_get_ext_count.3ssl.gzX509_CRL_get_ext_d2i.3ssl.gzX509_CRL_get_issuer.3ssl.gzX509_CRL_get_signature_nid.3ssl.gzX509_CRL_get_version.3ssl.gzX509_CRL_match.3ssl.gzX509_CRL_new.3ssl.gzX509_CRL_set1_lastUpdate.3ssl.gzX509_CRL_set1_nextUpdate.3ssl.gzX509_CRL_set_issuer_name.3ssl.gzX509_CRL_set_version.3ssl.gzX509_CRL_sign.3ssl.gzX509_CRL_sign_ctx.3ssl.gzX509_CRL_sort.3ssl.gzX509_CRL_verify.3ssl.gzX509_EXTENSION_create_by_NID.3ssl.gzX509_EXTENSION_create_by_OBJ.3ssl.gzX509_EXTENSION_dup.3ssl.gzX509_EXTENSION_free.3ssl.gzX509_EXTENSION_get_critical.3ssl.gzX509_EXTENSION_get_data.3ssl.gzX509_EXTENSION_get_object.3ssl.gzX509_EXTENSION_new.3ssl.gzX509_EXTENSION_set_critical.3ssl.gzX509_EXTENSION_set_data.3ssl.gzX509_EXTENSION_set_object.3ssl.gzX509_LOOKUP.3ssl.gzX509_LOOKUP_METHOD.3ssl.gzX509_LOOKUP_TYPE.3ssl.gzX509_LOOKUP_add_dir.3ssl.gzX509_LOOKUP_by_alias.3ssl.gzX509_LOOKUP_by_fingerprint.3ssl.gzX509_LOOKUP_by_issuer_serial.3ssl.gzX509_LOOKUP_by_subject.3ssl.gzX509_LOOKUP_ctrl.3ssl.gzX509_LOOKUP_ctrl_fn.3ssl.gzX509_LOOKUP_file.3ssl.gzX509_LOOKUP_free.3ssl.gzX509_LOOKUP_get_by_alias_fn.3ssl.gzX509_LOOKUP_get_by_fingerprint_fn.3ssl.gzX509_LOOKUP_get_by_issuer_serial_fn.3ssl.gzX509_LOOKUP_get_by_subject_fn.3ssl.gzX509_LOOKUP_get�x������Ha�������X�%�
��������0�(X�$8����������������(X)X'X��x�������������Q�������X�%�
��j������H��$X����������������H�I�G��b9f92186e5cb50ff4b382411f0925d4f9787ddb01a555c02fc734f7c2c6359e6e91f4c5c4081fbbd667505dc4daef02b20b9eea97a37e282fbcb341edc3a7585bffdd003803a28440319cf5af68b2fe87dc594475e075555545aa8f5269ea5c54b726dc2ead417ff7a9a233dd38c338b4e63d558436f9a13e0837fcb9bd0e275ec5895cc67199189037dd2012128cc4d6c0a788f09303e02c51a2e136143c429753f5cd9bedd2442a5b11bec01da0bb1b819706f1a11a4cb2c2079543cc16c99118d68bbb8352ec259eb0af9a4c57de60e57fc3ca7f2f31bab9b6d848f0da99dd1f115eb1e8b20ee1342f73fba71fa8e41582256a64f4de420c1fd2ef6fb7d5ffeadafcd8a3419ffe4f53bd03a6842d96895b21d21d1ba822a6409a62c854c98f903c45d92aed0164d69a368fb9370daae360ad91e08df48aced4894a4fff9e5fd6fda8218b20f8d101bc409f02bf53a27c7e81c0b793946ee44d5d471828966c3b4709593eb8576984d66683b7f24415cf4a7552b20fa3b91e78a3f23b22ed536ad033bad1c77f77a06c4c3b572f4794a0e49172987f18139834889a79ad5bc11dc1370a2cd9e41ab9a1b83de595477aee2a6a80a3fb8dd2037c4625daf20f2a3e6d365da440c91369c7beeba581bb0a7610c66d2a1ee0fda0d17a7afab3ba9ff38efa0c8a47d080be3fd28a09b89f9d1c9d1b1c95e0a7d6a8ddb8682aea18822c5c5a3a907fd4334621e4eb5a0f388d887e2126d10749b191aa71843ced14a018acde9ca2095ad5382d90c88372377b55607a9a21d82bc610604de70b92de7bdc9962e89f1f031ac2505452645dfddca314dd3c7df2cfe81777a5f20a4b5966473b8f70027afb4f89bc5d634bc4d50ff33640d80e1003e02d15e22a8d18190f91cefd81f80e9455db3101d0a96eec3cb1036212a94ef8184bfae4924eea1a139158b481977cde628d7ac47a6df32bdc98e9d25b8e19dad9f0df7f8b7c2a253102df1172270672c5fe8f87ba286f898590ff61c5086e384485753db4322cc992e96487bb051b2fc371091da99793899e6710eedeee07da5cd3b9b291b50d9ed1e2ba2da501deb857b5896dbf43c969317718874b78f4711061e7930ca2520e2b692a530a39027596a5aadd58b13f5917debde2a0a44390c754554fd124b78d361283b91992c25fa0cfb0289b86b5f8a295bbbc19c5ed57a939eadd478a0b0b70ec70645e9fc475cc58d63c0d89c7627a6c91e98d891c089957876f5463da482cf8971fb3aa5e7fbf0b66e39dce425b70047fb3624f4a72e744ae9451f17cc03332d510ba4d7688dd87e713211f1fabec33dd3e779c63003b454a3236eff2053c27eb9daab11fe3d08d6107187be45023ce01b3d7a9f46f70259ef36704bcb7bc5e0e509155f5ba9bb033cc2310cf0fde82fca3f5434f965412dd982574c763225e0420e4d78cd03908e4471246415008add05873a15854d19406e5ff8ad4367ced13577e8b5e2725fe88051ae45489569c960b2e622d4c56bb11826966971958258fecd8dbf45138b0f532168816f682bac40ea81b0c4d11d0cd41418f694dd213e192458b176358842243339ef92b6ecd2d3d3e484487268223ab7380846df9ec69b683b108f2a870525f10cb2cba282c2ceddba415ee936934d3e6076f3e8619ee81c654d65e017b25a5f2b28fa862a48c354e5c3f93a88eb8416c63f074406ea50ce83f5606c05f85cf371e5ad8c3677cd438d5aacf96411bf6847cedda60ecbb1c09c1b52acb86eefdd139a303ea736c16f5395a89321ae7db62cd446968ac83a9b792ad75774a81a9bbe4a46b13df9e6282890b95151b2fa5a7fb33f33105625705db10440a4e0825fefea99c390eae4bce020c3ab39b297bba021157ed80c8d79309048de4d962e54a54fecba7daf444737c64954df5330c02a4fe588c7839ba987b3c8a08faca5400493b1f1fd8df7ca77b42804fc3b6e1a591f872f727d5eafcc7e186ef13e5e5a9b994f8c891c49f477b160b72cfeba21b84253201295166a088b8d489d04253b74c55e16246f55bbe4f00473e953148e29a02d3b208f213a2b9a9afe28a82d716ab3df9a439084db4c3df294409f349ed16a95f5723e1855a8a8ba2951f82d3f87b9137a4349b3ae7527e20b62d8b7bd34bf1ecb416a51d1a4e85814a75e21adc57b56a158d43d4d16d967e3d978eed4dce14bac0162d00208485ff84eeeb1540d20813891a04edee1d4fa399d4c622ed0d5a8fe06ce5af1257a4bfa5005e0d102eb9af030bfba0fc0ff6ea20e9fa9b470ffca448780d32a351bc87920bcbc0c25d4809efaa22896af8bfb31fc4a786b7bca77e6ebcb8574510283bfb99467ff39aa11dc9c7534329c5e8a0803ac7e3749f853fec724c84df26d84f0fd06fbce43e06bf706f942f1db7fa964eabc92c9f999f73536955c73b3718623d6886e7ca07129000bd6d70adbf3053fe7533881f6c07ea1e59eaa6bf77967078b3bbdb9789d1a2745ac6073189ab1b5b1071b4c90b00c401e354aeacbf9929111aabb2535813227527a45ca7462aaf14765c166e288905206c38413ab720622ad4e92ed7516cc1647be6d3da9a5d077487a9c00ce4dcabdd6785cfd7cda870bbf57732d6f9d2f9ab605e3edd8164555ab6f62197a2a7db8dcd5da77670784c88cebbdaf6a212b549e76a086dd34a9efc2b284566144d29a08c2ebe1a9ee0e97eaff90206fd99748fe50306ca316160cd9e6caa95dc2973fbb16171e3da6f0e3579a5d67656e041ce38c0f2517f6f4c006e998978ed817fa92c948a620da6fd53d93b86252cf2577db2aaad7�x�������������x@�������X�$�
���������2DX�$T����������������DXCXEX�e' and 'sepolicy transition' faster
- open_init_pty: restore stdin/stdout to blocking upon exit
- fixfiles: do not dereference link files in tmp
- fixfiles: use a consistent order for options to restorecon
- fixfiles: don't ignore `-F` when run in `-C` mode
- fixfiles: remove bad modes of "relabel" command
- fixfiles: refactor into the `set -u` dialect
- fixfiles: if restorecon aborts, we should too
- fixfiles: usage errors are fatal
- fixfiles: syntax error
- fixfiles: remove two unused variables
- fixfiles: tidy up usage(), manpage synopsis
- fixfiles: deprecate -l option
- fixfiles: move logit call outside of redirected function
- fixfiles: fix logging about R/O filesystems
- fixfiles: clarify exclude_dirs()
- fixfiles: remove (broken) redundant code- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- semanage: Unify argument handling (#1398987)
- setfiles: set up a logging callback for libselinux
- setfiles: Fix setfiles progress indicator
- setfiles: stdout messages don't need program prefix
- setfiles: don't scramble stdout and stderr together (#1435894)
- restorecond: Decrease loglevel of termination message (#1264505)
- fixfiles should handle path arguments more robustly
- fixfiles: handle unexpected spaces in command
- fixfiles: remove useless use of cat (#1435894)
- semanage: Add checks if a module name is passed in (#1420707)
- semanage: fix export of fcontext socket entries (#1435127)
- selinux-autorelabel: remove incorrect redirection to /dev/null (#1415674)- Fix selinux-polgengui (#1432337)
- sepolicy - fix obtaining domain name in HTMLManPages- Fix several issues in gui and 'sepolicy manpage' (#1416372)- Use %{__python3} instead of python3- Fix pp crash when processing base module (#1417200)
- Update to upstream release 2016-10-14- Rebuild for brp-python-bytecompile- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuild for python 3.6- seobject: Handle python error returns correctly
- policycoreutils/sepolicy/gui: fix current selinux state radiobutton
- policycoreutils: semodule_package: do not fail with an empty fc file- Update translations
- Fix fcontextPage editing features (#1344842)- sandbox: Use dbus-run-session instead of dbus-launch when available
- hll/pp: Change warning for module name not matching filename to match new behavior
- Remove LDFLAGS from CFLAGS
- sandbox: create a new session for sandboxed processes
- sandbox: do not try to setup directories without -X or -M
- sandbox: do not run xmodmap in a new X session
- sandbox: Use GObject introspection binding instead of pygtk2
- sandbox: fix file labels on copied files
- sandbox: tests - close stdout of p
- sandbox: tests - use sandbox from cwd
- audit2allow: tests should use local copy not system
- audit2allow: fix audit2why import from seobject
- audit2allow: remove audit2why so that it gets symlinked
- semanage: fix man page and help message for import option
- semanage: fix error message for fcontext -m
- semanage: Fix semanage fcontext -D
- semanage: Correct fcontext auditing
- semanage: Default serange to "s0" for port modify
- semanage: Use socket.getprotobyname for protocol
- semanage: fix modify action in node and interface
- fixfiles: Pass -n to restorecon for fixfiles check
- sepolicy: Check get_rpm_nvr_list() return value
- Don't use subprocess.getstatusoutput() in Python 2 code
- semanage: Add auditing of changes in records
- Remove unused 'q' from semodule getopt string- Remove unused autoconf files from po/
- Remove duplicate, empty translation files
- Rebuilt with libsepol-2.5-9, libselinux-2.5-11, libsemanage-2.5-7- Fix sandbox -X issue related to python3 (#1358138)- Use generator approach to fix autorelabel- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- open_init_pty: Do not error on EINTR
- Fix [-s STORE] typos in semanage
- Update sandbox types in sandbox manual
- Update translations- Convert sandbox to gtk-3 using pygi-convert.sh (#1343166)- Fix typos in semanage manpages
- Fix the documentation of -l,--l�x�����p��/�������XB%�
���������:�d�$�����������������d�d�d�-4Tomáš Mráz <tmraz@redhat.com> 1.1.0c-3Tomáš Mráz <tmraz@redhat.com> 1.1.0c-2Tomáš Mráz <tmraz@redhat.com> 1.1.0c-1Tomáš Mráz <tmraz@redhat.com> 1.1.0b-4Tomáš Mráz <tmraz@redhat.com> 1.1.0b-3Tomáš Mráz <tmraz@redhat.com> 1.1.0b-2Tomáš Mráz <tmraz@redhat.com> 1.1.0b-1Richard W.M. Jones <rjones@redhat.com> - 1:1.0.2j-2Tomáš Mráz <tmraz@redhat.com> 1.0.2j-1David Woodhouse <dwmw2@infradead.org> 1.0.2i-2Tomáš Mráz <tmraz@redhat.com> 1.0.2i-1Tomáš Mráz <tmraz@redhat.com> 1.0.2h-3Tomáš Mráz <tmraz@redhat.com> 1.0.2h-2Tomáš Mráz <tmraz@redhat.com> 1.0.2h-1Tomáš Mráz <tmraz@redhat.com> 1.0.2g-4Tom Callaway <spot@fedoraproject.org> - 1.0.2g-3Tomáš Mráz <tmraz@redhat.com> 1.0.2g-2Tomáš Mráz <tmraz@redhat.com> 1.0.2g-1Fedora Release Engineering <releng@fedoraproject.org> - 1:1.0.2f-2Tomáš Mráz <tmraz@redhat.com> 1.0.2f-1Tomáš Mráz <tmraz@redhat.com> 1.0.2e-5Tomáš Mráz <tmraz@redhat.com> 1.0.2e-4Tomáš Mráz <tmraz@redhat.com> 1.0.2e-3Tomáš Mráz <tmraz@redhat.com> 1.0.2e-2Tomáš Mráz <tmraz@redhat.com> 1.0.2e-1Tomáš Mráz <tmraz@redhat.com> 1.0.2d-3Tom Callaway <spot@fedoraproject.org> 1.0.2d-2Tomáš Mráz <tmraz@redhat.com> 1.0.2d-1Tomáš Mráz <tmraz@redhat.com> 1.0.2c-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:1.0.2c-2Tomáš Mráz <tmraz@redhat.com> 1.0.2c-1Peter Robinson <pbrobinson@fedoraproject.org> 1.0.2a-4Tomáš Mráz <tmraz@redhat.com> 1.0.2a-3Tomáš Mráz <tmraz@redhat.com> 1.0.2a-2Tomáš Mráz <tmraz@redhat.com> 1.0.2a-1Tomáš Mráz <tmraz@redhat.com> 1.0.1k-7Tomáš Mráz <tmraz@redhat.com> 1.0.1k-6Tomáš Mráz <tmraz@redhat.com> 1.0.1k-5Tomáš Mráz <tmraz@redhat.com> 1.0.1k-4Till Maas <opensource@till.name> - 1:1.0.1k-3Tomáš Mráz <tmraz@redhat.com> 1.0.1k-2Tomáš Mráz <tmraz@redhat.com> 1.0.1k-1Tomáš Mráz <tmraz@redhat.com> 1.0.1j-3Tomáš Mráz <tmraz@redhat.com> 1.0.1j-2Tomáš Mráz <tmraz@redhat.com> 1.0.1j-1Tomáš Mráz <tmraz@redhat.com> 1.0.1i-5Tomáš Mráz <tmraz@redhat.com> 1.0.1i-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:1.0.1i-3Tomáš Mráz <tmraz@redhat.com> 1.0.1i-2Tomáš Mráz <tmraz@redhat.com> 1.0.1i-1Tom Callaway <spot@fedoraproject.org> 1.0.1h-6Tomáš Mráz <tmraz@redhat.com> 1.0.1h-5Tomáš Mráz <tmraz@redhat.com> 1.0.1h-4Tomáš Mráz <tmraz@redhat.com> 1.0.1h-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:1.0.1h-2Tomáš Mráz <tmraz@redhat.com> 1.0.1h-1Peter Robinson <pbrobinson@fedoraproject.org> 1.0.1g-2Tomáš Mráz <tmraz@redhat.com> 1.0.1g-1Dennis Gilmore <dennis@ausil.us> - 1.0.1e-44Tomáš Mráz <tmraz@redhat.com> 1.0.1e-43Tomáš Mráz <tmraz@redhat.com> 1.0.1e-42Tomáš Mráz <tmraz@redhat.com> 1.0.1e-41Tomáš Mráz <tmraz@redhat.com> 1.0.1e-40Tomáš Mráz <tmraz@redhat.com> 1.0.1e-39Tomáš Mráz <tmraz@redhat.com> 1.0.1e-38Tomáš Mráz <tmraz@redhat.com> 1.0.1e-37Tomáš Mráz <tmraz@redhat.com> 1.0.1e-36Tomáš Mráz <tmraz@redhat.com> 1.0.1e-35Tomáš Mráz <tmraz@redhat.com> 1.0.1e-34Tomáš Mráz <tmraz@redhat.com> 1.0.1e-33Tomáš Mráz <tmraz@redhat.com> 1.0.1e-32Tomáš Mráz <tmraz@redhat.com> 1.0.1e-31Tomáš Mráz <tmraz@redhat.com> 1.0.1e-30Tomáš Mráz <tmraz@redhat.com> 1.0.1e-29Tomáš Mráz <tmraz@redhat.com> 1.0.1e-28Tom Callaway <spot@fedoraproject.org> - 1.0.1e-27Tomáš Mráz <tmraz@redhat.com> 1.0.1e-26Tomáš Mráz <tmraz@redhat.com> 1.0.1e-25Tomáš Mráz <tmraz@redhat.com> 1.0.1e-24Tomáš Mráz <tmraz@redhat.com> 1.0.1e-23Tomáš Mráz <tmraz@redhat.com> 1.0.1e-22Kyle McMartin <kyle@redhat.com> 1.0.1e-21Tomas Mraz <tmraz@redhat.com> 1.0.1e-20Tomas Mraz <tmraz@redhat.com> 1.0.1e-19Tomas Mraz <tmraz@redhat.com> 1.0.1e-18Tomas Mraz <tmraz@redhat.com> 1.0.1e-17Tomas Mraz <tmraz@redhat.com> 1.0.1e-16Tomas Mraz <tmraz@redhat.com> 1.0.1e-15Petr Pisar <ppisar@redhat.com> - 1:1.0.1e-14Tomas Mraz <tmraz@redhat.com> 1.0.1e-13Tomas Mraz <tmraz@redhat.com> 1.0.1e-12Tomas Mraz <tmraz@redhat.com> 1.0.1e-11Pet�x�������������h�������Xk%�
���������*kd�${����������������kdldjd�nOIDs.3ssl.gzPROFESSION_INFO_set0_registrationNumber.3ssl.gzPROXY_CERT_INFO_EXTENSION_free.3ssl.gzPROXY_CERT_INFO_EXTENSION_new.3ssl.gzPROXY_POLICY_free.3ssl.gzPROXY_POLICY_new.3ssl.gzRAND_DRBG_bytes.3ssl.gzRAND_DRBG_cleanup_entropy_fn.3ssl.gzRAND_DRBG_cleanup_nonce_fn.3ssl.gzRAND_DRBG_free.3ssl.gzRAND_DRBG_generate.3ssl.gzRAND_DRBG_get0_master.3ssl.gzRAND_DRBG_get0_private.3ssl.gzRAND_DRBG_get0_public.3ssl.gzRAND_DRBG_get_entropy_fn.3ssl.gzRAND_DRBG_get_ex_data.3ssl.gzRAND_DRBG_get_ex_new_index.3ssl.gzRAND_DRBG_get_nonce_fn.3ssl.gzRAND_DRBG_instantiate.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_reseed.3ssl.gzRAND_DRBG_secure_new.3ssl.gzRAND_DRBG_set.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_set_defaults.3ssl.gzRAND_DRBG_set_ex_data.3ssl.gzRAND_DRBG_set_reseed_defaults.3ssl.gzRAND_DRBG_set_reseed_interval.3ssl.gzRAND_DRBG_set_reseed_time_interval.3ssl.gzRAND_DRBG_uninstantiate.3ssl.gzRAND_OpenSSL.3ssl.gzRAND_add.3ssl.gzRAND_bytes.3ssl.gzRAND_cleanup.3ssl.gzRAND_egd.3ssl.gzRAND_egd_bytes.3ssl.gzRAND_event.3ssl.gzRAND_file_name.3ssl.gzRAND_get_rand_method.3ssl.gzRAND_keep_random_devices_open.3ssl.gzRAND_load_file.3ssl.gzRAND_poll.3ssl.gzRAND_priv_bytes.3ssl.gzRAND_pseudo_bytes.3ssl.gzRAND_query_egd_bytes.3ssl.gzRAND_screen.3ssl.gzRAND_seed.3ssl.gzRAND_set_rand_method.3ssl.gzRAND_status.3ssl.gzRAND_write_file.3ssl.gzRC4.3ssl.gzRC4_set_key.3ssl.gzRIPEMD160.3ssl.gzRIPEMD160_Final.3ssl.gzRIPEMD160_Init.3ssl.gzRIPEMD160_Update.3ssl.gzRSAPrivateKey_dup.3ssl.gzRSAPublicKey_dup.3ssl.gzRSA_OAEP_PARAMS_free.3ssl.gzRSA_OAEP_PARAMS_new.3ssl.gzRSA_PKCS1_OpenSSL.3ssl.gzRSA_PSS_PARAMS_free.3ssl.gzRSA_PSS_PARAMS_new.3ssl.gzRSA_bits.3ssl.gzRSA_blinding_off.3ssl.gzRSA_blinding_on.3ssl.gzRSA_check_key.3ssl.gzRSA_check_key_ex.3ssl.gzRSA_clear_flags.3ssl.gzRSA_flags.3ssl.gzRSA_free.3ssl.gzRSA_generate_key.3ssl.gzRSA_generate_key_ex.3ssl.gzRSA_generate_multi_prime_key.3ssl.gzRSA_get0_crt_params.3ssl.gzRSA_get0_d.3ssl.gzRSA_get0_dmp1.3ssl.gzRSA_get0_dmq1.3ssl.gzRSA_get0_e.3ssl.gzRSA_get0_engine.3ssl.gzRSA_get0_factors.3ssl.gzRSA_get0_iqmp.3ssl.gzRSA_get0_key.3ssl.gzRSA_get0_multi_prime_crt_params.3ssl.gzRSA_get0_multi_prime_factors.3ssl.gzRSA_get0_n.3ssl.gzRSA_get0_p.3ssl.gzRSA_get0_pss_params.3ssl.gzRSA_get0_q.3ssl.gzRSA_get_default_method.3ssl.gzRSA_get_ex_data.3ssl.gzRSA_get_ex_new_index.3ssl.gzRSA_get_method.3ssl.gzRSA_get_multi_prime_extra_count.3ssl.gzRSA_get_version.3ssl.gzRSA_meth_dup.3ssl.gzRSA_meth_free.3ssl.gzRSA_meth_get0_app_data.3ssl.gzRSA_meth_get0_name.3ssl.gzRSA_meth_get_bn_mod_exp.3ssl.gzRSA_meth_get_finish.3ssl.gzRSA_meth_get_flags.3ssl.gzRSA_meth_get_init.3ssl.gzRSA_meth_get_keygen.3ssl.gzRSA_meth_get_mod_exp.3ssl.gzRSA_meth_get_multi_prime_keygen.3ssl.gzRSA_meth_get_priv_dec.3ssl.gzRSA_meth_get_priv_enc.3ssl.gzRSA_meth_get_pub_dec.3ssl.gzRSA_meth_get_pub_enc.3ssl.gzRSA_meth_get_sign.3ssl.gzRSA_meth_get_verify.3ssl.gzRSA_meth_new.3ssl.gzRSA_meth_set0_app_data.3ssl.gzRSA_meth_set1_name.3ssl.gzRSA_meth_set_bn_mod_exp.3ssl.gzRSA_meth_set_finish.3ssl.gzRSA_meth_set_flags.3ssl.gzRSA_meth_set_init.3ssl.gzRSA_meth_set_keygen.3ssl.gzRSA_meth_set_mod_exp.3ssl.gzRSA_meth_set_multi_prime_keygen.3ssl.gzRSA_meth_set_priv_dec.3ssl.gzRSA_meth_set_priv_enc.3ssl.gzRSA_meth_set_pub_dec.3ssl.gzRSA_meth_set_pub_enc.3ssl.gzRSA_meth_set_sign.3ssl.gzRSA_meth_set_verify.3ssl.gzRSA_new.3ssl.gzRSA_new_method.3ssl.gzRSA_padding_add_PKCS1_OAEP.3ssl.gzRSA_padding_add_PKCS1_OAEP_mgf1.3ssl.gzRSA_padding_add_PKCS1_type_1.3ssl.gzRSA_padding_add_PKCS1_type_2.3ssl.gzRSA_padding_add_SSLv23.3ssl.gzRSA_padding_add_none.3ssl.gzRSA_padding_check_PKCS1_OAEP.3ssl.gzRSA_padding_check_PKCS1_OAEP_mgf1.3ssl.gzRSA_padding_check_PKCS1_type_1.3ssl.gzRSA_padding_check_PKCS1_type_2.3ssl.gzRSA_padding_check_SSLv23.3ssl.gzRSA_padding_check_none.3ssl.gzRSA_print.3ssl.gzRSA_print_fp.3ssl.gzRSA_private_decrypt.3ssl.gzRSA_private_encrypt.3ssl.gzRSA_public_decrypt.3ssl.gzRSA_public_encrypt.3ssl.gzRSA_security_b�x���������������������X�$�
�v�&������^�$N����������������^]_� <dwalsh@RedHat.com> 2.12-19Elliot Lee <sopwith@redhat.com> 2.12-18Elliot Lee <sopwith@redhat.com> 2.12-17Elliot Lee <sopwith@redhat.com> 2.12-16Jeremy Katz <katzj@redhat.com> 2.12-15<SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com> 2.12-13<SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com>Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com> Dan Walsh <dwalsh@redhat.com> 2.12-5Elliot Lee <sopwith@redhat.com> 2.12-4Dan Walsh <dwalsh@redhat.com> 2.12-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12-1Steve Dickson <SteveD@RedHat.com> 2.12pre-4Elliot Lee <sopwith@redhat.com> 2.12pre-3Dan Walsh <dwalsh@redhat.com> 2.12pre-2Elliot Lee <sopwith@redhat.com> 2.12pre-1Dan Walsh <dwalsh@redhat.com> 2.11y-35.selDan Walsh <dwalsh@redhat.com> 2.11y-34.selElliot Lee <sopwith@redhat.com> 2.11y-34Dan Walsh <dwalsh@redhat.com> 2.11y-33Dan Walsh <dwalsh@redhat.com> 2.11y-32.selElliot Lee <sopwith@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-30.selElliot Lee <sopwith@redhat.com> 2.11y-28Dan Walsh <dwalsh@redhat.com> 2.11y-27Dan Walsh <dwalsh@redhat.com> 2.11y-26.selElliot Lee <sopwith@redhat.com> 2.11y-25Dan Walsh <dwalsh@redhat.com> 2.11y-24Elliot Lee <sopwith@redhat.com> 2.11y-22Elliot Lee <sopwith@redhat.com> 2.11y-20Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-17Elliot Lee <sopwith@redhat.com> 2.11y-16Elliot Lee <sopwith@redhat.com> 2.11y-15Matt Wilson <msw@redhat.com> 2.11y-14Jeremy Katz <katzj@redhat.com> 2.11y-13Jeremy Katz <katzj@redhat.com> 2.11y-12Phil Knirsch <pknirsch@redhat.com> 2.11y-11Elliot Lee <sopwith@redhat.com> 2.11y-10Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-8Yukihiro Nakai <ynakai@redhat.com> 2.11y-7Elliot Lee <sopwith@redhat.com> 2.11y-6Tim Waugh <twaugh@redhat.com> 2.11y-5Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11y-4Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-2Elliot Lee <sopwith@redhat.com> 2.11y-1Elliot Lee <sopwith@redhat.com> 2.11w-2Elliot Lee <sopwith@redhat.com> 2.11w-1Phil Knirsch <pknirsch@redhat.com> 2.11r-10hammer.3Elliot Lee <sopwith@redhat.com> 2.11r-10hammer.2Than Ngo <than@redhat.com> 2.11r-10hammer.1Bernhard Rosenkraenzer <bero@redhat.com> 2.11r-10hammerElliot Lee <sopwith@redhat.com> 2.11r-10Elliot Lee <sopwith@redhat.com> 2.11r-9Elliot Lee <sopwith@redhat.com> 2.11r-8Elliot Lee <sopwith@redhat.com> 2.11r-7Elliot Lee <sopwith@redhat.com> 2.11r-6Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 2.11r-4Trond Eivind Glomsrod <teg@redhat.com> 2.11r-3Elliot Lee <sopwith@redhat.com> 2.11r-2Elliot Lee <sopwith@redhat.com> 2.11r-1Elliot Lee <sopwith@redhat.com> 2.11n-19Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-17Trond Eivind Glomsrod <teg@redhat.com> 2.11n-16Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-14Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11n-12Elliot Lee <sopwith@redhat.com> 2.11n-11Elliot Lee <sopwith@redhat.com> 2.11n-10Elliot Lee <sopwith@redhat.com> 2.11n-9Elliot Lee <sopwith@redhat.com> 2.11n-8Elliot Lee <sopwith@redhat.com> 2.11n-7Elliot Lee <sopwith@redhat.com> 2.11n-6Elliot Lee <sopwith@redhat.com> 2.11n-5Bill Nottingham <notting@redhat.com> 2.11n-4Elliot Lee <sopwith@redhat.com> 2.11n-3Elliot Lee <sopwith@redhat.com> 2.11n-1Elliot Lee <sopwith@redhat.com> 2.11f-17Elliot Lee <sopwith@redhat.com> 2.11f-16Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com> 2.11f-14Elliot Lee <sopwith@redhat.com> 2.11f-13Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-10Elliot Lee <sopwith@redhat.com> 2.11f-9Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-7Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat�x�������������X��������X�%�
�������O��$_����������������O�P�N��h�/�h�/�h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h��x��������������������X%�
h�������m	�d�$S�����������������d�d�d�b215ef8fff39f6039ae8ec4a639dea994ff251825f6ff3faf4151657aaf552b4d6ae64b639b87659b69eb11e8cd39050fbf5407dfc54743a7b0364f5ba061a237ffaafd4761986bd7be193d9b90012a6213f0944a09b8a8f53572a41f9c0a7c3fdaa5cd5e8d00b3745bf0a60e3225edc7c5fe7b348ab53d673c6cf834b6f660398f3842f299f3b4fbbb75ff731a1911dbff5e870c8989e26960d8de2df9de71b5702860e31624c862e5d1304eff9a6f218a3ea93c6a25ee21af6f544775f18c668da5d36f4718edf3d242d2c0b0d70faa203a08552e0065668afb06f13411079cba83c14dae6107d1dac325192914560676984055a848e74b7c905f579f38ccc414fc9b39e9b5c4b9168575dbb8576d9a039b81109c74608fcd46dc39acf16af424a378a76333d2ce0759324c9b27efacf405539ed75cbd26c46cf7d855e195869b5f6bae3828d7169e89619482ef52f32ec0771df021093ea0f99bfbbb8f4d215d14fbcad03062cf310cca6852fe01c4542f840e7e9a89c4b4d246d9185ba09c4a2d2eb0a5ac48e6dde62b3b888a1ab2761e98ef2bbd75ede8a82dce649447c1ef926ce5096318d2f539aa338668921714438e33e7b7179d349c419d24ef386c97d8e116f98e7411276560c9a4b8492dbfdb283ad3d3fc0233882e85bd3301efac388b8a48b39915eddd7fd8d5816f971ec1d8e9d222690ee82d53f52630e99a73229da9b224a27641c8a0ad857efd94aeee3eee43bcdaf3f08198ebe3a581bf908c5bf5c4e9c69a4540075659f978720a9e3c20ae425ceb4717496f2ac87cc943c76a4f5279b019a0b9a830581da56616f6024559870c3ffbea9d9961d8ec56c5e0791cf1eac26c0c6895ae331da9c3e76a3be6cf9556baea39d273ae19e9059dd047154a7e940e64b63aaf1deffb93609d260f0dcc788e8b777ec8ae83b8020b73e71ac5dc7835004f471f123332f6f63ad8dab771d7b25408af35ce2e2519a20e282afdbac413f7421e6694eb8658d52417cd3274133a7ed17fece9fb7da10915e510e3066e579732d27c0c80cf98ce58cadf78d62e7b35dc6d9b15e117eeb4b50753e32a1bf5608b1e24fc4d4cd64c291a6d8785548ee2ce3d2b02c7c1d8b92cffc4599ac7a1fa5b93c9e31f7ffeef9d6a2ef68c4b1ed758050ee2724e9ca8caba0a31feed38c14d107797800c0289b7039e908fd4c49be029c2ba0e2202f84b890da6c96dec801a50ed9f44322a8452328b7c7c0d53fd464dca3bdf55e1d5b281eb8d31cc02148de7f451929f0466066e75447cc59cb18fe47717f9a48eab915703f2bed9822ab8d8e2e8c0e8a1d144ba95926d8e40c6499964177d357587907d22faac3a548700be46c6b38587da3287936d1d2f6e682cf093d9fa2d98746a52800b613aaa6db15af9fa327526f3aae2b2e0cb6adb05a013ea4e2327ae803830ecd4adfb37a321d3ace9f7a25bfe9d4ea936e33bfb231319ab04bb45d4c3b117c14821a49fefb4a0c22a0288eab83dde8a867e3cd90c387ce01c0280c274ef25ba7a5db1c83a583e88c69c815b703c03a1241392f38668a5c60c42c0325772b1da9e9afde24d84d53e1ef5537b3604ad0d2444846989c5c69ab929d3a3051fd0136bff72e0872b49988e8cdefb9f3dc50d0644018417419e5db2a43ac21f3e105b519b066498abe60c4c7050e1394393475ed6a1f3027e4cbae9c96e7bfe125cfc50c5824b63b2c05b7fb2aa71f9efaf4e6b73802c9837f96b0e0ca817bd70f184772737a6948a9cf5795f14c5aa7fc7f1c02f56a5103c77d0420d8d9587f02c91050ec180259cc25b23a3beeea82eb643ad501c46b926b5c1d37fb0ec2e993bb5a573e479316add6f16d36b1a5daef7070636d3487fafb23e4961b0a4106a0042af31d678e1b87c40516a9cb9f595cca2b088135b9fe8ab0c13e566b01ea0791d9e790f11581719c9bb7b3e24600f0b24a2438f48e22629cdd654f6a6613d2220003383a888a60240a506279db96d172d4ab3e8584df31f40888e413f09dd0e3e49d576fab3a89821bb7ea43e1bd67b304dcd5e77a7711255eadf663824f8011a9d3edbc1a80985a89ceceeef40f0f09e07f7651c3a2834322000a47a4d012f439f28297ed0a53233771ceef5c220ef65ffd27fc6b753565df5e00eb6fe5961c853274bec4c98eb99817f7deb41e25f10309e16649f239b9f97c2dd87a8c98f8427612531fa12b2f937ed4eb5c5ea61c91bc0a5e524bd3ab00eec05fcc77bc903322db4bce8f1db20462b11aee68a84e01070a675d6e059de7858638514c69cde2ce87f570b3c477a4e0762a641f2af4d42320160486aad400f35e9f3f405af4964487f3d1b5111873b7c7641f2acb4673a941808783173b7164dd55f88e6f3824d390fbb26f901e28008f019b79876502947cbcc1b71065f78b40d90e8435c22de3848d99fd7a50dce4cc83a60e84314d5517890b1d7018d998067b9d67f49849487d1076c7d012e362903c88ac029eed872d36f28c4aba97e475edc5cec7b924610c8acf513bb54b521b6f7a0e8ba3ee5b60ff2f44df1990f9e043b837b45a806c8�x�������������8�������Xp%�
X$��������fd�$v����������������fdgd8Y�SSL_set1_sigalgs.3ssl.gzSSL_set1_sigalgs_list.3ssl.gzSSL_set1_verify_cert_store.3ssl.gzSSL_set_accept_state.3ssl.gzSSL_set_allow_early_data_cb.3ssl.gzSSL_set_alpn_protos.3ssl.gzSSL_set_bio.3ssl.gzSSL_set_block_padding.3ssl.gzSSL_set_cert_cb.3ssl.gzSSL_set_cipher_list.3ssl.gzSSL_set_ciphersuites.3ssl.gzSSL_set_client_CA_list.3ssl.gzSSL_set_connect_state.3ssl.gzSSL_set_ct_validation_callback.3ssl.gzSSL_set_current_cert.3ssl.gzSSL_set_default_passwd_cb.3ssl.gzSSL_set_default_passwd_cb_userdata.3ssl.gzSSL_set_default_read_buffer_len.3ssl.gzSSL_set_ex_data.3ssl.gzSSL_set_fd.3ssl.gzSSL_set_generate_session_id.3ssl.gzSSL_set_hostflags.3ssl.gzSSL_set_info_callback.3ssl.gzSSL_set_max_cert_list.3ssl.gzSSL_set_max_early_data.3ssl.gzSSL_set_max_pipelines.3ssl.gzSSL_set_max_proto_version.3ssl.gzSSL_set_max_send_fragment.3ssl.gzSSL_set_min_proto_version.3ssl.gzSSL_set_mode.3ssl.gzSSL_set_msg_callback.3ssl.gzSSL_set_msg_callback_arg.3ssl.gzSSL_set_num_tickets.3ssl.gzSSL_set_options.3ssl.gzSSL_set_post_handshake_auth.3ssl.gzSSL_set_psk_client_callback.3ssl.gzSSL_set_psk_find_session_callback.3ssl.gzSSL_set_psk_server_callback.3ssl.gzSSL_set_psk_use_session_callback.3ssl.gzSSL_set_quiet_shutdown.3ssl.gzSSL_set_read_ahead.3ssl.gzSSL_set_record_padding_callback.3ssl.gzSSL_set_record_padding_callback_arg.3ssl.gzSSL_set_recv_max_early_data.3ssl.gzSSL_set_rfd.3ssl.gzSSL_set_security_callback.3ssl.gzSSL_set_security_level.3ssl.gzSSL_set_session.3ssl.gzSSL_set_session_id_context.3ssl.gzSSL_set_shutdown.3ssl.gzSSL_set_split_send_fragment.3ssl.gzSSL_set_ssl_method.3ssl.gzSSL_set_time.3ssl.gzSSL_set_timeout.3ssl.gzSSL_set_tlsext_host_name.3ssl.gzSSL_set_tlsext_max_fragment_length.3ssl.gzSSL_set_tlsext_status_ocsp_resp.3ssl.gzSSL_set_tlsext_status_type.3ssl.gzSSL_set_tlsext_use_srtp.3ssl.gzSSL_set_tmp_dh.3ssl.gzSSL_set_tmp_dh_callback.3ssl.gzSSL_set_verify.3ssl.gzSSL_set_verify_depth.3ssl.gzSSL_set_verify_result.3ssl.gzSSL_set_wfd.3ssl.gzSSL_shutdown.3ssl.gzSSL_state_string.3ssl.gzSSL_state_string_long.3ssl.gzSSL_stateless.3ssl.gzSSL_up_ref.3ssl.gzSSL_use_PrivateKey.3ssl.gzSSL_use_PrivateKey_ASN1.3ssl.gzSSL_use_PrivateKey_file.3ssl.gzSSL_use_RSAPrivateKey.3ssl.gzSSL_use_RSAPrivateKey_ASN1.3ssl.gzSSL_use_RSAPrivateKey_file.3ssl.gzSSL_use_cert_and_key.3ssl.gzSSL_use_certificate.3ssl.gzSSL_use_certificate_ASN1.3ssl.gzSSL_use_certificate_chain_file.3ssl.gzSSL_use_certificate_file.3ssl.gzSSL_use_psk_identity_hint.3ssl.gzSSL_verify_cb.3ssl.gzSSL_verify_client_post_handshake.3ssl.gzSSL_version.3ssl.gzSSL_waiting_for_async.3ssl.gzSSL_want.3ssl.gzSSL_want_async.3ssl.gzSSL_want_async_job.3ssl.gzSSL_want_client_hello_cb.3ssl.gzSSL_want_nothing.3ssl.gzSSL_want_read.3ssl.gzSSL_want_write.3ssl.gzSSL_want_x509_lookup.3ssl.gzSSL_write.3ssl.gzSSL_write_early_data.3ssl.gzSSL_write_ex.3ssl.gzSSLv23_client_method.3ssl.gzSSLv23_method.3ssl.gzSSLv23_server_method.3ssl.gzSSLv3_client_method.3ssl.gzSSLv3_method.3ssl.gzSSLv3_server_method.3ssl.gzSXNETID_free.3ssl.gzSXNETID_new.3ssl.gzSXNET_free.3ssl.gzSXNET_new.3ssl.gzTLS_FEATURE_free.3ssl.gzTLS_FEATURE_new.3ssl.gzTLS_client_method.3ssl.gzTLS_method.3ssl.gzTLS_server_method.3ssl.gzTLSv1_1_client_method.3ssl.gzTLSv1_1_method.3ssl.gzTLSv1_1_server_method.3ssl.gzTLSv1_2_client_method.3ssl.gzTLSv1_2_method.3ssl.gzTLSv1_2_server_method.3ssl.gzTLSv1_client_method.3ssl.gzTLSv1_method.3ssl.gzTLSv1_server_method.3ssl.gzTS_ACCURACY_dup.3ssl.gzTS_ACCURACY_free.3ssl.gzTS_ACCURACY_new.3ssl.gzTS_MSG_IMPRINT_dup.3ssl.gzTS_MSG_IMPRINT_free.3ssl.gzTS_MSG_IMPRINT_new.3ssl.gzTS_REQ_dup.3ssl.gzTS_REQ_free.3ssl.gzTS_REQ_new.3ssl.gzTS_RESP_dup.3ssl.gzTS_RESP_free.3ssl.gzTS_RESP_new.3ssl.gzTS_STATUS_INFO_dup.3ssl.gzTS_STATUS_INFO_free.3ssl.gzTS_STATUS_INFO_new.3ssl.gzTS_TST_INFO_dup.3ssl.gzTS_TST_INFO_free.3ssl.gzTS_TST_INFO_new.3ssl.gzUI.3ssl.gzUI_METHOD.3ssl.gzUI_OpenSSL.3ssl.gzUI_STRING.3ssl.gzUI_UTIL_read_pw.3ssl.gzUI_UTIL_read_pw_string.3ssl.gzUI_UTIL_wrap_read_pem_callba�x���������������������X%�
���������:�d�$A�����������������d�d�H$t?�d���� �	$�	a�$�(�D�H�R�\�p�	���������?��	^��
~��(�\��
�(��D�!��o�o�����(
�\
�p
(��8���9�,�:��G�x�Hٔ�I��X'8Y'L\'��]e��^Ib�d"e'f*l,tD�uS`�v�|
w�,�x�H�yd����������6*:6
p�����$hg$lh$pCopenssl-devel1.1.1k14.el8_6Files for development of applications which will use OpenSSLOpenSSL is a toolkit for supporting cryptography. The openssl-devel
package contains include files needed to develop applications which
support various cryptographic algorithms and protocols.g�x64-builder02.almalinux.org6-<AlmaLinuxAlmaLinuxOpenSSL and ASL 2.0AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.openssl.org/linuxx86_64
�[�9_��	^.�[7Vwi@4k�(?�+�0��
eC��>
��5�?'w
*"����ffA�eG,,�/)&�73��$7*((�Uv�$;�
"-�<l�f&��-F�	6�W�9��WL&[�
���$�89q�T+�/*W�Z�>�
�a�>~����"I#
�	���
;
��	�
a
	2\
0$����

�����I
]
�
!�
��
�	�{
�;�{8	E	�f�
,
7
�	�
w	8
��	Hu3

v�

2M
[
��x�������������(��������X�$�
L�^q�$a����������������qpr�C_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

 !"#$%&'()*+,-./0123456789:;<=>?@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@�x����������������������Xl%�
��������fjd�$z����������������jdkdid�its.3ssl.gzRSA_set0_crt_params.3ssl.gzRSA_set0_factors.3ssl.gzRSA_set0_key.3ssl.gzRSA_set0_multi_prime_params.3ssl.gzRSA_set_default_method.3ssl.gzRSA_set_ex_data.3ssl.gzRSA_set_flags.3ssl.gzRSA_set_method.3ssl.gzRSA_sign.3ssl.gzRSA_sign_ASN1_OCTET_STRING.3ssl.gzRSA_size.3ssl.gzRSA_test_flags.3ssl.gzRSA_verify.3ssl.gzRSA_verify_ASN1_OCTET_STRING.3ssl.gzSCRYPT_PARAMS_free.3ssl.gzSCRYPT_PARAMS_new.3ssl.gzSCT_LIST_free.3ssl.gzSCT_LIST_print.3ssl.gzSCT_LIST_validate.3ssl.gzSCT_free.3ssl.gzSCT_get0_extensions.3ssl.gzSCT_get0_log_id.3ssl.gzSCT_get0_signature.3ssl.gzSCT_get_log_entry_type.3ssl.gzSCT_get_signature_nid.3ssl.gzSCT_get_source.3ssl.gzSCT_get_timestamp.3ssl.gzSCT_get_validation_status.3ssl.gzSCT_get_version.3ssl.gzSCT_new.3ssl.gzSCT_new_from_base64.3ssl.gzSCT_print.3ssl.gzSCT_set0_extensions.3ssl.gzSCT_set0_log_id.3ssl.gzSCT_set0_signature.3ssl.gzSCT_set1_extensions.3ssl.gzSCT_set1_log_id.3ssl.gzSCT_set1_signature.3ssl.gzSCT_set_log_entry_type.3ssl.gzSCT_set_signature_nid.3ssl.gzSCT_set_source.3ssl.gzSCT_set_timestamp.3ssl.gzSCT_set_version.3ssl.gzSCT_validate.3ssl.gzSCT_validation_status_string.3ssl.gzSHA1.3ssl.gzSHA1_Final.3ssl.gzSHA1_Init.3ssl.gzSHA1_Update.3ssl.gzSHA224.3ssl.gzSHA224_Final.3ssl.gzSHA224_Init.3ssl.gzSHA224_Update.3ssl.gzSHA256.3ssl.gzSHA256_Final.3ssl.gzSHA256_Init.3ssl.gzSHA256_Update.3ssl.gzSHA384.3ssl.gzSHA384_Final.3ssl.gzSHA384_Init.3ssl.gzSHA384_Update.3ssl.gzSHA512.3ssl.gzSHA512_Final.3ssl.gzSHA512_Init.3ssl.gzSHA512_Update.3ssl.gzSMIME_read_CMS.3ssl.gzSMIME_read_PKCS7.3ssl.gzSMIME_write_CMS.3ssl.gzSMIME_write_PKCS7.3ssl.gzSSL_CIPHER_description.3ssl.gzSSL_CIPHER_find.3ssl.gzSSL_CIPHER_get_auth_nid.3ssl.gzSSL_CIPHER_get_bits.3ssl.gzSSL_CIPHER_get_cipher_nid.3ssl.gzSSL_CIPHER_get_digest_nid.3ssl.gzSSL_CIPHER_get_handshake_digest.3ssl.gzSSL_CIPHER_get_id.3ssl.gzSSL_CIPHER_get_kx_nid.3ssl.gzSSL_CIPHER_get_name.3ssl.gzSSL_CIPHER_get_protocol_id.3ssl.gzSSL_CIPHER_get_version.3ssl.gzSSL_CIPHER_is_aead.3ssl.gzSSL_CIPHER_standard_name.3ssl.gzSSL_COMP_add_compression_method.3ssl.gzSSL_COMP_free_compression_methods.3ssl.gzSSL_COMP_get0_name.3ssl.gzSSL_COMP_get_compression_methods.3ssl.gzSSL_COMP_get_id.3ssl.gzSSL_CONF_CTX_clear_flags.3ssl.gzSSL_CONF_CTX_free.3ssl.gzSSL_CONF_CTX_new.3ssl.gzSSL_CONF_CTX_set1_prefix.3ssl.gzSSL_CONF_CTX_set_flags.3ssl.gzSSL_CONF_CTX_set_ssl.3ssl.gzSSL_CONF_CTX_set_ssl_ctx.3ssl.gzSSL_CONF_cmd.3ssl.gzSSL_CONF_cmd_argv.3ssl.gzSSL_CONF_cmd_value_type.3ssl.gzSSL_CTX_add0_chain_cert.3ssl.gzSSL_CTX_add1_chain_cert.3ssl.gzSSL_CTX_add1_to_CA_list.3ssl.gzSSL_CTX_add_client_CA.3ssl.gzSSL_CTX_add_client_custom_ext.3ssl.gzSSL_CTX_add_custom_ext.3ssl.gzSSL_CTX_add_extra_chain_cert.3ssl.gzSSL_CTX_add_server_custom_ext.3ssl.gzSSL_CTX_add_session.3ssl.gzSSL_CTX_build_cert_chain.3ssl.gzSSL_CTX_callback_ctrl.3ssl.gzSSL_CTX_check_private_key.3ssl.gzSSL_CTX_clear_chain_certs.3ssl.gzSSL_CTX_clear_extra_chain_certs.3ssl.gzSSL_CTX_clear_mode.3ssl.gzSSL_CTX_clear_options.3ssl.gzSSL_CTX_config.3ssl.gzSSL_CTX_ct_is_enabled.3ssl.gzSSL_CTX_ctrl.3ssl.gzSSL_CTX_dane_clear_flags.3ssl.gzSSL_CTX_dane_enable.3ssl.gzSSL_CTX_dane_mtype_set.3ssl.gzSSL_CTX_dane_set_flags.3ssl.gzSSL_CTX_decrypt_session_ticket_fn.3ssl.gzSSL_CTX_disable_ct.3ssl.gzSSL_CTX_enable_ct.3ssl.gzSSL_CTX_flush_sessions.3ssl.gzSSL_CTX_free.3ssl.gzSSL_CTX_generate_session_ticket_fn.3ssl.gzSSL_CTX_get0_CA_list.3ssl.gzSSL_CTX_get0_chain_certs.3ssl.gzSSL_CTX_get0_param.3ssl.gzSSL_CTX_get0_security_ex_data.3ssl.gzSSL_CTX_get_cert_store.3ssl.gzSSL_CTX_get_ciphers.3ssl.gzSSL_CTX_get_client_CA_list.3ssl.gzSSL_CTX_get_client_cert_cb.3ssl.gzSSL_CTX_get_default_passwd_cb.3ssl.gzSSL_CTX_get_default_passwd_cb_userdata.3ssl.gzSSL_CTX_get_default_read_ahead.3ssl.gzSSL_CTX_get_ex_data.3ssl.gzSSL_CTX_get_info_callback.3ssl.gzSSL_CTX_get_keylog_callback.3ssl.gzSSL_CTX_get_max_cert_list.3ssl.gzSSL_CTX_get_max_early_data.3ssl.gzSSL_CTX_get_max_proto_version.3ssl.gzSSL_CTX_get_min_proto_vers�x���������������������X �%�
����������������!�$�����������������!�!�!�xt//usr/share/perl5/unicore/lib/GCB//usr/share/perl5/unicore/lib/Gc//usr/share/perl5/unicore/lib/GrBase//usr/share/perl5/unicore/lib/Hex//usr/share/perl5/unicore/lib/Hst//usr/share/perl5/unicore/lib/Hyphen//usr/share/perl5/unicore/lib/IDC//usr/share/perl5/unicore/lib/IDS//usr/share/perl5/unicore/lib/Ideo//usr/share/perl5/unicore/lib/In//usr/share/perl5/unicore/lib/InPC//usr/share/perl5/unicore/lib/InSC//usr/share/perl5/unicore/lib/Jg//usr/share/perl5/unicore/lib/Jt//usr/share/perl5/unicore/lib/Lb//usr/share/perl5/unicore/lib/Lower//usr/share/perl5/unicore/lib/Math//usr/share/perl5/unicore/lib/NFCQC//usr/share/perl5/unicore/lib/NFDQC//usr/share/perl5/unicore/lib/NFKCQC//usr/share/perl5/unicore/lib/NFKDQC//usr/share/perl5/unicore/lib/Nt//usr/share/perl5/unicore/lib/Nv//usr/share/perl5/unicore/lib/PCM//usr/share/perl5/unicore/lib/PatSyn//usr/share/perl5/unicore/lib/Perl//usr/share/perl5/unicore/lib/QMark//usr/share/perl5/unicore/lib/SB//usr/share/perl5/unicore/lib/SD//usr/share/perl5/unicore/lib/STerm//usr/share/perl5/unicore/lib/Sc//usr/share/perl5/unicore/lib/Scx//usr/share/perl5/unicore/lib/Term//usr/share/perl5/unicore/lib/UIdeo//usr/share/perl5/unicore/lib/Upper//usr/share/perl5/unicore/lib/WB//usr/share/perl5/unicore/lib/XIDC//usr/share/perl5/unicore/lib/XIDS/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x����������������������X!�%�
p	��������v!�$f����������������v!u!w!�<ppisar@redhat.com> - 4:5.24.0-375Petr Pisar <ppisar@redhat.com> - 4:5.24.0-374Petr Pisar <ppisar@redhat.com> - 4:5.24.0-373Petr Pisar <ppisar@redhat.com> - 4:5.24.0-372Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-371Petr Pisar <ppisar@redhat.com> - 4:5.24.0-370Petr Pisar <ppisar@redhat.com> - 4:5.24.0-369Petr Pisar <ppisar@redhat.com> - 4:5.24.0-368Petr Pisar <ppisar@redhat.com> - 4:5.24.0-367Petr Pisar <ppisar@redhat.com> - 4:5.24.0-366Petr Pisar <ppisar@redhat.com> - 4:5.24.0-365Petr Pisar <ppisar@redhat.com> - 4:5.24.0-364Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-363Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-362Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.6-361Petr Pisar <ppisar@redhat.com> - 4:5.22.1-360Petr Pisar <ppisar@redhat.com> - 4:5.22.1-359Petr Pisar <ppisar@redhat.com> - 4:5.22.1-358Petr Pisar <ppisar@redhat.com> - 4:5.22.1-357Fedora Release Engineering <releng@fedoraproject.org> - 4:5.22.1-356Petr Pisar <ppisar@redhat.com> - 4:5.22.1-355Jitka Plesnikova <jplesnik@redhat.com> - 5.22.1-354Petr Pisar <ppisar@redhat.com> - 4:5.22.0-353Petr Pisar <ppisar@redhat.com> - 4:5.22.0-352Petr Pisar <ppisar@redhat.com> - 4:5.22.0-351Petr Pisar <ppisar@redhat.com> - 4:5.22.0-350Petr Pisar <ppisar@redhat.com> - 4:5.22.0-349Petr Pisar <ppisar@redhat.com> - 4:5.22.0-348Petr Pisar <ppisar@redhat.com> - 4:5.22.0-347Petr Pisar <ppisar@redhat.com> - 4:5.22.0-346Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.22.0-345Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-244Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-242Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-328Petr Šabata <contyk@redhat.com> - 4:5.20.2-327Petr Šabata <contyk@redhat.com> - 4:5.20.2-326Petr Pisar <ppisar@redhat.com> - 4:5.20.2-325Lubomir Rintel <lkundrak@v3.sk> - 4:5.20.2-324Petr Pisar <ppisar@redhat.com> - 4:5.20.2-323Till Maas <opensource@till.name> - 4:5.20.2-322Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-321Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-320Petr Pisar <ppisar@redhat.com> - 4:5.20.1-319Petr Pisar <ppisar@redhat.com> - 4:5.20.1-318Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-317Petr Pisar <ppisar@redhat.com> - 4:5.20.1-316Petr Pisar <ppisar@redhat.com> - 4:5.20.1-315Petr Pisar <ppisar@redhat.com> - 4:5.20.1-314Petr Pisar <ppisar@redhat.com> - 4:5.20.1-313Petr Pisar <ppisar@redhat.com> - 4:5.20.1-312Petr Pisar <ppisar@redhat.com> - 4:5.20.1-311Petr Pisar <ppisar@redhat.com> - 4:5.20.1-310Petr Šabata <contyk@redhat.com> - 4:5.20.1-309Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-308Petr Pisar <ppisar@redhat.com> - 4:5.20.0-307Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-306Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-305Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-304Petr Pisar <ppisar@redhat.com> - 4:5.18.2-303Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-302Petr Pisar <ppisar@redhat.com> - 4:5.18.2-301Petr Pisar <ppisar@redhat.com> - 4:5.18.2-300Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-299Petr Pisar <ppisar@redhat.com> - 4:5.18.2-298Petr Pisar <ppisar@redhat.com> - 4:5.18.2-297Petr Pisar <ppisar@redhat.com> - 4:5.18.2-296Petr Pisar <ppisar@redhat.com> - 4:5.18.2-295Petr Pisar <ppisar@redhat.com> - 4:5.18.2-294Petr Pisar <ppisar@redhat.com> - 4:5.18.2-293Petr Pisar <ppisar@redhat.com> - 4:5.18.2-292Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-291Petr Pisar <ppisar@redhat.com> - 4:5.18.1-290Petr Pisar <ppisar@redhat.com> - 4:5.18.1-289Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-288Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-287Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.0-286Petr Pisar <ppisar@redhat.com> - 4:5.18.0-285Petr Pisar <ppisar@redhat.com> - 4:5.18.0-284Petr Pisar <ppisar@redhat.com> - 4:5.18.0-283Petr Pisar <ppisar@redhat.com> - 4:5.18.0-282�x�����p<�y�������X+M%�
��������8S�d�$�����������������d�d�d�l number to
  Makefile.certificate (#151188)
- make ca-bundle.crt a config file (#118903)- libcrypto shouldn't depend on libkrb5 (#135961)- rebuild- new upstream source, updated patches
- added patch so we are hopefully ABI compatible with upcoming
  0.9.7f- Support UTF-8 charset in the Makefile.certificate (#134944)
- Added cmp to BuildPrereq- generate new ca-bundle.crt from Mozilla certdata.txt (revision 1.32)- Fixed and updated libica-1.3.4-urandom.patch patch (#122967)- rebuild- rebuild- rebuild- remove der_chop, as upstream cvs has done (CAN-2004-0975, #140040)- Include latest libica version with important bugfixes- rebuilt- Updated ICA engine IBM patch to latest upstream version.- build for linux-alpha-gcc instead of alpha-gcc on alpha (Jeff Garzik)- handle %{_arch}=i486/i586/i686/athlon cases in the intermediate
  header (#124303)- add security fixes for CAN-2004-0079, CAN-2004-0112- Fixed libica filespec.- ppc/ppc64 define __powerpc__/__powerpc64__, not __ppc__/__ppc64__, fix
  the intermediate header- add an intermediate <openssl/opensslconf.h> which points to the right
  arch-specific opensslconf.h on multilib arches- rebuilt- Updated libica to latest upstream version 1.3.5.- Update ICA crypto engine patch from IBM to latest version.- rebuilt- rebuilt- Fixed libica build.- add "-ldl" to link flags added for Linux-on-ARM (#99313)- updated ca-bundle.crt: removed expired GeoTrust roots, added
  freessl.com root, removed trustcenter.de Class 0 root- Fix link line for libssl (bug #111154).- add dependency on zlib-devel for the -devel package, which depends on zlib
  symbols because we enable zlib for libssl (#102962)- Use /dev/urandom instead of PRNG for libica.
- Apply libica-1.3.5 fix for /dev/urandom in icalinux.c
- Use latest ICA engine patch from IBM.- rebuild- rebuild (22 wasn't actually built, fun eh?)- re-disable optimizations on ppc64- add a_mbstr.c fix for 64-bit platforms from CVS- add -Wa,--noexecstack to RPM_OPT_FLAGS so that assembled modules get tagged
  as not needing executable stacks- rebuild- re-enable optimizations on ppc64- remove exclusivearch- only parse a client cert if one was requested
- temporarily exclusivearch for %{ix86}- add security fixes for protocol parsing bugs (CAN-2003-0543, CAN-2003-0544)
  and heap corruption (CAN-2003-0545)
- update RHNS-CA-CERT files
- ease back on the number of threads used in the threading test- rebuild to fix gzipped file md5sums (#91211)- Updated libica to version 1.3.4.- rebuild- free the kssl_ctx structure when we free an SSL structure (#99066)- rebuild- lower thread test count on s390x- rebuild- disable assembly on arches where it seems to conflict with threading- Updated libica to latest upstream version 1.3.0- rebuild- rebuild- ubsec: don't stomp on output data which might also be input data- temporarily disable optimizations on ppc64- backport fix for engine-used-for-everything from 0.9.7b
- backport fix for prng not being seeded causing problems, also from 0.9.7b
- add a check at build-time to ensure that RSA is thread-safe
- keep perlpath from stomping on the libica configure scripts- thread-safety fix for RSA blinding- rebuilt- Added libica-1.2 to openssl (featurerequest).- fix building with incorrect flags on ppc64- add patch to harden against Klima-Pokorny-Rosa extension of Bleichenbacher's
  attack (CAN-2003-0131)- add patch to enable RSA blinding by default, closing a timing attack
  (CAN-2003-0147)- disable use of BN assembly module on x86_64, but continue to allow inline
  assembly (#83403)- disable EC algorithms- update to 0.9.7a- add fix to guard against attempts to allocate negative amounts of memory
- add patch for CAN-2003-0078, fixing a timing attack- Add openssl-ppc64.patch- EVP_DecryptInit should call EVP_CipherInit() instead of EVP_CipherInit_ex(),
  to get the right behavior when passed uninitialized context structures
  (#83766)
- build with -mcpu=ev5 on alpha family (#83828)- rebuilt- Added IBM hw crypto support patch.- add missing bui�x�������������pi�������X##%�
��������0:�d�$#�����������������d�d�d�des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_des.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_md5.3ssl.gzEVP_DigestInit.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc4.3ssl.gzEVP_rc4.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_sha224.3ssl.gzEVP_sha224.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha224.3ssl.gzEVP_sha224.3ssl.gzEVP_sha224.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cbc.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzSSL_CTX_set_generate_session_id.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzHMAC.3ssl.gzX509_dup.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMD5.3ssl.gzMDC2_Init.3ssl.gzMDC2_Init.3ssl.gzMDC2_Init.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2obj.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOCSP_cert_to_id.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_sendreq_new.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOCSP_response_status.3ssl.gzX509_dup.3ssl.gzOCSP_response_status.3ssl.gzOCSP_response_status.3ssl.gzOCSP_response_status.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOCSP_request_add1_nonce.3ssl.gzOCSP_response_status.3ssl.gzOCSP_response_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_request_add1_nonce.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_request_add1_nonce.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_response_status.3ssl.gzOCSP_resp�x��������������X�������X$�$�
�������� n������R�$B����������������RQS�d68cc4bc7900e6db044becb5419efa109b77ffadf0e33e84094c213cca2fc2e3ea06efc4a655ef4bb27ae4126943c574b98709767ba7d43682f8dd8eee55591d451aa0b4380e1cd01eb887a91528dbbb9187ed14d2995b77066141f0a0b67dec82d554a20909466eca6a3e8f237eb709b7f5b4c62a33736eafd741e7929ab8c13d1484f19a0874fb5a220dac8c6e4e7d3b2dc64586bb1f0dbb7af9f2891badb28f90e7ab9b82647a4b982a284b541968f669f2a9f1dd13080d71c8d880e628eee89e8f493c979441692ef364e01ca8c8a761d381e4d3265f8264768dde09b2962b2b19f1dd23b5283430b64b762d24515dee93cc8cfaecdd8f38c8fd02a9a6fe9685dde62da40bafd69412d0da67cfa86af3443e60189319a7ac414b0777557a29e5c6ddd32ec3a4db494eea31c193bdf80add723232d82bb405518558eece4c5a0889502a5df776b6db7e1e2c9f0c0cb9823895552021091a5554e9b6275cdabbf1820ccd18eff38d8b0094284ef7fb68c38f66fe337b3898cacda9485085c522d9306a043146cc52c780bbcf2c65b8d366f095a5cd7dd59ef1558c7d5bf8fe58581eb6b173f823b21f1e83598328de2d76950603023989370b39ed06207f18a9581de1d9d60482024e2c86135df22459559a410f775a5a4e4d051193cfc5dbcc2ba373d5cfe350604f3c4b79372ef4a7e494f02d1478a7f29aa6e2ac647acb10a2b1036bf2e2cb98e9627abb43fb1bf6ac561ec2eddd6f947b6246d18959c173aac7112e1e9b2d523ffe852f88011dd2e4836c60d66d90486e2f0b6eee9a962adc762cd19f7311b42d344cf47e49ef1261f90e4ff73ffe3f15cc6ec0bfeed0a2c87b67eb1c9890ec5e7a23d18eab733d16c0df8e7b2684e430a5b9f71ff766866ccd63c1358b568efc6fbdfcbaa4bed35b3ae304ea2ecf934319c37348fddefdf0f028614ce04cc1840574242bf47219cb0a8c8feb2b95abe8caac7840120e9575816d9e02dc8d08fe883293211f6f88389dfd874f9052c2e8991509621e742d39b65beb9489deef2b2b1f7a443f05acf11db46c80e2696bcb4fb7642418d3aec96f7c2931cdcfdaf245786ee3b6cded99e22fe7f99f914f660697f78e57850e4e70c027e73a0aa5074a28bd3a5d25c2564b3719c36b670fa1b23811490e2b47b6576a4b58f38ded511ed4f3757e7b858e3700e0ae50ed789c556f2abdabe09362169d385f9facf1bd05c13cf57b3f8e0078a5d4bcab470cac90909b105e525171e7bc0ad8fc60b0d98503f4d46dfad8060cf9e3f29aca0683c4b66ee099eb32cbbe0763965ba0de7b5e1d67efbf23db7f93fdd8a92b4a98b89f6c3af9baf94aab2cc24f58e0e2c4ffc6e2ea822cdc093d940ff701db74a1133159cf159c9a182a46eb77ecdab618c52e373f432b3924d8e2707454731bfb20b7be1e41f5b0704536a549ebf7ee755d64bd9ef882b04ae84173dc8d2fc0706082e013fdec16a7b7fcc3aadbc0c3e22f87d8a818d9aa95f364acf0afdd61db90044908eef15ef623eb9e6f4598cdfe581f20b1b812650d961f567406ba6772a881f22d10cad9096093673513c8426e81594c44977e1a57e7c4724f2a5396940e79dbdeea768970b2960d067e8a2fb78e9379a1b1b0fa25090659520a52821ce9e70f58e72f9050e3037aba96986aa39403a7b36bf5fac3de1b2c59266652a2153e29fc80a3716fb3efbddff33a33590eaa20773d0b694e3daf554d303360015af85fb1e174b2baded89ee18e4b492e86b4923e9a4d435be03af7132a935615aed4a5f444fbdf1da8364160390bed9eaa4d109515a8269432a01a12e33c9fd36591d62f19ff4ff4ce1bf4c839dbe6e9445dcd19d7ff16945dadcfe650711cc8c467b10fc463a333d3bba815810ae9cc1dd8b5c8bc0181b9721df826d06600296ca5b2c343d602e6d8d7680941c9ca29baa79137cf0d9cdaab73b85713c0e99482efd5139818e6f2a3383db05a6b6f9ae2356ab7f6578e95e3c8eb7efaef7d643aaf1e461124891e8799c0415764d0c3b5f1663ee73f1c0d7defac1c5daf627bd51f6e97d44f9f905c98b1c3023aaffc12fcd36802636b2872cda1ac1460f2f78f58e0195f4dc3af4a5e92925aa23f3f6ec5c73a7565329a7eb8b3b67d09288e327f405fa72009d7e85b81a70d20c5577ffb8b418b6b0de043e7fc1b90a36595a7585f33e27d5028c66fecb8db2f01832240b70527aa93f9d93c486a33449ad64a9c1e51ad0b82fc6afbb07febd5650842fea214231f399d7f3bf4daa873021ae3d172211a649626f466efd53423970ba15d29d6f5ce4fc5d78fcc9e1cf77f54f0bd20cc47638b163a4b4adab20f4901ff4ef296cd2a9e3ebbb6577f2a14123adff1db7144fa503b2e939d9383055e7b893a7730e146dd93c3280324b9350fe71eac2b6927a0e0ea228c4d5d809d96320c0c2db233af2c6e522ae941519a1b96f840f476647daa9d041a7d5db2dde0d80d3c99e973b1eccff8b259dc60762eff4f9768cda50c4e719c869ad6f2d9396f48c3bd4cb6c5bb90e847a3bf484caf21d33bef1f03dd3b6244295774565dcc516bef24718e4e07d8fad6662e3fd2fed08fe53b1bdf0b344633375273ce54bdb75c65a4383f2bf29aa9868ddfeb868f23ea5c5833a4fc9a642b78a83dd186259826304be649e7902086b8f9ff546700af22030dffeefaa6b13e9ebb7c24538adb0941dcb98a9d68a6426640f874cf09268bc51c0dd77267ef8e3d9948ff9c8c376a1b9ce911ca135b7baf9a5d540f591b0a59ce27b14cb151f6b110a3dbba6c006052c0501a69fc9140e093�x������@H�������X%�%�
���a������D��$T����������������D�E�C��e24f2abf4b21f656b33a206304959e84bd43716fe1e1a4e04bce0381d803cf91740ef8af01041085ad785c537b707ae8e57036a321e2c5ef14ea4587339900f839bed5724ce8be94c6acc2d486124a1cff28c9cc506ab7db20b422fb99c50e6bfae7f837fffc1350fec42d274c49b68fc8e5d18325f9799d2a8ae37f6b2842ef78a4f4dd88340d595c16306f8ec407ca9df1aca8b9659e18b4709a0838bd54f4b2fbbd591b4fb0ceddf976f500e872b10879f69b65f18b7da5fe8e03b0b7dd4ea4072cd617df8a6becbf4a8f2d005f99d4977c4f8b89e3cccaf0f07303654e3f2dcab276e4aa421f3c7f8916be04df9717564fe44875d4e404a86ba59a0a5fe1db7a344e6a034668f4ae942c25c349f4d99ce8d304e7f6b07c824f546d0bba590c50f2cb0c51982665afe9d10819b4fe926489d6fb346c73df771db272b58a6b775f6ef158a4904a83dc43f5a653a12a8e58326da20ccd456e2e9b03909e25160eb615d0fb2b46cc3f371830e41221e1debd4884c950f666c3cf792fd5cd11b91812daf5abcfdba283ee9fb8130e3d575167a76087bb4d0233a0b0b01252a5a5743a1ca3e179f0470822917c261b6dd22a4b481d2126cbfb857ed2615c071ef86b995ba3495ccb518b71cd96f74d3e1c6b386a017a3f790459594bca96e284c031a8c70d547844dbd7a55822b8fa31c557a3ddd13dddd28fb23669fc0ea6cd58e9ebef59dc48f4a95d46a49dc15d831180122e3dbcc51e70635209e1639798df492b4339e857c172412c0fad662ed5af1382e470391796379aa8e8809fd7830c7a50cca142a93f487c324163e5702189b978b8a177a534dbd5ff677399f9f0ba47c1203f0e159672462f4f43530e9e5aa6416114738fcb540f8036e67db219741326a41e3606b0f5138bd0870424bad99417b941d59d665e670ac26e47d8b10ec6f9551232252bae4290872773decf76601f84a3ec424fb10edbe20529a31c8c70b8a529dca9b5e5c590e51c30f8bef663cc27f0293dd7050a9b8d6f98a8a9c11b0c6c3efda27f6d13b5c5adb70c14dc306de507145d800a2226aaa8991895b7b60db806020d9ab873891a4b458cac37c50904cced439b499569e005c0a3a007913cddc5d3557f89337490d62015ebbbd5478b80d7f005c846f09280030c00842e32e0f8b30d7ecb9fa461d132d5eb5754db5e32cf607bd1ebb3c2e7d3df6dd95fcb92c0270eae29e7a5cf0ca50d34ea2d7624b871e5ebc5562db90c9055cd0bfd90cbcdbf5962093c123cf10ded6237cae2f07e0ca1f44affb4d144a5c8319dc36041a40107253a2b9bbb38e1ee86297b9ce6a4c4e9d69a6fa0150375e54216ec2cf076c37d38620c3e9346cf374e95d57880d7364a56c812390940dd7574ead12fb64125aedbc546f37f83f40ede3081fd60b4eb080eaacd52fd12810386c108b0f2120bf85364834d5c85350632cf41f686ef642bb7445dd36db72709e4cda7ab282275deaecf5a6934b57bd3c638536b483b3f182df7176a808a43694f2b7ced152bc7b327d31b7391649d762505cb14b22f03ed9259ff9b340c8413e2b998c03ba18f80244a13501d2bd1e64a538d63869581f70ac7888251d4e185303b32f8954adf4622ce26198f1c805d85f5c2b3984b521b2296908b812c6803cf91740ef8af01041085ad785c537b707ae8e57036a321e2c5ef14ea458739c72e4a4a7db49cfc16c6890751366edeb76c570f500774bd34ddc1557584f9b0cabadfbc3890da3fca4bba1dc560a22be75ffb18c82a32a3dc6c7b2a8c649e3512cc76e2a808c80e45d1b21bbe597dac92b1daf3fcd5af9b3d5f8a03c4b539d0a2f4f1a41bbe379fe7faf558bcff541f070801cd0355e3237743f88c94d135bb3f5a6a4d57b15e9f194a2393bf75ad6533fde799d053f51ccf90f10ff6a5ec6aa39ae8b78898857a1228b41586d32cbe4f0b776d046b8c36502b0789650a3438c44ef340244f55294ffd61c2f93205d8aef21657e618d33c048b36999581590e4dd710176f012b13e8dad9f61c33bc708b72d45853fa2d823b09e314f5fdba2041db2285aed20c33415d9d40eeb35397a4a5cefc53082f53c23c3936a7e51d64321ffdc99802a742d14d351a224b93ab2628a53f1aa4b30c80aa00481672af9ab8d1e37f5d8220ee3aa79ee294a65d7ad125a800445f733b4c102a840ee181d76921e090c9f0e3faccf2d59813cdbd7a10026df79a97257440198e571f265e19d1dbe18667b5d5ae0b9994f6dd2c7a8d3e08ce34d7e7f81b2dcfc166080b99ff6e93b8041e616206a702da252d70523c622242d3c4a2c684839902102b4fb392e1b838cd24c59d38e9879a5aa191b3c5e3e6e3806c0e2f80c8e96cf9a4ecadd958dc8c2a6292a00a81c26cb1c5ee5d2da1b545da673ee8010507e4b3839bdf18b38656872a508e8a1e8eb29105e95acda79f02d80e547a07a755cadc6384a2b722bae3e739da8977d7e249f84587791b8b854a1b641ae5bad6ca38b6ad24300009013c1377fa2f37de0a2c34add4df59ea8599b3c86bb9c0b2876e86ab12ed73f6bd39941db8c2dfd8795a5224e00aa4e9cc26eeffc01876bcbf08f4f8fe7900dbc14a9ef1bb7edef3e89965136d0125ddfb05134ab838b6c7b228fcc002b82d9ac861b91d4d738a77f08a08953844c63ce4d76c8da5434f04c15d3b0d0f46ab86a5d958c9d40beb059b09db1d2c8b9317ad6007ffd6c7f30e339069a4e00666987cbd016faa99b252ceab50c34e0d4268daa2d0fe583824e92b439592e6ce0eb7a3e144af242f161cdae4bb571457df8b7cbd4b042777�x��������������7�������X&�$�
x������8�XX�$H����������������XXWXYX�_ setting from Dan Walsh.
        * Dropped -b option from load_policy in preparation for always preserving booleans across reloads in the kernel.- Fixes for polgengui- Updated version of policycoreutils
        * Merged chcat, fixfiles, genhomedircon, restorecond, and restorecon patches from Dan Walsh.- Fix genhomedircon to handle non user_u for the default user- More cleanups for gui- Fix size and use_tmp problem on gui- Fix restorecon crash- Change polgengui to a druid- Fully path script.py- Add -l flag to restorecon to not traverse file systems- Fixes for policygengui- Add polgengui- Updated version of sepolgen
        * Merged seobject setransRecords patch to return the first alias from Xavier Toth.- Updated version of sepolgen
        * Merged updates to sepolgen-ifgen from Karl MacMillan.
        * Merged updates to sepolgen parser and tools from Karl MacMillan.
          This includes improved debugging support, handling of interface
          calls with list parameters, support for role transition rules,
          updated range transition rule support, and looser matching.- Don't generate invalid context with genhomedircon- Add filter to booleans page- Fix polgen.py to not generate udp rules on tcp input- system-config-selinux should be able to run on a disabled system,
- at least enough to get it enabled.- Many fixes to polgengui- Updated version of sepolgen
        * Merged patch to discard self from types when generating requires from Karl MacMillan.- Change location of audit2allow and sepol-ifgen to sbin
- Updated version of sepolgen
        * Merged patch to move the sepolgen runtime data from /usr/share to /var/lib to facilitate a read-only /usr from Karl MacMillan.- Add polgen gui
- Many fixes to system-config-selinux- service restorecond status needs to set exit value correctly- Fix gui- Update to upstream
        * Merged restorecond init script LSB compliance patch from Steve Grubb.
  -sepolgen
        * Merged better matching for refpolicy style from Karl MacMillan
        * Merged support for extracting interface paramaters from interface calls from Karl MacMillan
        * Merged support for parsing USER_AVC audit messages from Karl MacMillan.- Update to upstream
  -sepolgen
        * Merged support for enabling parser debugging from Karl MacMillan.
- Add sgrupp cleanup of restorcon init script- Add Bill Nottinham patch to run restorcond condrestart in postun- Update to upstream
  - policycoreutils
        * Merged newrole O_NONBLOCK fix from Linda Knippers.
        * Merged sepolgen and audit2allow patches to leave generated files
          in the current directory from Karl MacMillan.
        * Merged restorecond memory leak fix from Steve Grubb.
  -sepolgen
        * Merged patch to leave generated files (e.g. local.te) in current directory from Karl MacMillan.
        * Merged patch to make run-tests.py use unittest.main from Karl MacMillan.
        * Merged patch to update PLY from Karl MacMillan.
        * Merged patch to update the sepolgen parser to handle the latest reference policy from Karl MacMillan.- Do not fail on sepolgen-ifgen- Update to upstream
        * Merged translations update from Dan Walsh.
        * Merged chcat fixes from Dan Walsh.
        * Merged man page fixes from Dan Walsh.
        * Merged seobject prefix validity checking from Dan Walsh.
        * Merged Makefile and refparser.py patch from Dan Walsh.
          Fixes PYTHONLIBDIR definition and error handling on interface files.- Updated newrole NONBlOCK patch- Remove Requires: %{name}-plugins- Update to upstream
        * Merged seobject exception handler fix from Caleb Case.
        * Merged setfiles memory leak patch from Todd Miller.- Cleanup man pages syntax
- Add sepolgen- Update to upstream
        * Merged small fix to correct include of errcodes.h in semodule_deps from Dan Walsh.- Update to upstream
        * Merged new audit2allow from Karl MacMillan.
          This audit2allow depends on the new sepolgen python module.
          Note that you mu�x�������������@'�������X'�%�
��������H`��������$/��������������������4aff62cbb36b4a452ce67eb261c90e35325bf9b6b9562bd0882128ea4650b65c9389b35edf9ff534dc3a48e8bed73e650aeccc3ef0a7c2e1bbab934b0882b61f19569e96e4615d069dc50b6becdd19ab2cc69000c1206f1b8460952857f05d154158da8b89273ac2900a5c80ec09a36cf3e93b6374521c81fa4f302350d3c04b95573f5570717284107689188e6427d138cfba0b64e4090d53031ba5a470589ca0229336c6334e280e5eeadfc84af2491bf39f41b9f7c919ba47ed9ab03f87e943bc3b12417f98e5580d8077bc791731c3e8eefc36254118d8771bea069ec08c33d3e44496fd861a8316e73f6f1eec539275ef2140da652e19102f259ee84ae3432f2c94a862cc22da8957e4b2785cab4eb35c168aa76abbf955e5404008580e264115dc2ec5466373223e0dfa61eff60219165b7a7c6eda22e3b38946fd805408c13229ff88b4b10fc3bfec2f2aeffb4257e2466974f6af0eb1cc8d76345dbdf470748b3d12bb2f6d6b4bdbc8c29d842963a96d305bf7aa2c616f751c216add1be731a1e0f0066b223797a55d3069c4c188fa9dbaeb56026aee5cfd6478487a203455ec7fa32655665177756c5540dd248e77cab6e64ab4f5eca49e60ceb141ab26b240fafc751813806a2f52017c0a3669a0653bded7ae9c0ab80d57155ac9072c2cd8f029db11e4e9eda42c5287273783ae837b0c4a305edbbe89d184cde13eea217c1ddf505642e093000f9dae116c2ae672acfb0a1bec9b1310ef9a16d32b5239e4bb69657a12791af5b70ce568524684789cba926d99c3b0762851196739a345c004419f233f1f6d63f33471241ce10a7ddd389d9b1362eea4fd465368d47f0b39bef7cf06d42a3ae7a4c5eb27de2cd89c6b86dc7d42f1533e8d360da44c4d0ccede67f3abe68675dc2270cc8f0091358ddcc3c035e9f22bc32d26881f2af192b2b51106af9c5856486de0f08a9138e23a5b3486a80cd70071e491585ec3db71a6ca10bbfd747c35d1c0c08c64a0e6f2829acbf7d0c231c69a567370fae017723e3bdf7c084f55fa99818e46d81975f080477d1108f16ab905af6b1aedadcfaf08fa82ef6ce3a81ab5fd42576c3e027fd804e5be5e556edd0cad620fa93d36ca88e49b6e928a39a0ad116151ee9f01c4c167079be5154a6306ef4ecaf33194dcd258f4eac60b57387c0fb3feb38a3f52a644040c40487676f44f3b224e544e358de4bd55ba9fe1f43844624cb67648655eb2b5fc02169682b4c75b6893c4c75ecedf9f321855f76f3d70a878af120b6cd2784cd6e7c06744a2c3e658d822875602ca5e340ccdf1e257f5ac6b994618d955397c9f65fcde13112b7687a36b7348abb735ae01e433061d202bf0fc89e388fd8ec6bbeffec95b4bed7e84c72d5dda294dd0678b0a8bae9fd9b528f0c22b9dac09073d3c6eaa9a2b969a00ac89dcb70f5e80c64867ef1bc0afb0cdc2bee61da7bea7a3926d9c03d2954395af0c29289578d9a0dbd1ebe64b9a5e41a38b26bc33393500a19d0da2258663b97a35752be03dc27c68bd468cfff506704deb1ffbc890823aa6fb665f3e8ef87b67d6735a5e0c89d5364ef87fe739a0df4a2a4e704e77e91d48f8de140623fe8d6a6cc0637233b6c1ae3c1b1ee1a3b5dcd75b89d489ada277ba91d580e9196db3abeba747052c989eebc2861b51016074ab500d78083cb9592b401d16ddde10b1c7ee1b4f7aa0f6a53c001c9027dcf75287aeb4a969eeb6f3d0e50a1447e7642993c3b5ad9f5d115b24863f748c648f3f8209dab67c5f2bca4b1da2e320918634fd56620ac1d57945567902129d285c228c53237348e14e2cd1a8a99bfe13535dfe90ee43721a636adddccc2cd017afdec2bf141c66667991ce9ab6bbd2b7564ee6c2b58c8a7199506111e9996a469ac85475d9a7719345ba6631daf034f24e5ab350624087fcd28a25a03b5b754e99e3e759f0b3fff99671711fb9a36e4b1402209d1bfd3457d212b708770a21b73ee20dad6dc3b95776045f512a583a82184137b010dd8ecaf0ac194813147749ff0cd1d31a160dab7f469318c67e0dbdd84b7c0492d3110f4602978a35280a4b3bf6badb791f0937ce1b36b8fb164b343caeaf8bee248ecbae5fabda69c2a39f1311e1cfe112c62af1daf0b559b9520ccd03a197c5dc632d76f44964ee13301532e273cab5e878ec6260b9c39a682f7b00ebb44cac5a6926c96969551faf464b3f45f6c9252153fb37b2b028a1c142d44003b4103b1b1500ecaf63a4eb30fa4bfd0bfe7f450cecea00db42a58be347babcb52cfd14c27a05b634dfa701e2994048e9e2f54207ba37554d1d18656c6694c0abe68d2a91f32abb87118c8390fb1f493c8f610a08974b9a91af0015a85b7cd4e1fc6298807ba37a5c7d17e351216f0990351cf2e3207dba678570d1de900e60f2550e95e2fb36fc8cbb773dc77ef0ad1e96b750dafd6a9079a0fc65d9be1d8df9fce856094a6e3e6c557f137393c85bcd8e3d5fee6dbbc9d21258bfd099fa4d3eb15d87706bd7933a52c370ab0401c7d205b37f0a6a8bda2fd6ba20a0b20f57c17586719b373a5fadec41646090be8c6f3296e8384b4133e0d25c64bf0557862c1b691201ba7f14c168994ac93d21dd39edcd3e8516156927b6844a37dd8415ecb3a3fecbae6f2933ef7d06ddcb765d9881b672584afa6d10871be7e12aba0c14dc5fe78c9b848cceda9aba5ad4f9acdc3f886fdac5927ff7f065396d622e380f989a7926949e5372dfc2a00ffdfb8d00d4796f466f75860d98ad528403ed6b94fc15c38be06c07a269effb06686fc288de55c684�x���������������������X(�$�
��������p,������T�$D����������������TSU�85c1ec6a07435db59acf0a3744db565a402f7c12b1a7e63d1e9b2e4500b7911fd334a06dbb134acccbcf101cb90b7d4e7975f5aaf64556f7437905590f56b90dce1bf8a017a2ece56452184a1a20051e66376a83851a5a591842e2db8c6b13274926d8d19bbf4b0111eee21c5af3f7112ab52ab263f91609092fe0fa2e881d59a873e05d49a7b1c2e8e9bef43af3c6d7eb4712e93b19cd4e2bf3e573f58c0ce0c6b9a4216a4f2edc0560e72c3781ef3d33379fd761172d824c3178e31fa99ee9769aed661718b479dd9e4f4152d03157b758f03d1db5c2e9c071a31441e2751e53cba6009e48c3f4d7941a26bbe5eb7dab5d3d11555bf9e70967969a000a838871207c6fd8a20e28d1853c73b21f85d78698972163ccb767bca3afb068e0427f49d1a956053a0dcf63b777a6a41d7fc0fd73f27b8f48312119002e879ce2cbf551e3160704988ca7abed7a2dfc817e088a86737379df19d1983e5c6c4fa3c01bb3b20d3c32a8bea313e8c051b0e4142e3bc9ad3f13596374f8971dba37c053aa52c5ced3f5b7d8f06e13a8f008ba5937e4fb7129a316cd3280ca5fbcdebcd8b56d295c8bfe021811cba99559707ca7d94ddabfb9b1c3ca7dc336fc9d036c2f473d25b5df0deca8c2d9dac12664488f6a615b8cfc499e28d6619dbf29b7bf1c81c7f24db57094dde0b760ee0272aeba5ded8e21738cefbf22e0e04fcb7879820f521a945edbb73e150d39e69a937d8e0e5def4e2bdb31c876a76d782464bc6f8dd5b3c336028dd810121d52eac5f1ecdf107c2cd3c94eae7bf8f985394ecbb2e2efc9e3bf2f7be6c74b12b8139e73b36d4eecd6e1739bd54c46619af14bcfbd87f2022dcae2d330b7c62b37eedd717736b49462b332e105b91f0eb84b84849dfa8887f16613a7c0ba3321b8fb9f51d75a5f6b14c461c04b3190ba0986122e430d92ab8528193601ea0f6f88ff599d0ee508ba4e1a283a55e1964c0976c438ac12754704b2e9a5de193219f438eaedff2ce5c0d1def864a22a939b7179048b954b87d843aff772530981842e5f385693cdd6e41269c9e855ca9179950bc28629c52f5a254e066d36a6bb9cda3f90d9723695b857457273c1902a1b901d7c6f8e1ed983216e7c4fcc34fa4fb5320b2758549df078d4d4c000c6d5aa8095af4b8c0cb286707b0cefcd829e5cf6974f9f4e435b10ec8fb185cf400b994a4c73502f63d6c8ff688faf076f7ba4bfb6bfbf092226508bc3ba606434b971fd8df618a75647520b4b2f7df296d326df5755802d65569da189944255bd35f8035d758f9dce85f83471a6e505931dff1e4df63ae9ca3eb04ccda83036d68a22147435a8f047da90b46e37d41392f2dec304c9785a63b921b878c4672527a2973596cffa24fc3507a14c70aed9159d68c083958069f25d1a31edad9d7d8acd2f3808c052c553b813230d0a289dd8607e3d24b67a2958f4dd86eb05d92ecc722640faf7084b4b4a4a0873fd87b529a429153caaa27842741370c31b688f4b0bd9a424b586f12655c127a05f0a317ef5b2b66bf65bf6efd0f1ad4a00fa114d80656cdd109b1bc979b0730de99d9bba4379b9680b6cb6e94d060cafc6bc3a48069ca94e58d1a13c02afc0733d8ecba71e77d77eea40e097db8e6d2900441326c50a2ea828f22614bbdd9af85d68b6cab3980cc605a0c73430f4ff6a5e67ed5fdec97d3700863fdd0c9b0973dc986720bcc07aae05312ab9b9606891ca351f19642a32b241178434aed89bbc7b627dd97101a60fefe73c7842492f193f549f2eb5319e272d897f0c9228a859c370b5cdcf985dacfce1a5693271d80159c9591e12de574f8f792e69623a1d26260cc6ffc1a4d66d410992ea84ebe79cf0bfaa1dc2aa0ef05ec8956b3309fc5554a7259df8c555a1713d1b7645001c5e2cbd673b317654a24a7e2857be72f503b88e9397e877f6ba637b9ebc9abdfd289b595969463ddc0dc9ad4faeccc99560e7d8beefc40876beb2281dbb988751ef551f44c8e066829d1717f906b248855c37955b078422df48fe7f03dcd56cd3b17f20172a283e4e8db6124e22ebae4f247e05b4b9fda2b07face25064b7fb1eeda455aea0ff69d721f817383dc3f2d448c47f0870b104c9df6bf43f1a2d606942ca3ba600add07b52de8a4d3a0dcf8ec755dea89ca27e15a1791a468657a85aafe481bc89436ea71c3c08074f36678c16a42311863c84671c624c2be6427ce9a93d4638a334bc156c1f253f3a601be2cf1481d8df2ea960a7589f1f60de6a3fe6e67240ac9fb9d11ab756e8eefa77fc218cad0f1d4d7d3e71b9c8b08dcbc0bd0150952fcf6bb1c8e3882dac5a359e2065891ee2ec8ac95b763cf85b27d9c77b39677a8ae86f2c0a8cdee3f292086b52141f0a239cbc0e99f48b7ec54c8efc61915fa9106978cd619436606d08be5dadaf26c760b2261a623d32fa5200c93b025e1bb3480a8911684f2b00667d45d9d2457ff566e942417fbddfb274fbf60962da9f9b3d3498661a0b9f5cb1e42035482887d5325d49599adeca7759459cf9412499881f8011366096f8017deecb857791cebc44cc392f41eb25e2ee2a6211926b7c398d72e685b0fbbda9144fbeefc7eccce9f288d82fa5572ee60550d278d9cd15e5c0f961f8e92113e1ad298617e4f8bf3c845e240fa0f1c107522064a8084c57b0a1eadc377cc6b8bc3d7baae466855672ed41260357912b77d75e8bcad364ea64038192f37e2d66ebda38a7fdde441e94d952820443f33f0a185862c036c722d02d094ff66cb225f84feb4696a784992304f38627abe36fb4a33f4d95976�x���������������������X)�%�
��"������s�$c����������������sr�ed, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0dbc815834d8966763d592edfdca1306117b0277, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)
R
RRRRRR	R
RRRRRutf-8b29dfaabd9cc5ee7be868c70b6aa865e441ad05391cc81be003858b8cdb056d5?����Ld�3!�^���P,��*����%�f��
	*����%�0��-a�N�G��x��J�Gu�vpǨK�X����4?��v.���ʖR&Sӡ��Qs���#�x#����aY��'�E��X����>�C�;H�yu�òN�`3I�\\��
�/��]$%�C��y��4y�ܯ	�[��׊��Ld�����Yy%���s��o�!�L��zo̔���u�e���{�r��M�\��o�Ug�i��8X�v�/m��s�L{�u_�7*���A�F��z{�kN��8q
���:1
�#G:,�2o	c��I�Qf�>�4�w�:�<Q��>��"���e��_�5��%(������Eeg,�8�������.��AimNG�"�D;�\\�ҔzG-�"5��u���Wq�	�^M�`�ƿ�8V�Y\�y�6h�b�"1��tB;昨Y�aUv��%p���Unv0����� pK�Q�W<Л�
1(k��{yp��b�?�J?V��ꥠ���nn�ҡa[�vC���+�4a$�1�A�H���X��T� $w�3!�^���P,��*����%�f��
	*����%�	u�N
?���G��s�~Z�ISzü�'��B%��`���z�Ho���B:�s�Y82��n���4�3���NG��P.$G�����(V�;��l�'� �B�>H�|ɧ^�j�2��v�U��E)-5v=~�
t�B�'�\��]�Wr	 �reZ5�u8
���2�!�ʹ�3�?���1}S������1���'L@���҉1c�*����4���e��>Q��Z[��g�����}�����)?�
~���Εw�ҝ��+q�~���vV-z%X����u`g�4�a�C&�'��Q�4�3 ��9ra������Ů�Qc*��SX=�y���j����H�Dߚ���cjй�W*'���g*�A��uRV��l�+�*&�7h�&@$�)@˨(4*{�����Ǭ��nh���4���En9#I�T�V԰t���G���CB���s[��H^���a��B�N�_�M��cwN���m:�j�"�éì�Oq�46066d4e978ea2acfd3611db3ed865e3cd4eb956fa465703f1ebba4dd6db998b6f4582dcce737aefc8120c82fb283143b8793061fX�/ҔfX�CL_1.1)(64bit)��"libattr.so.1(ATTR_1.1)(64bit)��
libblkid.so.1(BLKID_1.0)(64bit)1��� libblkid.so.1(BLKID_2.21)(64bit)<0������ libblkid.so.1(BLKID_2.17)(64bit)B0������
 libblkid.so.1(BLKID_2.15)(64bit)H0����	��	libblkid.so.1()(64bit)M���libblkidP�libarchive.so.13()(64bit)�
keyutils-libs�dlibbrotlidec.so.1()(64bit)h�libanonymous.so.3()(64bit)�u/libbasicobjects.so.0(BASICOBJECTS_0.1.1)(64bit)- �a/libbasicobjects.so.0(BASICOBJECTS_0.1.0)(64bit)69�]libbasicobjects.so.0()(64bit)�nlibbasicobjectsas�elibbrotlicommon.so.1()(64bit)libc.so.6()(64bit)H*J�����	��libbz2.so.1()(64bit);libauparse.so.0()(64bit)H;J�����
��libaudit.so.1()(64bit) Do��libattr.so.1()(64bit)@Eop�����libacl.so.1(ACL_1.0)(64bit)PEop�������libacl.so.1()(64bit)olibacllibKSC.so()(64bit)libJISX0213.so()(64bit)libJIS.so()(64bit)libISOIR165.so()(64bit)libGB.so()(64bit)libCNS.so()(64bit)�&'*+:=BFILXeg~���������	����&ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)(ld-linux-x86-64.so.2(GLIBC_2.2.5)(64bit)�&'*+:=BFILXeg~�������������ld-linux-x86-64.so.2()(64bit)u*iptables-libs(x86-64)�x����������������������X*�%�
��
�������{!�$k����������������{!z!|!�7)
- Fix an overflow when parsing a character range with no preceding character
  (RT#132245)
- Fix walking symbol table for ISA in Carp
- Fix handling file names with null bytes in stat and lstat functions
  (RT#131895)
- Fix a crash when untying an object witout a stash
- Fix deparsing of transliterations with unprintable characters (RT#132405)
- Fix error reporting on do() on a directory (RT#125774)
- Fix stack manipulation when a lexical subroutine is defined in a do block in
  a member of an iteration list (RT#132442)
- Fix setting $! when statting a closed file handle (RT#108288)
- Fix tainting of s/// with overloaded replacement (RT#115266)
- Expand system() arguments before a fork (RT#121105)
- Avoid undefined behavior when copying memory in Glob and pp_caller (RT#131746)- Update perl(:MODULE_COMPAT)- 5.26.1 bump (see <http://search.cpan.org/dist/perl-5.26.1/pod/perldelta.pod>
  for release notes)- Fix unreliable Time-HiRes tests (CPAN RT#122819)
- Do not require $Config{libs} providers by perl-devel package (bug #1481324)- Fix reporting malformed UTF-8 character (RT#131646)
- Fix File::Glob rt131211.t test random failures
- Fix t/op/hash.t test random failures
- Parse caret variables with subscripts as normal variables inside ${...}
  escaping (RT#131664)
- Do not display too many bytes when reporting malformed UTF-8 character
- Fix select called with a repeated magical variable (RT#131645)
- Fix error message for "our sub foo::bar" (RT#131679)
- Fix executing arybase::_tie_it() in Safe compartement (RT#131588)
- Fix handling attribute specification on our variables (RT#131597)
- Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907)
- Fix compiler warnings in code generated by ExtUtils::Constant
  (CPAN RT#63832, CPAN RT#101487)
- Fix GCC version detection for -D_FORTIFY_SOURCE override (RT#131809)- Enable separate debuginfo back- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- perl package installs all core modules, interpreter moved to
  perl-interpreter package, perl-core package is obsolete
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>
  (bug #1464903)- Make File::Glob more resistant against degenerative matching (RT#131211)
- Fix a crash when calling a subroutine from a stash (RT#131085)
- Fix an improper cast of a negative integer to an unsigned 8-bit type (RT#131190)
- Fix cloning :via handles on thread creation (RT#131221)
- Fix glob UTF-8 flag on a glob reassignment (RT#131263)
- Fix a buffer overflow in my_atof2() (RT#131526)
- Fix handling backslashes in PATH environment variable when executing
  "perl -S" (RT#129183)
- Fix a conditional jump on uninitilized memory in re_intuit_start() (RT#131575)
- Fix spurious "Assuming NOT a POSIX class" warning (RT#131522)
- Provide perl-interpreter RPM dependency symbol
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>- Stop providing old perl(MODULE_COMPAT_5.24.*)- 5.26.0 bump (see <http://search.cpan.org/dist/perl-5.26.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages
- Update or remove patches
- Enable hardening (bug #1238804)
- Use 64 bit ints on 32 bit platforms (bug #1268828)- Introduce build-conditions for groff, systemtap, syslog tests, and tcsh- Fix a null-pointer dereference on malformed code (RT#130815)
- Fix an use-after-free in substr() that modifies a magic variable (RT#129340)
- Fix a memory leak leak in Perl_reg_named_buff_fetch() (RT#130822)
- Fix an invalid memory read when parsing a loop variable (RT#130814)
- Fix a heap-use-after-free in four-arguments substr call (RT#130624)- Adapt Compress::Raw::Zlib to zlib-1.2.11 (bug #1420326)
- Fix a heap buffer overflow when evaluating regexps with embedded code blocks
  from more than one source (RT#129881)
- Fix a memory leak in list assignment from or to magic values (RT#130766)- Adapt tests to zlib-1.2.11 (bug #1420326)
- Fix a crash when compiling a regexp with impossible quantifiers (RT#130561)
- Fix a buffer overrun with format and "u�x�������������p������X++$�
h4
���$l����������������������� other plugins do
  - oracle: fixed ip_local_port_range parity warning
    resolves: rhbz#1527219
  - Fix verifying cpumask on systems with more than 32 cores
    resolves: rhbz#1528368
  - oracle: updated the profile to be in sync with KCS 39188
    resolves: rhbz#1447323- Fixed python3-gobject-base requirement- Bumped release to fix conflict caused by automerge- New version
- Dropped plugin-disk-traceback-fix patch (upstreamed)- Dropped qemu-kvm-tools-rhev requirement, now satisfied by
  tuned-profiles-nfv-host-bin
  Related: rhbz#1504681- kernel-tools made weak dependency- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- fixed traceback in disk plugin if dynamic tuning is enabled- qemu-kvm-tools-rhev made weak dependency- new release
  - rebase tuned to latest upstream
    resolves: rhbz#1388454
  - cpu-partitioning: enabled timer migration
    resolves: rhbz#1408308
  - cpu-partitioning: disabled kvmclock sync and ple
    resolves: rhbz#1395855
  - spec: muted error if there is no selinux support
    resolves: rhbz#1404214
  - units: implemented instance priority
    resolves: rhbz#1246172
  - bootloader: added support for initrd overlays
    resolves: rhbz#1414098
  - cpu-partitioning: set CPUAffinity early in initrd image
    resolves: rhbz#1394965
  - cpu-partitioning: set workqueue affinity early
    resolves: rhbz#1395899
  - scsi_host: fixed probing of ALPM, missing ALPM logged as info
    resolves: rhbz#1416712
  - added new profile cpu-partitioning
    resolves: rhbz#1359956
  - bootloader: improved inheritance
    resolves: rhbz#1274464
  - units: mplemented udev-based regexp device matching
    resolves: rhbz#1251240
  - units: introduced pre_script, post_script
    resolves: rhbz#1246176
  - realtime-virtual-host: accommodate new ktimersoftd thread
    resolves: rhbz#1332563
  - defirqaffinity: fixed traceback due to syntax error
    resolves: rhbz#1369791
  - variables: support inheritance of variables
    resolves: rhbz#1433496
  - scheduler: added support for cores isolation
    resolves: rhbz#1403309
  - tuned-profiles-nfv splitted to host/guest and dropped unneeded dependency
    resolves: rhbz#1413111
  - desktop: fixed typo in profile summary
    resolves: rhbz#1421238
  - with systemd don't do full rollback on shutdown / reboot
    resolves: rhbz#1421286
  - builtin functions: added virt_check function and support to include
    resolves: rhbz#1426654
  - cpulist_present: explicitly sorted present CPUs
    resolves: rhbz#1432240
  - plugin_scheduler: fixed initialization
    resolves: rhbz#1433496
  - log errors when applying a profile fails
    resolves: rhbz#1434360
  - systemd: added support for older systemd CPUAffinity syntax
    resolves: rhbz#1441791
  - scheduler: added workarounds for low level exceptions from
    python-linux-procfs
    resolves: rhbz#1441792
  - bootloader: workaround for adding tuned_initrd to new kernels on restart
    resolves: rhbz#1441797- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Fixed traceback when non-existent profile is queried through
  tuned-adm profile_info
  Resolves: rhbz#1385145- Fixed pkexec
  Resolves: rhbz#1377896- New release
  Resolves: rhbz#1362481
- Dropped tuned-gui-traceback-fix and tuned-adm-list-no-dbus-traceback-fix
  patches (both upstreamed)- Fixed tuned-gui traceback (by tuned-gui-traceback-fix patch)
  Resolves: rhbz#1358846
- Fixed 'tuned-adm list' traceback if daemon is not running
  (by tuned-adm-list-no-dbus-traceback-fix patch)- new-release
  - gui: fixed save profile
    resolves: rhbz#1242491
  - tuned-adm: added --ignore-missing parameter
    resolves: rhbz#1243807
  - plugin_vm: added transparent_hugepage alias
    resolves: rhbz#1249610
  - plugins: added modules plugin
    resolves: rhbz#1249618
  - plugin_cpu: do not show error if cpupower or x86_energy_perf_policy are
    missing
    resolves: rhbz#1254417
  - tuned-adm: fixed restart attempt if tuned is not running
    resolves: rhbz#1258755
  - nfv: avoided race condition by using synchronous�x���������������������X,�%�
�]
�����q�$a����������������qpr�mlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)shadow-utilssystemd-unitssystemd-unitssystemd-unitstrousers-lib(x86-64)0.3.15-2.el83.0.4-14.6.0-14.0-15.2-10.3.15-2.el84.14.3e/�_�:�\���\��@[m~@[a��[U�@Z}�@Y�@Yy�X���V���U�@Ud`@S��S�P@St�@S(5@R���R�Q�B@Q�3�Q#@Pa��P?U�P;a@P�@O��On@M���MS�@MR��K��Ko��Kb�J��@JlE@J�J{�I��@I�2�Is�IG�@IG�@H�5@H���HF��HE2@G��Gfd�Ga�G_�@GMX@GMX@G8@@D���D�n@Štěpán Horáček <shoracek@redhat.com> - 0.3.15-2Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.15-1Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-4Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-3Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-2Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-1Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.13-11Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-10Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-9Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-8Peter Robinson <pbrobinson@fedoraproject.org> 0.3.13-7Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-5Tomáš Mráz <tmraz@redhat.com> 0.3.13-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-2Steve Grubb <sgrubb@redhat.com> 0.3.13-1Steve Grubb <sgrubb@redhat.com> 0.3.11.2-3Peter Robinson <pbrobinson@fedoraproject.org> 0.3.11.2-2Steve Grubb <sgrubb@redhat.com> 0.3.11.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.10-4Steve Grubb <sgrubb@redhat.com> 0.3.10-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.10-2Steve Grubb <sgrubb@redhat.com> 0.3.10-1Steve Grubb <sgrubb@redhat.com> 0.3.9-4Steve Grubb <sgrubb@redhat.com> 0.3.9-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.9-2Steve Grubb <sgrubb@redhat.com> 0.3.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.6-2Steve Grubb <sgrubb@redhat.com> 0.3.6-1Miloš Jakubíček <xjakub@fi.muni.cz> - 0.3.4-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.4-4Miloš Jakubíček <xjakub@fi.muni.cz> - 0.3.4-3Steve Grubb <sgrubb@redhat.com> 0.3.4-2Steve Grubb <sgrubb@redhat.com> 0.3.4-1Tomas Mraz <tmraz@redhat.com> - 0.3.1-19Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.1-18Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-17Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-16Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-15Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.1-14Tomas Mraz <tmraz@redhat.com> - 0.3.1-13David Woodhouse <David.Woodhouse@intel.com> - 0.3.1-12David Woodhouse <David.Woodhouse@intel.com> - 0.3.1-11Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-10Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-9Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-8Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 0.3.1-6Kent Yoder <kyoder@users.sf.net> - 0.3.1-5Kent Yoder <kyoder@users.sf.net> - 0.3.1-4Kent Yoder <kyoder@users.sf.net> - 0.3.1-3Kent Yoder <kyoder@users.sf.net> - 0.3.1-2Kent Yoder <kyoder@users.sf.net> - 0.3.1-1Kent Yoder <kyoder@users.sf.net> - 0.3.1Kent Yoder <kyoder@users.sf.net> - 0.2.6-1Kent Yoder <kyoder@users.sf.net> - 0.2.6-1- Fix home directory of the tss user
  Resolves: RHEL-9099- Rebase to 0.3.15
- Fix CVE-2020-24330 CVE-2020-24331 CVE-2020-24332
resolves: rhbz#1725782 rhbz#1877517 rhbz#1882402 rhbz#1882414- Fix annocheck warnings
resolves: rhbz#1624181- Add initial CI gating support
- Fix covscan reported issues
resolves: rhbz#1602719- release mutex in error path for obj_context_set_machine_name
resolves: rhbz#1614915- Rebase to 3.14 release
resolves: rhbz#1614915- Rebuild with correct source checksum.- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_�x�������������`�������X-
&�
8|���������$?��������������������6- 623908 fix fd leak in anacron, which caused denail of prelink
  and others- remove sendmail from requirements. If it's not installed, it will
 log into (r)syslog.- update to new release- update to new release- 564894 FTBFS DSOLinking- 533189 pam needs add a line and selinux needs defined one function- 531963 and 532482 creating noanacron package- 529632 service crond stop returns appropriate value- new release- rebuilt with new audit- create the anacron timestamps in correct post script- update to 1.4.1
- create and own /var/spool/anacron/cron.{daily,weekly,monthly} to
 remove false warning about non existent files
- Resolves: 517398- 515762 move anacron provides and obsoletes to the anacron subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- merge cronie and anacron in new release of cronie
- obsolete/provide anacron in spec- 506560 check return value of access- new release- 496973 close file descriptors after exec- rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- 477100 NO_FOLLOW was removed, reload after change in symlinked
  crontab is needed, man updated.- update init script- add sendmail file into requirement, cause it's needed some MTA- 462252  /etc/sysconfig/crond does not need to be executable- update to 1.2- fix setting keycreate context
- unify logging a bit
- cleanup some warnings and fix a typo in TZ code
- 450993 improve and fix inotify support- 49864 upgrade/update problem. Syntax error in spec.- release 1.1- 446360 check for lock didn't call chkconfig- upgrade from less than cronie-1.0-4 didn't add chkconfig- 431366 after reboot wasn't cron in chkconfig- 431366 trigger part => after update from vixie-cron on cronie will
  be daemon running.- change the provides on higher version than obsoletes- packaging cronie
- thank's for help with packaging to my reviewers/bin/sh/bin/sh/bin/shcronie-sysvinit/bin/sh/bin/sh/bin/sh	

1.5.2-10.el81.5.2-10.el81.5.2-10.el8	



cron.d0hourlycron.denycrondcrondcrond.servicecronnextcrontab.build-id4d3dddeacec65e1a9392128f48a9b9f928c84d1b77afc4d38904aed0da78db3ea75771291e04f28bfe2f8563d3ec9b2c7d348e260c015eb237574379crondcronieAUTHORSChangeLogREADMEcronieCOPYINGcronnext.1.gzcrontab.1.gzcrontab.5.gzcron.8.gzcrond.8.gzcron/etc//etc/cron.d//etc/pam.d//etc/sysconfig//lib/systemd/system//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/4d//usr/lib/.build-id/77//usr/lib/.build-id/fe//usr/sbin//usr/share/doc//usr/share/doc/cronie//usr/share/licenses//usr/share/licenses/cronie//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8//var/spool/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	directoryASCII textemptyELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=77afc4d38904aed0da78db3ea75771291e04f28b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fe2f8563d3ec9b2c7d348e260c015eb2�x�������������س�������X.�%�
3H��������!�$�����������������!�!��wV&�ON�Y;���ʻ��%�_�3!�^���P,��*����%�h�>w
	*����%�g�x��2�+w>������A����*�|�]��/��N~au��5e�6���q��#�?	�E��A�xjC�?�u��f6u'�?�Q�?(���M���T/�A����&A�h�7#�=z�g��g*���#<�7�,�X��''�]�u�)�>:��<yZ�����Ң�gJF^W�S�F���/��pῺ������PE�-��g���f~��qT
�GpZ�P��{�r�ވ��N�C���t�m�Z�[R[T��7�*D����YY��F7�F��r�4����C�B�We&������p�;�|�&�H�21�ߎ oP���KV��8������"��:쟯�d�7�U�M�L�"�;�y��8�G�d�pY851#�BZ�@Y,�\ט�v�o��w���el�1������>�1[��C(�A�*Q�h6�$B���N��=A\+�-HQy���M���d������|D�@u��/���G���{�vc�`4bd1813eaa5852fefce1d5de2c707b76042a628d248985e3532611025c33e82a6eacdc44f85933b465a4b4bccc1fa28a6e576554h�K�^Dh�K�ck (Steve Best) [1638287]
- [powerpc] powerpc/time: Use clockevents_register_device(), fixing an issue with large decrementer (Steve Best) [1638287]
- [hwmon] hwmon: (nct6775) Fix potential Spectre v1 (Dean Nelson) [1637464]
- [vfio] vfio-pci: Disable binding to PFs with SR-IOV enabled (Alex Williamson) [1637871]
- [netdrv] net: hns3: fix page_offset overflow when CONFIG_ARM64_64K_PAGES (Petr Oros) [1638385]
- [netdrv] net: hns: fix skb->truesize underestimation (Petr Oros) [1638385]
- [netdrv] net: hns: fix length and page_offset overflow when CONFIG_ARM64_64K_PAGES (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix get_vector ops in hclgevf_main module (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix warning bug when doing lp selftest (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for mac pause not disable in pfc mode (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for mailbox message truncated problem (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix return value error in hns3_reset_notify_down_enet (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for reset_level default assignment probelm (Petr Oros) [1638385]
- [netdrv] net: hns3: Reset net device with rtnl_lock (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for phy link issue when using marvell phy driver (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for command format parsing error in hclge_is_all_function_id_zero (Petr Oros) [1638385]
- [net] xprtrdma: Fix disconnect regression (Don Dutile) [1635418]
- [infiniband] RDMA/uverbs: Fix validity check for modify QP (Don Dutile) [1635418]
- [infiniband] IB/srp: Avoid that sg_reset -d $srp_device triggers an infinite loop (Don Dutile) [1635418]
- [infiniband] ucma: fix a use-after-free in ucma_resolve_ip() (Don Dutile) [1635418]
- [infiniband] RDMA/uverbs: Atomically flush and mark closed the comp event queue (Don Dutile) [1635418]
- [infiniband] RDMA/mlx4: Ensure that maximal send/receive SGE less than supported by HW (Don Dutile) [1635418 1623100]
- [infiniband] RDMA/cma: Protect cma dev list with lock (Don Dutile) [1635418]
- [infiniband] IB/ipoib: Avoid a race condition between start_xmit and cm_rep_handler (Don Dutile) [1635418]
- [infiniband] RDMA/ucma: check fd type in ucma_migrate_id() (Don Dutile) [1635418]
- [infiniband] RDMA/rxe: Set wqe->status correctly if an unexpected response is received (Don Dutile) [1635418]
- [infiniband] IB/IPoIB: Set ah valid flag in multicast send flow (Don Dutile) [1635418]
- [infiniband] RDMA/core: Avoid holding lock while initializing fields on stack (Don Dutile) [1635418]
- [infiniband] IB/rxe: Drop QP0 silently (Don Dutile) [1635418]
- [infiniband] RDMA/umem: Don't hold mmap_sem for too long (Don Dutile) [1635418]
- [infiniband] IB/srpt: Fix srpt_cm_req_recv() error path (2/2) (Don Dut�x�������������P��������X/�$�
v
8������d�$t����������������dce�-ChangeLog- upgrade to the release 2.19-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc2-ChangeLog
- fix #671893 - SELinux is preventing /bin/chown from 'setattr' accesses
  on the file mounts.- clean up specfile (review #667416)- upgrade to the release 2.19-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes- fix #645640 - new "-s" parameter parsing in agetty does not work
- add -l (lock) support to fsck- fix #623685 - please extend agetty to not require a baud rate to be specified- fix #620924 - /sbin/mount.tmpfs uses not available /usr/bin/id- fix #615719 - tmpfs mount fails with 'user' option.
- fix #598631 - shutdown, reboot, halt and C-A-D don't work
- fix #618957 - ISO images listed in fstab are mounted twice at boot- upgrade to the final 2.18
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes- upgrade to 2.18-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc2-ChangeLog- upgrade to the release 2.18-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc1-ChangeLog- fix #581252 - remounting tmpfs fails because of hidden rootcontext=
- fix #580296 - "rtcwake" does miss the "off" option
- fix #575734 - use microsecond resolution for blkid cache entries
- upgrade to the bugfix release 2.17.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ChangeLog
- minor fixed in spec file- fix #533874 - libblkid should allow scanning of slow devices (eg. cdroms)- upgrade to the final 2.17.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.1-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.1-ChangeLog- upgrade to 2.17.1-rc1- fix uuidd init script- fix #541402 - uuidd initscript lsb compliance- remove Provides: lib{uuid,blkid}-static (thanks to Michael Schwendt)
- remove useless URL to sf.net- upgrade to the final 2.17
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-ChangeLog
- fix #545147 - util-linux-ng : Violation of the Packaging Guidelines
  (remove uuid and blkid static libs)- minor fixes in spec file (fix URL, add Requires, add LGPLv2+)- upgrade to 2.17-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-rc2-ChangeLog- add clock.8 man page (manlink to hwclock)
- add --help to mount.tmpfs- upgrade to 2.17-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-rc1-ChangeLog- upgrade to pre-release snapshot (official changelog not available yet, see
  http://git.kernel.org/?p=utils/util-linux-ng/util-linux-ng.git for now)- upgrade to pre-release snapshot (official changelog not available yet, see
  http://git.kernel.org/?p=utils/util-linux-ng/util-linux-ng.git for now)  
- new commands: fallocate, unshare, wipefs
- libblkid supports topology and partitions probing
- remove support for --rmpart[s] from blockdev(8) (util-linux-ng-2.14-blockdev-rmpart.patch)
- merged upstream:
  util-linux-ng-2.14-sfdisk-dump.patch
  util-linux-ng-2.16-blkid-swsuspend.patch
  util-linux-ng-2.16-libblkid-compression.patch
  util-linux-ng-2.16-libblkid-ext2.patch
  util-linux-ng-2.16-switchroot-tty.patch- fix spec file- release++- fix #519237 - bash: cannot set terminal process group (-1): Inappropriate ioctl for device- use password-auth common PAM configuration instead of system-auth and
  drop pam_console.so call from the remote PAM config file- fix #522718 - sfdisk -d /dev/xxx | sfdisk --force /dev/yyy fails when LANG is set
- fix typo in swsuspend detection- rebuilt with new audit- fix #518572 - blkid requires ext2.ko to be decompressed on installation media- fix #513104 - blkid returns no fstype for ext2 device when ext2 module not loaded- set conflict with versions of e2fsprogs containing fsck- remove the mount.conf support (see #214�x�������������Ȓ�������X0j%�
����������
ld�$|����������������ldmdkd�RSAPublicKey.3ssl.gzPEM_read_bio_RSA_PUBKEY.3ssl.gzPEM_read_bio_SSL_SESSION.3ssl.gzPEM_read_bio_X509.3ssl.gzPEM_read_bio_X509_AUX.3ssl.gzPEM_read_bio_X509_CRL.3ssl.gzPEM_read_bio_X509_REQ.3ssl.gzPEM_read_bio_ex.3ssl.gzPEM_write.3ssl.gzPEM_write_CMS.3ssl.gzPEM_write_DHparams.3ssl.gzPEM_write_DHxparams.3ssl.gzPEM_write_DSAPrivateKey.3ssl.gzPEM_write_DSA_PUBKEY.3ssl.gzPEM_write_DSAparams.3ssl.gzPEM_write_ECPKParameters.3ssl.gzPEM_write_ECPrivateKey.3ssl.gzPEM_write_EC_PUBKEY.3ssl.gzPEM_write_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_write_PKCS7.3ssl.gzPEM_write_PKCS8.3ssl.gzPEM_write_PKCS8PrivateKey.3ssl.gzPEM_write_PKCS8PrivateKey_nid.3ssl.gzPEM_write_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_write_PUBKEY.3ssl.gzPEM_write_PrivateKey.3ssl.gzPEM_write_RSAPrivateKey.3ssl.gzPEM_write_RSAPublicKey.3ssl.gzPEM_write_RSA_PUBKEY.3ssl.gzPEM_write_SSL_SESSION.3ssl.gzPEM_write_X509.3ssl.gzPEM_write_X509_AUX.3ssl.gzPEM_write_X509_CRL.3ssl.gzPEM_write_X509_REQ.3ssl.gzPEM_write_X509_REQ_NEW.3ssl.gzPEM_write_bio.3ssl.gzPEM_write_bio_CMS.3ssl.gzPEM_write_bio_CMS_stream.3ssl.gzPEM_write_bio_DHparams.3ssl.gzPEM_write_bio_DHxparams.3ssl.gzPEM_write_bio_DSAPrivateKey.3ssl.gzPEM_write_bio_DSA_PUBKEY.3ssl.gzPEM_write_bio_DSAparams.3ssl.gzPEM_write_bio_ECPKParameters.3ssl.gzPEM_write_bio_ECPrivateKey.3ssl.gzPEM_write_bio_EC_PUBKEY.3ssl.gzPEM_write_bio_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_write_bio_PKCS7.3ssl.gzPEM_write_bio_PKCS7_stream.3ssl.gzPEM_write_bio_PKCS8.3ssl.gzPEM_write_bio_PKCS8PrivateKey.3ssl.gzPEM_write_bio_PKCS8PrivateKey_nid.3ssl.gzPEM_write_bio_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_write_bio_PUBKEY.3ssl.gzPEM_write_bio_Parameters.3ssl.gzPEM_write_bio_PrivateKey.3ssl.gzPEM_write_bio_PrivateKey_traditional.3ssl.gzPEM_write_bio_RSAPrivateKey.3ssl.gzPEM_write_bio_RSAPublicKey.3ssl.gzPEM_write_bio_RSA_PUBKEY.3ssl.gzPEM_write_bio_SSL_SESSION.3ssl.gzPEM_write_bio_X509.3ssl.gzPEM_write_bio_X509_AUX.3ssl.gzPEM_write_bio_X509_CRL.3ssl.gzPEM_write_bio_X509_REQ.3ssl.gzPEM_write_bio_X509_REQ_NEW.3ssl.gzPKCS12_BAGS_free.3ssl.gzPKCS12_BAGS_new.3ssl.gzPKCS12_MAC_DATA_free.3ssl.gzPKCS12_MAC_DATA_new.3ssl.gzPKCS12_SAFEBAG_free.3ssl.gzPKCS12_SAFEBAG_new.3ssl.gzPKCS12_create.3ssl.gzPKCS12_free.3ssl.gzPKCS12_new.3ssl.gzPKCS12_newpass.3ssl.gzPKCS12_parse.3ssl.gzPKCS5_PBKDF2_HMAC.3ssl.gzPKCS5_PBKDF2_HMAC_SHA1.3ssl.gzPKCS7_DIGEST_free.3ssl.gzPKCS7_DIGEST_new.3ssl.gzPKCS7_ENCRYPT_free.3ssl.gzPKCS7_ENCRYPT_new.3ssl.gzPKCS7_ENC_CONTENT_free.3ssl.gzPKCS7_ENC_CONTENT_new.3ssl.gzPKCS7_ENVELOPE_free.3ssl.gzPKCS7_ENVELOPE_new.3ssl.gzPKCS7_ISSUER_AND_SERIAL_digest.3ssl.gzPKCS7_ISSUER_AND_SERIAL_free.3ssl.gzPKCS7_ISSUER_AND_SERIAL_new.3ssl.gzPKCS7_RECIP_INFO_free.3ssl.gzPKCS7_RECIP_INFO_new.3ssl.gzPKCS7_SIGNED_free.3ssl.gzPKCS7_SIGNED_new.3ssl.gzPKCS7_SIGNER_INFO_free.3ssl.gzPKCS7_SIGNER_INFO_new.3ssl.gzPKCS7_SIGN_ENVELOPE_free.3ssl.gzPKCS7_SIGN_ENVELOPE_new.3ssl.gzPKCS7_decrypt.3ssl.gzPKCS7_dup.3ssl.gzPKCS7_encrypt.3ssl.gzPKCS7_free.3ssl.gzPKCS7_get0_signers.3ssl.gzPKCS7_new.3ssl.gzPKCS7_print_ctx.3ssl.gzPKCS7_sign.3ssl.gzPKCS7_sign_add_signer.3ssl.gzPKCS7_verify.3ssl.gzPKCS8_PRIV_KEY_INFO_free.3ssl.gzPKCS8_PRIV_KEY_INFO_new.3ssl.gzPKEY_USAGE_PERIOD_free.3ssl.gzPKEY_USAGE_PERIOD_new.3ssl.gzPOLICYINFO_free.3ssl.gzPOLICYINFO_new.3ssl.gzPOLICYQUALINFO_free.3ssl.gzPOLICYQUALINFO_new.3ssl.gzPOLICY_CONSTRAINTS_free.3ssl.gzPOLICY_CONSTRAINTS_new.3ssl.gzPOLICY_MAPPING_free.3ssl.gzPOLICY_MAPPING_new.3ssl.gzPROFESSION_INFO.3ssl.gzPROFESSION_INFOS.3ssl.gzPROFESSION_INFOS_free.3ssl.gzPROFESSION_INFOS_new.3ssl.gzPROFESSION_INFO_free.3ssl.gzPROFESSION_INFO_get0_addProfessionInfo.3ssl.gzPROFESSION_INFO_get0_namingAuthority.3ssl.gzPROFESSION_INFO_get0_professionItems.3ssl.gzPROFESSION_INFO_get0_professionOIDs.3ssl.gzPROFESSION_INFO_get0_registrationNumber.3ssl.gzPROFESSION_INFO_new.3ssl.gzPROFESSION_INFO_set0_addProfessionInfo.3ssl.gzPROFESSION_INFO_set0_namingAuthority.3ssl.gzPROFESSION_INFO_set0_professionItems.3ssl.gzPROFESSION_INFO_set0_professio�x�������������@��������X1�%�
8Z������P�������7��$'����������������7�8�6��alumni.drew.edu> - 4:5.10.0-82Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-81Stepan Kasal <skasal@redhat.com> - 4:5.10.0-80Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-79Stepan Kasal <skasal@redhat.com> - 4:5.10.0-78arcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-77Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-76Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.10.0-75Stepan Kasal <skasal@redhat.com> - 4:5.10.0-74Stepan Kasal <skasal@redhat.com> - 4:5.10.0-73Stepan Kasal <skasal@redhat.com> - 4:5.10.0-72Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-71Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-70Stepan Kasal <skasal@redhat.com> - 4:5.10.0-69Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-68Stepan Kasal <skasal@redhat.com> - 4:5.10.0-67Stepan Kasal <skasal@redhat.com> - 4:5.10.0-66Stepan Kasal <skasal@redhat.com> - 4:5.10.0-65Stepan Kasal <skasal@redhat.com> - 4:5.10.0-64Stepan Kasal <skasal@redhat.com> - 4:5.10.0-63Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-62Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-61Stepan Kasal <skasal@redhat.com> - 4:5.10.0-60Robert Scheck <robert@fedoraproject.org> - 4:5.10.0-59Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-58Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-57Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-56Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-55Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-54Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-53Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-52Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-51Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-50Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-49Lubomir Rintel <lkundrak@v3.sk> - 4:5.10.0-48Marcela Mašláňová <mmaslano@redhat.com> 4:5.10.0-47.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-46Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-45Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-44.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-43.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-42.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-41.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-40.fc10Stepan Kasal <skasal@redhat.com> 4:5.10.0-39.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-38Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-36Stepan Kasal <skasal@redhat.com> 4:5.10.0-35Stepan Kasal <skasal@redhat.com> 4:5.10.0-34Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-33Stepan Kasal <skasal@redhat.com> 4:5.10.0-32Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-28Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-27Stepan Kasal <skasal@redhat.com> 4:5.10.0-26Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-25Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-24Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-23Marcela Maslanova <mmaslano@redhat.com>Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-21Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-20Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-19Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-18Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-17Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-16Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-15Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-14Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-13Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-12Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-11Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-10Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-9Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-8Stepan Kasal <skasal@redhat.com> - 4:5.10.0-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 4:5.10.0-6Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-5Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-4Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-3Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-2Tom "spot" Callaway <tcallawa@redhat.�x��������������q�������X2�$�
���������n�$~����������������nmo�	


 !"#$%&&'())*+,--./012234556789:;<=>>?@@@@ABCDEEFGGHIIJJJKLLMNOPQQRSTUVVWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZ[[[[[[\]]]]]^_`abcdefghijklmnopqrstuvwxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzadjtimemtabloginremoterunuserrunuser-lsusu-lcalchmemchrtcolcolcrtcolrmcolumndmesgejectfallocatefincorefindmntflockgetopthexdumpi386ioniceipcmkipcrmipcsisosizekilllastlastblinux32linux64loggerloginlooklsblklscpulsipclslockslsloginslsmemlsnsmcookiemesgmoremountmountpointnameinsenterprlimitrawrenamerenicerevscriptscriptreplaysetarchsetprivsetsidsettermsutasksetulumountuname26unshareutmpdumpuuidgenuuidparsewallwdctlwhereiswritex86_64.build-id009219e358382627110aa2873705f9e5a571b03bcd2682bb03f2fd95d69809b4885cca619ab7d301bd476ab709c516470e74fd08f54074d31c19b4064260a6230beda04eb252db03555241020324f81b57d0c25d77b2e6cfd52a2aad1b74c56ecb46a91d9b4e45afe837c7eb4c53548b75df2f8d0705cb23930f026445ef98d4da490b100ca70f47a3df6926f840aa8aaf351d6db02657710d4d67d0386521294a1d143ea2871f3e2ed5bc2e04db32ea290e362b0acc07b4e7553291368912761ccd0cf8deb4d1707be9885f8ced7c5780a4945a1785861d70ef2d39ebe7f4ca2cdb365cc5a9aa9e356b3c96a85e99a6ed0176c1ffbe9de63047f7e4400a7ac9312f0b0a383360b8423522795127961534bdb060e23445fc8dbdb11ac88ebc3f1a74eadc0d0b2556283541638a6871762059904627fb8fde808eb8f3b4360912916f7247ca72648ef4304ab0c46f4b0d5037d58cfc0cc4b064b5777d1c610edbdcf3ab0a3339151120aba86b79c44792da063cd5ba688e3dc53d099729d0d03eabf8e79d4d6afdd25194be2cf43e82124a0700ec5ece3d81ba6c675b598ef23c719877f48f78170c2497b43896d06a8651763c624306ce1f6ad3ce18ecc219a303d336ea5f77810e4bfdf3b9a45c0228b0a2bfdd376e48b58b91f36c4ffbec8ad9ffda8daccb0e7a3adef656d847ebd2530df3fecc75965786f1fbc7aa64e4d87e05258a56708bfcdd0b212c0d8dfbe17ba4d3ca76407d9657406f96ecbc2f6576f5d78f254bf3571b1f5d4c8197c089708b3416bc29fcd59d841c72ac308f5a939fcd2197a7cb8e3ccee3cb41b0992027c77e5c808cf19b002989ce568c9557a920e439e272255eb883c9111918963553b0b1ffd855d7ee9782d9f5ac1ac892946bc8cadb66581180a4347370a05f1e784fd38990fcea�x�������������0a�������X3&�
`������0���$�������������������� ruubygems build dependencies- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.3- fix build on non-Fedora with python3- Fix bz2 compression support for python3 (RhBug:1293652)- Revert reworked multiversion orphaned handling- Update to 0.6.15- Rebase to upstream b1ea392
- Enable bz2 compression support (Mikolaj Izdebski <mizdebsk@redhat.com>) (RhBug:1226647)- revert obsolete, as %python_provide does it (undocumented)- adjust obsolete for stupid packaging- python2-solv obsoletes python-solv (#1263230)- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- Backport patches from upstream- Update to 0.6.14
- Backport patches from upstream- Update to 0.6.12- added compile flag to support rich dependencies
- new version adding MIPS support
- Distribute testsolv in -tools subpackage (Igor Gnatenko)
- Enable python3 bindings for fedora (Igor Gnatenko)- make bindings require the exact matching version of the lib (#1243737)- new version fixing segfault
- RbConfig fixed in the upstream (1928f1a), libsolv-ruby22-rbconfig.patch erased- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- new version fixing segfault- Rebuilt with new provides selection feature- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.2- Update to latest upstream release to fix a crash in PackageKit.- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebase to upstream 12af31a- Rebase to upstream 5bd9589- Rebase to upstream 2a5c1c4
- Filename selector can start with a star- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebase to upstream 6d968f1
- Fix RhBug:1049209- Rebase to 0.6.0, upstream commit f78f5de.- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.1- Rebase to 0.6.0, upstream commit 05baf54.- Rebase upstream bcedc98
- Fix RhBug:1051917.- Rebase to 0.4.1, upstream commit a8e47f1.- Rebase to 0.4.0, upstream commit 4442b7f.
- support DELTA_LOCATION_BASE for completeness- Rebase to 0.4.0, upstream commit d49d319.- Perl 5.18 rebuild- Rebase to upstream a59d11d.- Add build flags, including Deb, Arch, LZMA and MULTI_SEMANTICS. (RhBug:985905)- Perl 5.18 rebuild- Rebase to upstream 228d412.
- Fixes hawkey github issue https://github.com/akozumpl/hawkey/issues/13- Rebase to upstream 209e9cb.
- Package the new man pages.- Run 'make test' with libsolv build.- Rebase to upstream 7399ad1.
- Fixes RhBug:905209- Rebase to upstream e372b78.
- Fixes RhBug:e372b78- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebase to upstream 6c9d3eb.
- Drop the solv.i stdbool.h fix integrated upstream.
- Dropped the job reasons fix.- Fix build problems with Perl bindings.- Rebuilt after a failed mass rebuild.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- preliminary fix for JOB resons in solver_describe_decision().- Rebase to upstream 1617994.
- Support for RPM_ADD_WITH_HDRID.- Rebase to upstream d39a42b.
- Fix the epochs.
- Move the ruby modules into vendorarch dir, where they are expected.- Rebase to upstream 8cf7650.
- ruby bindings: fix USE_VENDORDIRS for Fedora.- Rebase to the upstream.
- Make repo_add_solv() work without stub repodata.- Rebuild for the new libdb package.- Rebuild for the new rpm package.- New upstream version, fix the .rpm release number.- New upstream version.- Adapted to Ruby 1.9.3 (workaround for broken CMake in Fedora and
  ruby template correction in bindings)- Initial packaging
- Based on Jindra Novy's spec file
- Based on upstream spec file	
�������0.7.20-6.el80.7.20-6.el8.build-ida41ef2a076fb9767824ed44e7c17321c0effaf50db70ab2422666bdc4ca19fd25d7a8a1bace05015libsolv.so.1libsolvext.so.1libsolvREADMElibsolvLICENSE.BSD/usr/lib//usr/lib/.build-id//usr/lib/.build-id/a4//usr/lib/.build-id/db//usr/lib64//usr/share/doc//usr/share/doc/libsolv//usr/s�x��������������P�������X4�$�
��������HcO�$_����������������ONP�
��I'�/'=��������������������������������������������������������������������������������������A�A���A�A�A�A�A�A�A�A���A���A�A�A�A�A�A�A�A���A�A�A�A�A�A���A�A�A���A�A�A�A�A�A�A���A�A�A���A�A�A�A���A�A�A�A�A���A�A�A���A�A�A�A�A�A�A�A�A���A�A�������A�A�A�A�A���A�A���A�A���A�����A�A���A�A�A�A�A���A�A�A�A�������������������������������������������������큤��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤����������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�[LsJ[LtE[��[+v�[��[��fG�Y��SY��S[��Y��SY��SfG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG��x������������� @�������X5%�
��������Ht�d�$@�����������������d�d�d�
z���
�	����
&
d

	�zL1	&	�y2���
�
��	�y	:	O�	`
	�		L�
��	^�W	?���g	n�7�
���,�$
<h
�
�	g	�
5�	0�	�&�����%�d�	y $� 
@  	�!$�**:!!!�
|��8	��	oXQ
k��	���
X��x��������������/�������X6v%�
�������^
3Y�$#����������������3Y4Y2Y�STRING.3ssl.gzi2d_DISPLAYTEXT.3ssl.gzi2d_DIST_POINT.3ssl.gzi2d_DIST_POINT_NAME.3ssl.gzi2d_DSAPrivateKey.3ssl.gzi2d_DSAPrivateKey_bio.3ssl.gzi2d_DSAPrivateKey_fp.3ssl.gzi2d_DSAPublicKey.3ssl.gzi2d_DSA_PUBKEY.3ssl.gzi2d_DSA_PUBKEY_bio.3ssl.gzi2d_DSA_PUBKEY_fp.3ssl.gzi2d_DSA_SIG.3ssl.gzi2d_DSAparams.3ssl.gzi2d_ECDSA_SIG.3ssl.gzi2d_ECPKParameters.3ssl.gzi2d_ECParameters.3ssl.gzi2d_ECPrivateKey.3ssl.gzi2d_ECPrivateKey_bio.3ssl.gzi2d_ECPrivateKey_fp.3ssl.gzi2d_EC_PUBKEY.3ssl.gzi2d_EC_PUBKEY_bio.3ssl.gzi2d_EC_PUBKEY_fp.3ssl.gzi2d_EDIPARTYNAME.3ssl.gzi2d_ESS_CERT_ID.3ssl.gzi2d_ESS_ISSUER_SERIAL.3ssl.gzi2d_ESS_SIGNING_CERT.3ssl.gzi2d_EXTENDED_KEY_USAGE.3ssl.gzi2d_GENERAL_NAME.3ssl.gzi2d_GENERAL_NAMES.3ssl.gzi2d_IPAddressChoice.3ssl.gzi2d_IPAddressFamily.3ssl.gzi2d_IPAddressOrRange.3ssl.gzi2d_IPAddressRange.3ssl.gzi2d_ISSUING_DIST_POINT.3ssl.gzi2d_NAMING_AUTHORITY.3ssl.gzi2d_NETSCAPE_CERT_SEQUENCE.3ssl.gzi2d_NETSCAPE_SPKAC.3ssl.gzi2d_NETSCAPE_SPKI.3ssl.gzi2d_NOTICEREF.3ssl.gzi2d_OCSP_BASICRESP.3ssl.gzi2d_OCSP_CERTID.3ssl.gzi2d_OCSP_CERTSTATUS.3ssl.gzi2d_OCSP_CRLID.3ssl.gzi2d_OCSP_ONEREQ.3ssl.gzi2d_OCSP_REQINFO.3ssl.gzi2d_OCSP_REQUEST.3ssl.gzi2d_OCSP_RESPBYTES.3ssl.gzi2d_OCSP_RESPDATA.3ssl.gzi2d_OCSP_RESPID.3ssl.gzi2d_OCSP_RESPONSE.3ssl.gzi2d_OCSP_REVOKEDINFO.3ssl.gzi2d_OCSP_SERVICELOC.3ssl.gzi2d_OCSP_SIGNATURE.3ssl.gzi2d_OCSP_SINGLERESP.3ssl.gzi2d_OTHERNAME.3ssl.gzi2d_PBE2PARAM.3ssl.gzi2d_PBEPARAM.3ssl.gzi2d_PBKDF2PARAM.3ssl.gzi2d_PKCS12.3ssl.gzi2d_PKCS12_BAGS.3ssl.gzi2d_PKCS12_MAC_DATA.3ssl.gzi2d_PKCS12_SAFEBAG.3ssl.gzi2d_PKCS12_bio.3ssl.gzi2d_PKCS12_fp.3ssl.gzi2d_PKCS7.3ssl.gzi2d_PKCS7_DIGEST.3ssl.gzi2d_PKCS7_ENCRYPT.3ssl.gzi2d_PKCS7_ENC_CONTENT.3ssl.gzi2d_PKCS7_ENVELOPE.3ssl.gzi2d_PKCS7_ISSUER_AND_SERIAL.3ssl.gzi2d_PKCS7_NDEF.3ssl.gzi2d_PKCS7_RECIP_INFO.3ssl.gzi2d_PKCS7_SIGNED.3ssl.gzi2d_PKCS7_SIGNER_INFO.3ssl.gzi2d_PKCS7_SIGN_ENVELOPE.3ssl.gzi2d_PKCS7_bio.3ssl.gzi2d_PKCS7_bio_stream.3ssl.gzi2d_PKCS7_fp.3ssl.gzi2d_PKCS8PrivateKeyInfo_bio.3ssl.gzi2d_PKCS8PrivateKeyInfo_fp.3ssl.gzi2d_PKCS8PrivateKey_bio.3ssl.gzi2d_PKCS8PrivateKey_fp.3ssl.gzi2d_PKCS8PrivateKey_nid_bio.3ssl.gzi2d_PKCS8PrivateKey_nid_fp.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO_bio.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO_fp.3ssl.gzi2d_PKCS8_bio.3ssl.gzi2d_PKCS8_fp.3ssl.gzi2d_PKEY_USAGE_PERIOD.3ssl.gzi2d_POLICYINFO.3ssl.gzi2d_POLICYQUALINFO.3ssl.gzi2d_PROFESSION_INFO.3ssl.gzi2d_PROXY_CERT_INFO_EXTENSION.3ssl.gzi2d_PROXY_POLICY.3ssl.gzi2d_PUBKEY.3ssl.gzi2d_PUBKEY_bio.3ssl.gzi2d_PUBKEY_fp.3ssl.gzi2d_PrivateKey.3ssl.gzi2d_PublicKey.3ssl.gzi2d_RSAPrivateKey.3ssl.gzi2d_RSAPrivateKey_bio.3ssl.gzi2d_RSAPrivateKey_fp.3ssl.gzi2d_RSAPublicKey.3ssl.gzi2d_RSAPublicKey_bio.3ssl.gzi2d_RSAPublicKey_fp.3ssl.gzi2d_RSA_OAEP_PARAMS.3ssl.gzi2d_RSA_PSS_PARAMS.3ssl.gzi2d_RSA_PUBKEY.3ssl.gzi2d_RSA_PUBKEY_bio.3ssl.gzi2d_RSA_PUBKEY_fp.3ssl.gzi2d_SCRYPT_PARAMS.3ssl.gzi2d_SCT_LIST.3ssl.gzi2d_SSL_SESSION.3ssl.gzi2d_SXNET.3ssl.gzi2d_SXNETID.3ssl.gzi2d_TS_ACCURACY.3ssl.gzi2d_TS_MSG_IMPRINT.3ssl.gzi2d_TS_MSG_IMPRINT_bio.3ssl.gzi2d_TS_MSG_IMPRINT_fp.3ssl.gzi2d_TS_REQ.3ssl.gzi2d_TS_REQ_bio.3ssl.gzi2d_TS_REQ_fp.3ssl.gzi2d_TS_RESP.3ssl.gzi2d_TS_RESP_bio.3ssl.gzi2d_TS_RESP_fp.3ssl.gzi2d_TS_STATUS_INFO.3ssl.gzi2d_TS_TST_INFO.3ssl.gzi2d_TS_TST_INFO_bio.3ssl.gzi2d_TS_TST_INFO_fp.3ssl.gzi2d_USERNOTICE.3ssl.gzi2d_X509.3ssl.gzi2d_X509_ALGOR.3ssl.gzi2d_X509_ALGORS.3ssl.gzi2d_X509_ATTRIBUTE.3ssl.gzi2d_X509_AUX.3ssl.gzi2d_X509_CERT_AUX.3ssl.gzi2d_X509_CINF.3ssl.gzi2d_X509_CRL.3ssl.gzi2d_X509_CRL_INFO.3ssl.gzi2d_X509_CRL_bio.3ssl.gzi2d_X509_CRL_fp.3ssl.gzi2d_X509_EXTENSION.3ssl.gzi2d_X509_EXTENSIONS.3ssl.gzi2d_X509_NAME.3ssl.gzi2d_X509_NAME_ENTRY.3ssl.gzi2d_X509_PUBKEY.3ssl.gzi2d_X509_REQ.3ssl.gzi2d_X509_REQ_INFO.3ssl.gzi2d_X509_REQ_bio.3ssl.gzi2d_X509_REQ_fp.3ssl.gzi2d_X509_REVOKED.3ssl.gzi2d_X509_SIG.3ssl.gzi2d_X509_VAL.3ssl.gzi2d_re_X509_CRL_tbs.3ssl.gzi2d_re_X509_REQ_tbs.3ssl.gzi2d_re_X509_tbs.3ssl.gzi2o_SCT.3ssl.gzi�x��������������������X7%�
���������|�d�$+�����������������d�d�d�ecd76fd3a153f8bd0781958b3cfa91c207d6fbb29330a952e16c283ae4ea392a502ff204b9f0153272a270761440b5bf5cc32c917b7aea291ec2fb586c89302d852364582945677c3e7a1eb7e34b84e559a3b7680dfa7d5881eef3d443423c8f28ec7cd4e3af4660ee35003502384409d3f2aecfed97c93e10c63d345144a618b26d8c0219e5c5770c69e1cad469e02740d715f7d49e0b7b5d8f1838878875d38f1811f1d78f1bdaad42a48ffea831513eaafa3939d7dc68284bf8a0af9d5387f96ec9f7f5056c926dc185febe90db7f213c6c4adb5cb7c48b3da2b44bd244f49272e29b32987022d1168a2b31d01f84471159a525063940d069aa7ada614c8ab930482999efe21cd32670dccca926971fdee8bbc85237flibcrypto.so.1.1.1klibssl.so.1.1.1kX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzX509_dup.3ssl.gzASN1_ITEM_lookup.3ssl.gzASN1_OBJECT_new.3ssl.gzASN1_STRING_TABLE_add.3ssl.gzASN1_STRING_TABLE_add.3ssl.gzASN1_STRING_TABLE_add.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_new.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_print_ex.3ssl.gzASN1_STRING_print_ex.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_new.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set.3ssl.gzOPENSSL_load_builtin_modules.3ssl.gzASN1_generate_nconf.3ssl.gzASN1_STRING_print_ex.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_start_job.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_encrypt.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDR.3ssl.gzBIO_connect.3ssl.gzBIO_s_file.3ssl.gzBIO_connect.3ssl.gzBIO_ctrl.3ssl.gzBIO_set_callback.3ssl.gzBIO_set_callback.3ssl.gzBIO_connect.3ssl.�x���������������������X8�%�
@��~��$R��������������������-0.19.8.1.so()(64bit)libgettextsrc-0.19.8.1.so()(64bit)libglib-2.0.so.0()(64bit)libgomp.so.1()(64bit)libgomp.so.1(GOMP_1.0)(64bit)libgomp.so.1(GOMP_4.0)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libncurses.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libtinfo.so.6()(64bit)libunistring.so.2()(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)0.19.8.1-17.el83.0.4-14.6.0-14.0-15.2-1filesystem34.14.2]�@]�@\�-@Zz�@Zu�@ZOh�Y���Yx�@X�,�X��@X��XZn�XW�XS�@X=m�W�@W[�@WYZ@V��V��V���Vii@V�U���U���U�>�U�a@UD�@T�s@T��@T��@T�M�TO�@T?�@T>a�T.��T�@S�G�S��@S���S��@S���S�g@S�g@R��@R�Q��Q�L�Q��Q?�Q�@P��Pj�@P��P��Oĺ@O��@O�O�O(@N��@N�@MQ0@MO�MO�L��@Lrb�L!�@K�u�Kы�K�@J��Ji�@JB@J?r@J��I��@I�@H��H��H���Hv@G�s@G�s@G�-@G�}�F�@F�w�F��F�<@F�u�F5�@E�5@E��@E��@E��@E��@E��Ej�@Ee�@EA�E �@D��@D�+@D��D��@C�R@C�@C�C�g@C�q�C:��B�=�B>�@B$Y@A��@A�%@A_�A]F�AE��@��@Ū@@�@@��@��@@Dw@@,�@@;�?j�>��@>�/�>.��>&��=�?�=�=l�@=Jt@=C�=@<��<�@<���<�?@<o�@<<0�<@;�\�;��@;�A�;���;r{@;V�;T(�;x@;&�:�:�S�:��:��@:��@:n�:a��:]�@:L|�9���9��@9m�@9i��9Q��9	}@8��8��@8|l�7�9�7��7�,@7�e�71�@6��@6�6f}@6@5���5�5��5���5Ds@4\k@4[�3���Sundeep Anand <suanand@redhat.com> - 0.19.8.1-17Sundeep Anand <suanand@redhat.com> - 0.19.8.1-16Jens Petersen <petersen@redhat.com> - 0.19.8.1-15Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-14Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.19.8.1-13Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-12Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-11Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-10Kalev Lember <klember@redhat.com> - 0.19.8.1-9Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-8Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-7Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-6Miro Hrončok <mhroncok@redhat.com> - 0.19.8.1-5Petr Šabata <contyk@redhat.com> - 0.19.8.1-4Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-3Daiki Ueno <dueno@redhat.com> - 0.19.8.1-2Daiki Ueno <dueno@redhat.com> - 0.19.8.1-1Daiki Ueno <dueno@redhat.com> - 0.19.8-1Fedora Release Engineering <releng@fedoraproject.org> - 0.19.7-4Daiki Ueno <dueno@redhat.com> - 0.19.7-3Daiki Ueno <dueno@redhat.com> - 0.19.7-2Daiki Ueno <dueno@redhat.com> - 0.19.7-1Daiki Ueno <dueno@redhat.com> - 0.19.6-1Daiki Ueno <dueno@redhat.com> - 0.19.5.1-2Daiki Ueno <dueno@redhat.com> - 0.19.5.1-1Daiki Ueno <dueno@redhat.com> - 0.19.4-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19.4-6Kalev Lember <kalevlember@gmail.com> - 0.19.4-5Till Maas <opensource@till.name> - 0.19.4-4Daiki Ueno <dueno@redhat.com> - 0.19.4-3Daiki Ueno <dueno@redhat.com> - 0.19.4-2Daiki Ueno <dueno@redhat.com> - 0.19.4-1Peter Robinson <pbrobinson@fedoraproject.org> 0.19.3-2Daiki Ueno <dueno@redhat.com> - 0.19.3-1Daiki Ueno <dueno@redhat.com> - 0.19.2-5Daiki Ueno <dueno@redhat.com> - 0.19.2-4Dennis Gilmore <dennis@ausil.us> - 0.19.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19.2-2Daiki Ueno <dueno@redhat.com> - 0.19.2-1Daiki Ueno <dueno@redhat.com> - 0.19.1-2Daiki Ueno <dueno@redhat.com> - 0.19.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19-3Daiki Ueno <dueno@redhat.com> - 0.19-2Daiki Ueno <dueno@redhat.com> - 0.19-1Daiki Ueno <dueno@redhat.com> - 0.18.3.2-1Daiki Ueno <dueno@redhat.com> - 0.18.3.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.3-2Daiki Ueno <dueno@redhat.com> - 0.18.3-1Daiki Ueno <dueno@redhat.com> - 0.18.2.1-2Daiki Ueno <dueno@redhat.com> - 0.18.2.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.2-2Daiki Ueno <dueno@redhat.com> - 0.18.2-1Jens Petersen <petersen@redhat.com> - 0.18.1.1-17Jens Petersen <petersen@redhat.com> - 0.18.1.1-1�x���������������������X9�%�
��������� ������V�$�����������������VVV�ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b49d222b6badb99e2485f43943117291c1c3d9af, strippeddirectoryPerl5 module source textPerl POD document, ASCII textASCII textPerl5 module source, ASCII text, with very long linesELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6348c2486233cf8e50702aea59b737f7d32ac688, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2fc46f25fa2c9ce10bd177a351ff4ffcbc38df5e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0789a40331769143eac65087200fc9ee07673eca, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7f855b53e57aba52c5572d9fe81a2a129fcf1f2a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=20307d9d535d93a26fd5238cc181a63b187ed089, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0b93a2c0e77051df14d9030fd92d070d87536ff4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1192ff9fe30513a27467baeeb3ac4b0c46ade694, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=873bc4d23ab94b4f545cca420fece9674e3956a6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=983e0d728a343d4a89e31820e554b1f0aaa64842, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=afce3a4dbeaafaec2475b32e35d4ad37974526cc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b2295248594e0a59c9b04789c86a4ea61450db28, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c2a9c27a61d461d7d8abc060374f3d0cd93cbec3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ffc49ed5166a3a16af22eab118ab777a9455a009, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=44855f734112d8ff9b4e42fc4287d5bb6b018a2d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c95699abb089d63ec4395b9814f1d88b592740dd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ee4534ed175175d26b182e4de505564a26f85767, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=66c529abd1c3eb4d79a84be19a9d2be6f892f494, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3239efc797250ec716ad27df6214fa2581354112, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5036906a748b622a828c8f41a639395cd88c5d56, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ef3dbbac3ef6f3ff8d5fe2e8cb3050eb1fc1623d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1bc4cd0bba113258f0015fdceca91323141831bb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4576a7383cb0ff03607febebb22ed85e20c8cd93, strippedASCII text, with very long linestroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)awk or perl script, ASCII textAlgol 68 source, ASCII textPerl5 module source, ASCII textPerl POD document, ASCII text, with very long linesPerl POD document, UTF-8 Unicode textC source, ASCII textOS/2 REXX batch file, ASCII textPython script, ASCII text executable, with ve�x�������������������XC%�
������������d�����$_�����������������d�d�d�	`	�
n	g
"
w		K	;	L
	s
;	�
�	�	|	w
!
b	0	�	k'�}
�o#�����	=
���
��L�
�	��!\�K�	�""����C	[	\�g��
m��
�
B��
L
Y	
��
�
�
�	Nx�4�	Q$$�$$$$$$$$$	3
�
�+
z
m	B"0
Z�ujt''''	;
@
� 	�%W	�#
�$*	]%**
	�%
""%%!#!%%"+""&$$$	v�#��#
�
H�	fA&"&&

��">+h��
JRs00�	�#
A%'%%%	��s
<�'%�x���������������������X;�%�
��������������$X�$4����������������$X%X#X��x������!�������X<�%�
h������x,
,��$<����������������,�-�+��d config option -Dinc_version_list=none (#448735)
- use perl_archname consistently
- cleanup of usage of *_lib macros in %install- 449577 rebuild for FTBFS- 448392 upstream fix for assertion- sparc64 breaks with the rpath hack patch applied- 447142 upgrade CGI to 3.37 (this actually happened in -21 in rawhide.)- sparc64 fails two tests under mysterious circumstances. we need to get the
  rest of the tree moving, so we temporarily disable the tests on that arch.- create the vendor_perl/%{perl_version}/%{perl_archname}/auto directory 
  in %{_libdir} so we own it properly- fix CPANPLUS-Dist-Build Provides/Obsoletes (bz 437615)
- bump version on Module-CoreList subpackage- forgot to create the auto directory for multilib vendor_perl dirs- own multilib vendor_perl directories
- mark Module::CoreList patch in patchlevel.h- 437817: RFE: Upgrade Module::CoreList to 2.14- xsubpp now lives in perl-devel instead of perl.- back out Archive::Extract patch, causing odd test failure- add missing lzma test file- conditionalize multilib patch report in patchlevel.h
- Update Archive::Extract to 0.26
- Update Module::Load::Conditional to 0.24- only do it once, and do it for all our patches- note 32891 in patchlevel.h- get rid of bad conflicts on perl-File-Temp- use /usr/local for sitelib/sitearch dirs
- patch 32891 for significant performance improvement- Add perl-File-Temp provides/obsoletes/conflicts (#433836),
  reported by Bill McGonigle <bill@bfccomputing.com>
- escape the macros in Jan 30 entry- Autorebuild for GCC 4.3- disable some futime tests in t/io/fs.t because they started failing on x86_64
  in the Fedora builders, and no one can figure out why. :/- create %{_prefix}/lib/perl5/vendor_perl/%{perl_version}/auto and own it
  in base perl (resolves bugzilla 214580)- Update Sys::Syslog to 0.24, to fix test failures- add some BR for tests- 5.10.0 final
- clear out all the unnecessary patches (down to 8 patches!)
- get rid of super perl debugging mode
- add new subpackages- first attempt at building 5.10.0perlperl-suidperl�x��������������������X=�$�
0��������r�$b����������������rqs�@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijj@kklm@nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnonnnnnnnnnnnnnnnnnnnnnnnnnnnnnASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=78ecd19fec9be4640f53d9d755f6bbe3173a9e40, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=57406f96ecbc2f6576f5d78f254bf3571b1f5d4c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c5a8e742ea95368b65edd856bf2feb3119654677, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=de1ce0c881b70b8795bffa9c5293934ceed7a094, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=bbaf61082ea843099d4d4c605f38a644bfcfff58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=23930f026445ef98d4da490b100ca70f47a3df69, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dd56df3364e0a120316ba13844156f82f2316575, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=37d58cfc0cc4b064b5777d1c610edbdcf3ab0a33, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c9e12427b5453fd47600be6221f49fbd2c72231d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9f9375a931913c2f05b0717bd331e89920c00338, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=da6629069a545035ea5f8aed959c2b35e9b070d5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7a0517578d75c9d2926188e6b8717d2bd682beba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamicall�x�������������X��������X>&�
v
����������$�������������������JcT?_<d��
��	�	1�p�t�����������	�����H	^
t��
,c���	�@	t	�	�	�(	�8	��9��:)g�GX�HX�IYXY$	YYH	\Yl]Y�^Z6	bZ�d\8e\=f\@l\Bt\\u\�v\�w]�x^y^<,�^��^��^��_8_L_P�aa�
b�b��c8c<cHgcLhcPClibsolv0.7.206.el8Package dependency solverA free package dependency solver using a satisfiability algorithm. The
library is based on two major, but independent, blocks:

- Using a dictionary approach to store and retrieve package
  and dependency information.

- Using satisfiability, a well known and researched topic, for
  resolving package dependencies.e'+&x64-builder01.almalinux.orgC�AlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/openSUSE/libsolvlinuxx86_64%"	?P�xneA�A�A����A큤A큤e'+%e'+%e'+%e'+%e'+%e'+%e'+%e'+%aO��e'+%aO��6bec96c1e60a28588d93d6555a913d4496cc24706f53ae28d42686fb281f1402d5171e5d258439829c7b4b987aa16cdb9fea08e7bf099fe1d8b869168fa41cab77b1004a889df14cf6d5a1b71e1d6cf17f89cdb6e408be77d3f4bb59f8a01c7d57f15acfb29fbef7749779e096a5885c60b716633e34484a21bb717554c0198f../../../../usr/lib64/libsolvext.so.1../../../../usr/lib64/libsolv.so.1�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibsolv-0.7.20-6.el8.src.rpm��������������������������������������������libsolvlibsolv(x86-64)libsolv.so.1()(64bit)libsolv.so.1(SOLV_1.0)(64bit)libsolv.so.1(SOLV_1.1)(64bit)libsolv.so.1(SOLV_1.2)(64bit)libsolv.so.1(SOLV_1.3)(64bit)libsolvext.so.1()(64bit)libsolvext.so.1(SOLV_1.0)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@



@libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)liblzma.so.5()(64bit)liblzma.so.5(XZ_5.0)(64bit)librpm.so.8()(64bit)librpmio.so.8()(64bit)libsolv.so.1()(64bit)libsolv.so.1(SOLV_1.0)(64bit)libsolv.so.1(SOLV_1.1)(64bit)libsolv.so.1(SOLV_1.3)(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)libz.so.1()(64bit)libz.so.1(ZLIB_1.2.3.3)(64bit)libzstd.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1rpm(x86-64)4.14.34.14.3d��@dd��c��@bs�@brj�a�b�`��@`��@`���`2@_��@^��\���\���\�t@\��\]o@\Z�@\�@[ā@[�Z��Z���Z��@Zz�@Zq��Zp^@Zp^@Zp^@Zo�Zo�Zo�Zo�Z�ZN�Y�+@Y��Y�4�Y��@Y�J�Y�J�Y�@Y�@Yx�@Yq�YW��Y,
@Y�X��X�!@X�~@X�O@X�B�X���Xx�@XN�@XJ��X%��X�@W��@W���W��@W��W��@W�g�W�@W_�WUe�WL+@W<Y@W;�W�W��V޾�Vя�V��@V��V�G�V��@Vs�@Vr��Vf�@VV�@VLh@VLh@VA�@VC�V��U�p�U���U��@U���U��x�������������К�������X?h%�
)�������
nd�$~����������������ndodmd�E_SPKAC_free.3ssl.gzNETSCAPE_SPKAC_new.3ssl.gzNETSCAPE_SPKI_free.3ssl.gzNETSCAPE_SPKI_new.3ssl.gzNOTICEREF_free.3ssl.gzNOTICEREF_new.3ssl.gzOBJ_cleanup.3ssl.gzOBJ_cmp.3ssl.gzOBJ_create.3ssl.gzOBJ_dup.3ssl.gzOBJ_get0_data.3ssl.gzOBJ_length.3ssl.gzOBJ_ln2nid.3ssl.gzOBJ_nid2ln.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2sn.3ssl.gzOBJ_obj2nid.3ssl.gzOBJ_obj2txt.3ssl.gzOBJ_sn2nid.3ssl.gzOBJ_txt2nid.3ssl.gzOBJ_txt2obj.3ssl.gzOCSP_BASICRESP_free.3ssl.gzOCSP_BASICRESP_new.3ssl.gzOCSP_CERTID_dup.3ssl.gzOCSP_CERTID_free.3ssl.gzOCSP_CERTID_new.3ssl.gzOCSP_CERTSTATUS_free.3ssl.gzOCSP_CERTSTATUS_new.3ssl.gzOCSP_CRLID_free.3ssl.gzOCSP_CRLID_new.3ssl.gzOCSP_ONEREQ_free.3ssl.gzOCSP_ONEREQ_new.3ssl.gzOCSP_REQINFO_free.3ssl.gzOCSP_REQINFO_new.3ssl.gzOCSP_REQUEST_free.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQ_CTX_add1_header.3ssl.gzOCSP_REQ_CTX_free.3ssl.gzOCSP_REQ_CTX_i2d.3ssl.gzOCSP_REQ_CTX_set1_req.3ssl.gzOCSP_RESPBYTES_free.3ssl.gzOCSP_RESPBYTES_new.3ssl.gzOCSP_RESPDATA_free.3ssl.gzOCSP_RESPDATA_new.3ssl.gzOCSP_RESPID_free.3ssl.gzOCSP_RESPID_match.3ssl.gzOCSP_RESPID_new.3ssl.gzOCSP_RESPID_set_by_key.3ssl.gzOCSP_RESPID_set_by_name.3ssl.gzOCSP_RESPONSE_free.3ssl.gzOCSP_RESPONSE_new.3ssl.gzOCSP_REVOKEDINFO_free.3ssl.gzOCSP_REVOKEDINFO_new.3ssl.gzOCSP_SERVICELOC_free.3ssl.gzOCSP_SERVICELOC_new.3ssl.gzOCSP_SIGNATURE_free.3ssl.gzOCSP_SIGNATURE_new.3ssl.gzOCSP_SINGLERESP_free.3ssl.gzOCSP_SINGLERESP_new.3ssl.gzOCSP_basic_add1_nonce.3ssl.gzOCSP_basic_sign.3ssl.gzOCSP_basic_sign_ctx.3ssl.gzOCSP_basic_verify.3ssl.gzOCSP_cert_id_new.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_check_nonce.3ssl.gzOCSP_check_validity.3ssl.gzOCSP_copy_nonce.3ssl.gzOCSP_id_cmp.3ssl.gzOCSP_id_get0_info.3ssl.gzOCSP_id_issuer_cmp.3ssl.gzOCSP_request_add0_id.3ssl.gzOCSP_request_add1_cert.3ssl.gzOCSP_request_add1_nonce.3ssl.gzOCSP_request_onereq_count.3ssl.gzOCSP_request_onereq_get0.3ssl.gzOCSP_request_sign.3ssl.gzOCSP_resp_count.3ssl.gzOCSP_resp_find.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_get0.3ssl.gzOCSP_resp_get0_certs.3ssl.gzOCSP_resp_get0_id.3ssl.gzOCSP_resp_get0_produced_at.3ssl.gzOCSP_resp_get0_respdata.3ssl.gzOCSP_resp_get0_signature.3ssl.gzOCSP_resp_get0_signer.3ssl.gzOCSP_resp_get0_tbs_sigalg.3ssl.gzOCSP_resp_get1_id.3ssl.gzOCSP_response_create.3ssl.gzOCSP_response_get1_basic.3ssl.gzOCSP_response_status.3ssl.gzOCSP_sendreq_bio.3ssl.gzOCSP_sendreq_nbio.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_set_max_response_length.3ssl.gzOCSP_single_get0_status.3ssl.gzOPENSSL_Applink.3ssl.gzOPENSSL_INIT_free.3ssl.gzOPENSSL_INIT_new.3ssl.gzOPENSSL_INIT_set_config_appname.3ssl.gzOPENSSL_INIT_set_config_file_flags.3ssl.gzOPENSSL_INIT_set_config_filename.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_DOALL_FUNC.3ssl.gzOPENSSL_LH_HASHFUNC.3ssl.gzOPENSSL_LH_node_stats.3ssl.gzOPENSSL_LH_node_stats_bio.3ssl.gzOPENSSL_LH_node_usage_stats.3ssl.gzOPENSSL_LH_node_usage_stats_bio.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats_bio.3ssl.gzOPENSSL_MALLOC_FAILURES.3ssl.gzOPENSSL_MALLOC_FD.3ssl.gzOPENSSL_VERSION_NUMBER.3ssl.gzOPENSSL_VERSION_TEXT.3ssl.gzOPENSSL_atexit.3ssl.gzOPENSSL_buf2hexstr.3ssl.gzOPENSSL_cipher_name.3ssl.gzOPENSSL_cleanse.3ssl.gzOPENSSL_cleanup.3ssl.gzOPENSSL_clear_free.3ssl.gzOPENSSL_clear_realloc.3ssl.gzOPENSSL_config.3ssl.gzOPENSSL_fork_child.3ssl.gzOPENSSL_fork_parent.3ssl.gzOPENSSL_fork_prepare.3ssl.gzOPENSSL_free.3ssl.gzOPENSSL_hexchar2int.3ssl.gzOPENSSL_hexstr2buf.3ssl.gzOPENSSL_ia32cap.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_ssl.3ssl.gzOPENSSL_instrument_bus.3ssl.gzOPENSSL_instrument_bus2.3ssl.gzOPENSSL_load_builtin_modules.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc_init.3ssl.gzOPENSSL_mem_debug_pop.3ssl.gzOPENSSL_mem_debug_push.3ssl.gzOPENSSL_memdup.3ssl.gzOPENSSL_no_config.3ssl.gzOPENSSL_realloc.3ssl.gzOPENSSL_secure_actual_size.3ssl.gzOPENSSL_secure_clear_free.3ssl.gzOPENSSL_secure_free.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_zalloc.3ssl.gzOPENSSL_strdup.3ssl.gzOPENSSL_strlcat.3ssl.gzOPENSSL_st�x�����p<�������X1p$�
��������w��$w��������������������re.d and post.d mandatory- x86_64: enable the kexec file load by default
- Revert "kdump-lib: switch to the kexec_file_load() syscall on x86_64 by default"- mkdumprd: Improve the error message for umounted dump target- mkdumprd: Fix nfs detection in to_mount
- Always wrap up call to dracut get_persistent_dev function
- man: improve description about /etc/kdump/{pre.d,post.d}interface- kdump-lib: switch to the kexec_file_load() syscall on x86_64 by default- Fix kdump failure when mount target specified by dracut_args
- mkdumprd: Fix dracut error on multiple extra_modules- kdump.conf: Specify /etc/kdump/{pre.d,post.d}interface
- dracut-kdump.sh: Execute the binary and script filesin /etc/kdump/{pre.d,post.d}
- kdumpctl: Check the update of the binary and script files in /etc/kdump/{pre.d,post.d}
- dracut-module-setup.sh: Install files under /etc/kdump/{pre.d,post.d} into kdump initramfs- fadump: update fadump-howto.txt with some more troubleshooting help- fadump-howto.txt: source it in spec file- mkdumprd: Use DUMP_TARGET which printing error message during ssh- Don't inherit swiotlb parameter form 1st kernel by default
- Add a new option 'rd.znet_ifname' in order to use it in udev rules
- kdump.sysconfig: Remove the option 'log_buf_len' from kdump command line
- kdump-error-handler.service: Remove ExecStopPost
- module-setup.sh: Add "rd.neednet" parameter if network is needed- Update docs for the new noauto dump target support
- kexec-kdump-howto.txt: Add some format to the document
- mkdumprd: generate usable kdump initramfs even target is not mounted
- Use get_mount_info to replace findmnt calls
- kdump-lib.sh: add fstab failback helper for getting mount info
- Allow calling mkdumprd from kdumpctl even if targat not mounted
- Add a is_mounted helper
- Introduce get_kdump_mntpoint_from_target and fix duplicated /
- Doc: Improves the early-kdump-howto.txt document in several points
- Doc: Add --force option to step 2 in early-kdump-howto.txt
- Doc: Fix typo in early-kdump-howto.txt
- Remove adjust_bind_mount_path call
- No longer treat atomic/silverblue specially
- mkdumprd: Simplify handling of user specified target
- mkdumprd: Use get_save_path instead of parsing config
- Remove is_dump_target_configured
- Always use get_save_path to get the 'path' option
- kdump-lib: Don't abuse echo, and clean up
- mkdumprd: Fix dracut args parsing
- mkdumprd: simplify dracut args parsing- dracut-module-setup.sh: improve get_alias()
- fadump: update fadump-howto.txt with some troubleshooting help
- Append both nofail and x-systemd.before to kdump mount target
- Partially Revert "Don't mount the dump target unless needed"
- Don't unmount the dump target just after saving vmcore- makedumpfile: Avoid false-positive failure in mem_seciton validation- mkdumprd: Use makedumpfile --check-params option- makedumpfile update to latest- makedumpfile rebase to 1.6.7- kexec-tools/module-setup: Ensure eth devices get IP address for VLAN- Add document to declare FCoE support- powerpc: enable the scripts to capture dump on POWERNV platform- s390: Use get_kaslr_offset_general() for s390x- arm64: kdump: deal with a lot of resource entries in /proc/iomem
- arm64: kexec: allocate memory space avoiding reserved regions
- kexec: add variant helper functions for handling memory regions- makedumpfile: assign bitmap1/2 fd for subprocess in non-cyclic mode- makedumpfile: remove -lebl- makedumpfile: Fix off-by-one issue in exclude_nodata_pages()-rhel-8.2.0, origin/rhel-8.2.0) Increase SECTION_MAP_LAST_BIT to 4
- spec: move binaries from /sbin to /usr/sbin
- As /etc/kdump.conf timestamp is updated do not compare it when doing rpm --verify
- kdumpctl: make reload fail proof- Don't execute final_action if failure_action terminates the system
- module-setup: re-fix 99kdumpbase network dependency
- kdumpctl: bail out immediately if host key verification failed
- kdumpctl: echo msg when waiting for connection
- kdumpctl: distinguish the failed reason of ssh
- kdumpctl: wait a while for network ready if dump target i�x��������������y�������XA�$�
�v��	�W�$i�����������������W�W�W�Popelka <jpopelka@redhat.com> - 2.0-0.5.20130109gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.4.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.3.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.2.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.1.20121004gitJiri Popelka <jpopelka@redhat.com> - 1.60-145.20120917gitJiri Popelka <jpopelka@redhat.com> - 1.60-144.20120917gitJiri Popelka <jpopelka@redhat.com> - 1.60-143.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-142.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-141.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-140.20120702gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-139.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-138.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-137.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-136.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-135.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-134.20120127gitJiri Popelka <jpopelka@redhat.com> - 1.60-133.20120119gitJiri Popelka <jpopelka@redhat.com> - 1.60-132.20120111gitJiri Popelka <jpopelka@redhat.com> - 1.60-131.20120105gitJiri Popelka <jpopelka@redhat.com> - 1.60-130.20111207gitJiri Popelka <jpopelka@redhat.com> - 1.60-129.20111206gitJiri Popelka <jpopelka@redhat.com> - 1.60-128Jiri Popelka <jpopelka@redhat.com> - 1.60-127Jiri Popelka <jpopelka@redhat.com> - 1.60-126Jiri Popelka <jpopelka@redhat.com> - 1.60-125Jiri Popelka <jpopelka@redhat.com> - 1.60-124Jiri Popelka <jpopelka@redhat.com> - 1.60-123Jiri Popelka <jpopelka@redhat.com> - 1.60-122Jiri Popelka <jpopelka@redhat.com> - 1.60-121Jiri Popelka <jpopelka@redhat.com> - 1.60-120Jiri Popelka <jpopelka@redhat.com> - 1.60-119Jiri Popelka <jpopelka@redhat.com> - 1.60-118Jiri Popelka <jpopelka@redhat.com> - 1.60-117Jiri Popelka <jpopelka@redhat.com> - 1.60-116Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-115Jiri Popelka <jpopelka@redhat.com> - 1.60-114Jiri Popelka <jpopelka@redhat.com> - 1.60-113Jiri Popelka <jpopelka@redhat.com> - 1.60-112Jiri Popelka <jpopelka@redhat.com> - 1.60-111Jiri Popelka <jpopelka@redhat.com> - 1.60-110Jiri Popelka <jpopelka@redhat.com> - 1.60-109Jiri Popelka <jpopelka@redhat.com> - 1.60-108jkeating - 1.60-107Jiri Popelka <jpopelka@redhat.com> - 1.60-106Jiri Popelka <jpopelka@redhat.com> - 1.60-105Jiri Popelka <jpopelka@redhat.com> - 1.60-104Jiri Popelka <jpopelka@redhat.com> - 1.60-103Jiri Popelka <jpopelka@redhat.com> - 1.60-102Jiri Popelka <jpopelka@redhat.com> - 1.60-101Jiri Popelka <jpopelka@redhat.com> - 1.60-100Jiri Popelka <jpopelka@redhat.com> - 1.60-99Jiri Popelka <jpopelka@redhat.com> - 1.60-98Jiri Popelka <jpopelka@redhat.com> - 1.60-97Jiri Popelka <jpopelka@redhat.com> - 1.60-96Jiri Popelka <jpopelka@redhat.com> - 1.60-95Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-94Jiri Popelka <jpopelka@redhat.com> - 1.60-93Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-92Zdenek Prikryl <zprikryl@redhat.com> - 1.60-91Zdenek Prikryl <zprikryl@redhat.com> - 1.60-90Zdenek Prikryl <zprikryl@redhat.com> - 1.60-89Radek Vokál <rvokal@redhat.com> - 1.60-88Radek Vokál <rvokal@redhat.com> - 1.60-87Radek Vokal <rvokal@redhat.com> - 1.60-86Fedora Release Engineering <rel-eng@fedoraproject.org> - 1.60-85Radek Vokál <rvokal@redhat.com> - 1.60-84Radek Vokál <rvokal@redhat.com> - 1.60-83Radek Vokál <rvokal@redhat.com> - 1.60-82Radek Vokál <rvokal@redhat.com> - 1.60-81Radek Vokál <rvokal@redhat.com> - 1.60-80Radek Vokál <rvokal@redhat.com> - 1.60-79Radek Vokál <rvokal@redhat.com> - 1.60-78Radek Vokál <rvokal@redhat.com> - 1.60-77Radek Vokál <rvokal@redhat.com> - 1.60-76Radek Vokal <rvokal@redhat.com> - 1.60-75Radek Vokal <rvokal@redhat.com> - 1.60-74Radek Vokal <rvokal@redhat.com> - 1.60-73Jesse Keating <jkeating@redhat.com> - 1.60-72.1Radek Vokal <rvokal@redhat.com> - 1.60-72Radek Vokal <rvokal@redhat.com> - 1.60-71Radek Vokál <rvokal@redhat.com> - 1.60-70Radek VokÈx�������������8i�������XB&�
H��v��������$ �������������������37574379, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4d3dddeacec65e1a9392128f48a9b9f928c84d1b, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)
R
R
RRRRRRRRRRRR
R
RRRRRRRRRRRR
RRR	RRRR
RRRRRRutf-8e3c94b344f27f7d3f51ed53055e8939f9856e27a6944caf042668a84c24c5f60?���P�\�3!�^���P,��*����%�f�J
	*����%�>x�ULIqy�N�k������n��h���脂BX�#�b/F[f�s� 0�u0ME��k:\���ʇ�.y��Fҋlj���ԔEg��q�⽗���ld�C[b���Q�z���B�=� �!�Ye�x�Ǟ��(4��2��]B���.0w�;L1��نd\��<�Jm�|a��B��A/%i�޴ �@�Uo�]q�1����ge$�������0֢_"�4c2MH�^�w)T�qn�1�iF�|ӗ�RRD/{�OR��W�]���=�2��ʝ��j�A��u~8�v8�*�M^"�D����������c)!h*�!�YjBIQ
㹞Gnw���A���=;5���7�p�ϫ�H��3W2���*d�!w��m���	�Iz.�n��+&��[�Da��xY�!׽J@�%�t��5�{l�����Yч�w��O �
i�ʪB�El����=�bC���K�ݒ�*
L?JњL⛿�
�nŲR��'�e��Ⱥ^��n�/1j6e�[]�P�o|�ә�3!�^���P,��*����%�f�J
	*����%����'�S+��Ə�3\����z��u��2�S�'�����c�F�]+ެ�z�2���m��l��I��a_4��� ��r[`������fmuW�jG�ۙ
�@�ۊ��v3�ަS�;<45��I�Hrzf�-�CV"���A|%�\��"�L��ۦDT,�3*j*[j9Vh{(*����n��ъ�G3�a^���=Z�y�-elʘy����g�Q�]"��LM1#(qqZ0\%��nla��C������2s��>��E�>����d�m��5�PYSs�3�i;��\v��q���.r��#��P�*��2ս�X�Q�%���}]��ߤ��h6�� ���PA�8�n��2�r��,�e�����O�I�`o~���1V0:G�i���y0���ޙuG��7�b�����|�HI�~��K��g���5%��sƿ�m���>��˹J™2����⦡��;��g���rm�:���_K`���bk�׃v���ǟ�73566674b8d742c637e16b909cd7865640f9c88e9a1b2f01c5027656e699540c81234488e9a244666550107372af902734e56febbfX�/�XfX�74e90712499db1a89edhU<8&7032f08d9b6488ccd861f332450ab58272d75a�s&7007512a5d17e237151568b07f8e7524728a78rva8�?I��:���0)70=+Uz�&6fd23b315915705e6153ad578f5f10101abba7aW�g�&6fbc5cd7e0ab6af4264752a5d92b525fc929d71fcUd&6f94ec2a21e12c23fc80fc8bd7c0e106a4c56a226g&6f8c4e86e8c48432f60eb77b33905491b2c5bf�&6f59c16e1a7b54c9f08870aba4ad7599b90d5caW���&6f4f89c740a40dc40bb21797f12b57397486d9�>.�b@&6f47a3d3cc942058bfb2fe0cc76f980cf54302ska�&6f3a3c30c1f68625a3deb6a87b1d3f7bec5452aW�0�
�8��	��J6f=L��&6eff496e1438c21be8d946cea59a7b200e2f64=���3&6e3887599f1a28d6be6bf291d2e6f150909356com�'�&6e3531c604c895837478c36eec2284f2b230dd�6��ud�.O6e=Qc&6df174808211131f415c4fbf07d775bf941838f8b�t&6deb60a2f2af66db58bc601bafe5745115b9fe@V���e&6de92fd8b6c43dfc5581556b1325f881ee7d97oje��&6dd1f20f501de2c89c824be98d9b9fee72dbb1@?���F&6dc1020927f867b8e7228256b2b1ff9542a589roj���&6d5789f1d97e366f0433bbe17df5dd6a2a50f7@S���&6d00c5f9371e4a9da21ffbd73e6810fc7fc023aW�@�Yub����,���1T6d=V��&6c8d65376137a38b00559dca80378d66c9bdb4=��-�&6c0947b656643a48eb0ed63daf34a708532e98�;	(�u_����g6c=i36&6bc5fd3b69c20038816ac9a196a7194b9fb5785�
�&6b924a727d6f237b0daabc897c4d870b79bf91�A�'�&6b569cf9370b368b32c0ee5f423a1b98ef8e1a�u]� 6b4J��&6aeb1dbbbd7511f3e8b52f00881771f8b5cfc2aW�UP&6ae81efb80a74594d209644f63488d6a686818764�x��������������X�������XC&�
��
@d��������$�������������������hare/licenses//usr/share/licenses/libsolv/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=db70ab2422666bdc4ca19fd25d7a8a1bace05015, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a41ef2a076fb9767824ed44e7c17321c0effaf50, strippedASCII textPPPPPPPPRRRR	RRRRR
RRPPR
RRRRRRRRRRRRRRRRRRRRRRutf-8b363644b47aef6e9e26015e79bc5393b6e54b5d3bf0c968a1a8582270ddb812d?����܉�!�<��ΰ��Q�d~���e(��
	Q�d~��ꋕ�p����F���4��?���	_����/�#�j9�T���@%D-Z�J�(#��X���H����˭v<�2�p`��.lw `^�OW�JW��abUa����(�I�������ժ�QDg:���R9J�ܓ�0T`R��d7E�����~�W
��xi�
)s���?��4J��/�DYG��{�E��z�m�����K�ѽ�֬��jޞ�_Ւ<kC�x��D�/&f3}�QNQ��v�����yT��T�}]��OA
�ݭ�6�S�
x/
�E>ܢ� 
.��F���g�)��"ݿ�N�X����>jk{��)��IAC��f{�n�"��4ɝ�:�h�.2Z�aUa��#QV ��m}�U��p�V��Wx����&�ph��%����!�<��ΰ��Q�d~���e(��
	Q�d~���S��܄)��̑�
�ީy�7>򋬚�.)IFj�b�qP�W8���#P�q(��nS%��a�W�8�=�}�|.)�br���t�A����ɴD�R�[�z�}RU���4�7��ޟ�i^LZ�e�q�Ѥ
�C0��m�.���_��̇���_0�w]�^��C�ݯ���ȳ�q�nk��H�,h����>��(�|��ä��?8�X�R�w_�r^/��}(��V��ȾI�_��d~���/M-�L���SC����_wq���_7d��1#d�
s��X�|-��wN(R��\�O�*�G-d��RZl�%�1t�y��ݨ[�����o�u�,���'薕.����ָ�{��ʎn��$Pz�UPޡ+�\yzk8a37236175aca3d34d6c44ee57238141026a83eeb32365a28cc6cabaed6ea5adf8a67b1240136108534ce42774c5e2f55a536f43fX�/J�fX�1246eefbdc0103118a993a�u(fc9b5f991d99c019cb011b637e844ad767a00cb4L�(fbac21015d11b9523b89929117bb5bfcb92fe3a3Dc(f9459099bf21cd815d415b1cf482ba99f79722d63�(f79ddd72cfeff0a2bc6f2db35e3d25fc12e53bc2��(f6b7354075fba5aa64dba2e570be6734f1c37225�j�(f675ba873daa2a99f05d95b2b0cc76e45a02cef0w(f4b61bd5aecd1084baa4133aef250facf771b422�(f42c801c269ced38359ecdd18cb8c18b8fd508072(ef0094c10d14ce7270befa287f257f305fe58639(eddec6b29868c2721fa96de49f7948c5097c1c1c�e(ed89318f75edea035acab5c670473f44daf6230e (e90949572c22eb2875172c3e62cdf7e5569cd121(e83db379aaab364fa832814ca7dc699df5cb1c28�n(e7bbfc7a99f705765226d5f85ecb9a2b28c360c4<(e6efa4380b4da03d366ea260018ffb6e9a09331a\b(e6948cd688fa1695ca31484a0517195ca46fe426j�(e5c8356a9d9c547981f5eb5ae395aa555f3f28b8�(e584d0d0cc9e4a53d3536e819630b1d0d0c9bb61de(e4d70f73ada4904646c6baee146eba34b5b0fe48
!(e3d4fe8ad1e5f16d73bb3c97e6a06329b70efaac_w(e2d2ea815c8b5c9eb3f78de777d084533040457f2�(e12a2aea5ccc0c4afa83e67d2d2b517a7dd2a42cf8(e077affe3807fdaad7d1ded48c215846711e6409��(dfe123b6d0250ef7915ec8cd606cb190bd6a3d6fRi(df84848ee16bbe742455c99a9dec24d88eed2fe5
�l(de58d669bd66a96c65e9d2dbb3976669d9728fafa6(ddfc8e29d23472004f473989e3b2313592908ec7�8(dc870ca510b4fbbd02da073ca987694c10638726�(dbfe0fd4d9bf766164292cda75143c0af7003403� (db2cc805f052664553f2034dda33f8b9a7635191i�(d924b831b95822ac0f9a8ccd49d58665754ee0cb�(d86c2995499c7cc7f42267b12a290191b28df34a�(d23bab2be15edd8458777313641a452e3327c822�x�������������(H�������XD�%�
��������������/��$?����������������/�0�.��t temporarily to build new GDBM- Correct perl-CGI list of Provides
- Make tests optional
- Correct perl-ExtUtils-ParseXS Provides
- Correct perl-Locale-Codes Provides
- Correct perl-Module-CoreList version
- Automate perl-Test-Simple-tests Requires version- Make gdbm support optional to bootstrap with new gdbm
- Split Carp into standalone sub-package to dual-live with newer versions
  (bug #736768)- Split Locale::Codes into standalone sub-package to dual-live with newer
  versions (bug #717863)- perl needs to own vendorarch/auto directory- Move xsubpp to ExtUtils::ParseXS (#728393)- fix Compress-Raw-Bzip2 pacakging
- ensure that we never bundle bzip2 or zlib- remove from provides MODULE_COMPAT 5.12.*- Have perl-Module-Build explicitly require perl(CPAN::Meta) >= 2.110420,
  needed for creation of MYMETA files by Build.PL; the dual-life version of
  the package already has this dependency- Temporarily provide 5.12.* MODULE_COMPAT- fix escaping of the __provides_exclude_from macro- Parse-CPAN-Meta explicitly requires CPAN::Meta::YAML and JSON::PP
- Exclude CPAN::Meta* from CPAN sub-package
- Don't try to normalize CPAN-Meta, JSON-PP, and Parse-CPAN-Meta versions;
  their dual-life packages aren't and have much higher numbers already- update macros -> add %perl_bootstrap 1 and example for readability
- add into Module::Build dependency on perl-devel (contains macros.perl)
- create new sub-package macros, because we need macros in minimal buildroot- remove from macros BSD, because there exists BSD::Resources- remove old MODULE_COMPATs- move ptargrep to Archive-Tar sub-package
- fix version numbers in last two changelog entries- add provide for perl(:MODULE_COMPAT_5.14.1)- update to 5.14.1 - no new modules, just serious bugfixes and doc
- switch off fork test, which is failing only on koji- try to update to latest ExtUtils::MakeMaker, no luck -> rebuild with current 
  version, fix bug RT#67618 in modules- filter even Mac:: requires, polish filter again for correct installation
- add sub-package Compress-Raw-Bzip2, solve Bzip2 conflicts after install
- and add IO::Uncompress::Bunzip2 correctly into IO-Compress- Perl 5.14 mass rebuild, bump release, remove releases in subpackages- Perl 5.14 mass rebuild- Perl 5.14 mass rebuild- add new sub-packages, remove BR in them- arm can't do parallel builds
- add require EE::MM into IPC::Cmd 711486- test build of released 5.14.0
- remove Class::ISA from sub-packages
- patches 8+ are part of new release
- remove vendorarch/auto/Compress/Zlib- add provides UNIVERSAL and DB back into perl- Remove rpath-make patch because we use --enable-new-dtags linker option- 692900 - lc launders tainted flag, RT #87336- Cwd.so go to the PathTools sub-package- sub-package Path-Tools- sub-package Scalar-List-Utils- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Document ExtUtils::ParseXS upgrade in local patch tracking- update ExtUtils::ParseXS to 2.2206 (current) to fix Wx build- Make %global perl_default_filter lazy
- Do not hard-code tapsetdir path- added systemtap tapset to make use of systemtap-sdt-devel
- added an example systemtap script- stable update 5.12.3
- add COMPAT- 463773 revert change. txt files are needed for example by UCD::Unicode,
 PDF::API2,...- required systemtap-sdt-devel on request in 661553- create sub-package for CGI 3.49- Sub-package perl-Class-ISA (bug #651317)- Make perl(ExtUtils::ParseXS) version 4 digits long (bug #650882)- 643447 fix redefinition of constant C in h2ph (visible in git send mail,
  XML::Twig test suite)
- remove ifdef for s390- Package Test-Simple tests to dual-live with standalone package (bug #640752)- remove removal of NDBM- Consolidate Requires filtering
- Consolidate libperl.so* Provides- filter useless requires, provide libperl.so- Reformat perl-threads description
- Fix threads directories ownership- sub-package threads- add vendor path, clean paths in Configure in spec file
- create sub-package threads-shared- Do not leak when destroying thread (RT #77352, �x��������������7�������XE�$�
���������2X�$"����������������2X1X3X�kVf�kVf�kVf�a{f�a{f�a{f�a{f�kUf�kUf�a{f�kSf�kSf�kUf�kSf�kUf�kUf�kUf�kUf�kUf�kSf�kSf�kSf�kV\�>f�kOf�kOf�kOf�kOf�kOf�kOf�kOf�kOf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kPf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kTf�kTf�kTf�kTf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kSf�kTf�kTf�kTf�kTf�kSf�kSf�kS7237d8d48517c7788589ba5a78ec41d28da0f0ae2f9cf06f68b2de154c2334162e3dd2101650ec2bfe3e0fef81bd877ad59b1c4d8e8ffadc7eeb37ced28b95bf42a509cd97af6844a4c2ea6a9c46c74101c035b66fccd2c82d80685d33dfd9090012a2b05a1bb570683c73bd93b1c8d18def90386f964f0b3bec68a873d3c34731127cada5fdfeb251fadce57c5d3da4f9f1fd90a87035a752a415ca813062f9c4494f0417e87156a1d376e1714c4a57e537f037ba83b9058b38ed5390285ec8ec37c4ed3d2168d367d2bb07c44ea16df052e123908e83010d84aaa1bda1cedec7707e97067ae344b99a9b59845a4c7335c9ff4e470723bf2a213a67578777079b39bc7e3fb46bc916b23933ad742f11e58401b14755d3a5c991ce5718669586c340133060c163caf9e22f0624306bd528768e89b3d5faf7285f23d2bada9485cd798de962f2140e8189b5bfabbb33a71f85d9f0e85a8a5ed193b39c564b22e5140ccb630700c6a73c69f7641960641b6f0771547417c7a489f4a30a60ce65352b44389988147f5ca72fd3d538d9e77f8ddd928b342058c5ad773cdd7bfef3724468e635b62bb920b187d0d324962d04045675daf0b88c2453357b78123272200694c23dceb6c4d241c2debabf754d8584a3342b1adf360dc89cd1f66bb060af85f28a4469836efa201aaba1d675309339d464d0e1fb65a81ac959bb00e5b683833658ead4c06d0dfa49f25fa5b8dd848b25137bcba1cb9e0a98a0c1513b17d9875dd214f471ead7c35bd7d66a74ec51acdf633125b9ce1b7705ed9f8231d6919fa0d8340283c3a1afa8d789a6c7d06f2e06038fbf63e8eba5017bb552bebb37a560a3fc372d8c390bcd5c07e4ec8295841f8406ae7f5c7f7fa1f237a9b5228f204d8eff92f95aac4df6c8122bc1505f468f3a901e5a4cc08940e0ede193899453dfc06b750c6a6b92761d1b7349a890214f064c9fa8d65061f54b9de3db334318800f371cffec432e47cd1f49b1a4a68deaae5cbacb3e4a68a4a12ff2664e979ab9ea2d532fc002bdac2f516aef8ba706ae769da2fa8f88d4754c2c6a2355f66dd8fd85b190091277e96c72de14a3e8199dd3a201ccba2ad9b4bf39f35a8ea5ae62cb8ee98f2a64f5ecfb685d6f58f5f0bd7e00cce543fd10d15a335d4b97b3f7a44c28a6efcbe7a52bfb78f124664752d3c44ae9c31e7cee39a14bbae5af5eac5034a98a90bfe762799082b468e12c746515614049f9c354726be06d6bc7a5c4fbbec32d1a143461b3aeb73907ef2407534af97fe1d26568cf96aef52a6f534debd917a41e2e510b9b796f5a5e844a13cbb3d49f5e60af61776d341606b7e373eb42c7aa105ba563e6e43da382378148f60143cf34f345d86ca0bba4503f62fbb7733376f0a9e3309eec118e935f8f5e6ce138ba68c6d77f06f6b4f3762a9f8b188f9c6c3e0aafd6552352389df2c512fa75ccf8b583c338617840cbd0f75f209f7c449dab4ffff48100ef08157b160f032342f769e476ba3ecb3d97cd9cc41b5e8c78efc58d09c40447becd772c51ef02710a2de213b2a1ba528bca45366f100a0cfa3b6aaf0b0c37ee6277cd7f581ada4e75880c5646928ac1a0cd99cc85e4911f8ddd4c8354573d2d5a1d711f6fbc8e4a8364ea31c693e94b050880b5a3e443f63e9c7ae055d5be031b94f12a10520a1b44660c452e3d4f0c31777a582bf3eca46d9294d0ecf68e58eda9757b3d9116d883ddaec761b41b76e00f03a318e0b943a159e37eba3b5194c3a7131d62233a36dd781401f10e0ecb2867582db5eb95ed5c3ff452a534b8c4d115d9546ee437aa0d6c1ad740abb1784846a16329e5829e14e7bf4f97b96b017a2910e4bfc930ffed0342eb9274c1c2c0f91331e25e3b166c4bfb53bafa8f993b23e067cd16d9839ff43ca238b52da546a5152d8bb82194fe26fafcf3f790cce7ad18945b20a4d716cd27564e9108b61448c86218603e84ab374af20a1d9eb1fcda406aa8bf9f0a8f583101bba0af390afcce3a39009820b7a65cc9bb5e522293ac0d40e78de160cc7acbafd839fcb3526dd6a99ceabfbc6c4c8620993a34f1137a397949a45e6bd1e05ae089b18f30d1cfcde248f7a86f5f3c630e88bbc2f45aaa61afbdfba09903852b251fe0cd75c23db1c6f2938721a2f59f09dbef961e7cdfac3f5c01a793ae479aefdb1c47c73af405f8f17d13c1c4cf89c943c2aef1ae272a591a720c694ef808470aa7ff31740cc1bab8af333dc35d795466c51b993233d56d4bd019f2af6e5de94b33130ad0045935c03111ad478dbae0be40b240b3619aedc8b7aad9de695aea244f9891ffe26ef5a0c4d84b4aef37364844ecae307bf268bf935cf72377d7906fdfe92b3a6bd665dab5e5494be201eb355e2ae261ca5889daf70fdb16a0bf59489�x�������������'�������XF�%�
������3�������!�$�����������������!�!�!�	directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e0b12d7ea2fd7cae12140a00da756abe0c14597f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2622685f0db1f52fc83bfea6f0f78f27bafb41e, strippedPerl5 module source textUTF-8 Unicode textASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)HTML document, UTF-8 Unicode textPerl5 module source, ASCII text!"#$�x���������������������XG�$�
���������<������4X�$$����������������4X3X5X�900bc5aa5f0846598c744a1aec7dcc3fc58bc431d0a582d51876344e8d7056fd7d7544c2815887e098f37233efb5f31874af404c9ce2e87eb7b32cc029540a36ad9621275ce530e2ec82dd42643619fce6ed125096e6ec92d3746ae1d92160bc560a79864f8edff255b29562d1e7ba493bfcf2fcd622ff9e0453105afb2d0aaca2824edcf0d05d87da5ce16702d6de58ccaf2cea86c7eb5b29db6b70314bd7ac89a10d65c99e451815ba7733d6148ab7bd978e0c18fceb4077cfbd203a2195ce19ae443c76c086389fdb5d73fca57d9da34ab9801abc1811ae255c39c861e54aa8c5c21f0a568f5db268d6f6f1c47d63c3266d9878f337e9af2cddf451ea0177c757640eaa230310baf9c37bbcfd49b5d4a04d4d3c70b0293b5c865fc2d4d5724a0d0d4448fa28a8b8fcee336fc20baf1a2fb5974dd9917dbb59f4d6ebb97b18d326f35e353781939535de08b60cee46edb6868964e3b7458bc9229e8ed615c4ba27737d85dbcebbb3d3a7f1f303986a88b8aecbf9060eff47e43619dbe38a24dad639784ed8af2de6786bc5b495f4274d9457c2331b41e99d79cd233a204a4c20a414b4a26c04b11a364ff9de90d6a4e9ccc57d3557bebb5b322eb71fecc86dfb6b59b7ba7d43e8622769c85c5c5556b19e14b8a14d8da245f03a787ef2ea82d16c8c14010cc375392ac14e538c3c4fe90c708ebe44251c7eedbd62214ff8ac804534426f242a01719d3407b570359546dd3dc3419dc6557ecc2647b5ab611b8b6fa1d131aa6b44119868eb4bc98a8b9ef19398../../../../usr/sbin/restorecon_xattr../../../../usr/bin/secon../../../../usr/bin/semodule_package../../../../usr/bin/semodule_link../../../../usr/sbin/setsebool../../../../usr/sbin/setfiles../../../../usr/sbin/load_policy../../../../usr/bin/semodule_unpackage../../../../usr/bin/semodule_expand../../../../usr/sbin/sestatus../../../../usr/sbin/semodule../../../../usr/libexec/selinux/hll/ppsemodulesetfiles�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpolicycoreutils-2.9-26.el8_10.src.rpm�����������������x��������������������XH�%�
`��K+��$;����������������+�,�*��=>?ABCDEFHIJKMNPQSTUVWXYZ\]_`abdeghjklmnoqrstvwyz|}~��������������������������������������������������������������������}~�������������3456789:;<=>KLOPQefghijklmnopqrstuvwxyz{|}~��������������������
()*/012HIJKLMZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������������������������������������������������	

 !"#$'()*+,CDEFGJKLMNOPQRSTUVWX[\]^_`abcdefghijklmnopqrstuvwz{|}~��������������������������������������������������;BCHIJKLMNcde�����	

'()./256789:;xy��������	

vwz{���x������� ��������X%�%�
p������������V�$����������������VVV�
		

	
	RRRRRRRRRRRYRRRRRRRRRRRYPPR'RIPRR!R'RCRIRPPRR R"RIP	RR R#RIP
RR%RIPRIRORPPR%P!R'R>RIP%R>RIRPP'RR>RIRPP,R#R'R:R>RIRPP.RR#R'RIRPRQP/RR'RIRPP4RR#R'R>RIRPP7R:R>RIRPPDRR#PER:R>RIRPPFRR#R'R>RIRJPGPHPIPJR'R+R:R>RIRPPLR>RIPMR>RIRPPNR>POR>PQR'R:R>RIRPPVR#R'RIPgR>RIPyR>PzR>RIRRRRRRRYR�x�����8��������X>o$�
��������,��$v��������������������pace unnecessarily
- module-setup.sh: don't source $dracutfunctions
- logger: source the logger file individually
- dracut-module-setup.sh: enable ForwardToConsole=yes in fadump mode- Always include watchdog-modules
- mkdumprd: Ensure kdumpbase is added
- Move watchdog detect and install code to module-setup.sh
- Add a helper to omit non-mandatory dracut module
- Move some dracut module dependencies checks to module-setup.sh
- Set watchdog's pretimeout to zero in kdump kernel
- kdump-lib.sh: Use a more generic helper to detect omitted dracut module
- Fix the watchdog drivers detection code
- Add a helper for detecting watchdog drivers
- Remove a redundant nfs check
- kdumpctl: split the driver detection from fs dection function
- kdump.service: use ConditionKernelCommandLine=crashkernel
- Revert "Append both nofail and x-systemd.before to kdump mount target"
- Revert "Don's try to restart dracut-initqueue if it's already failed"
- Fix dump_fs mount point detection and fallback mount
- kdump.conf: Update doc about core_collector for ssh target
- Save the final failure information to log file if saving vmcore failed
- Doc: Improve the kdump sysconfig document
- kdumpctl: fix a variable expansion in check_fence_kdump_config()
- Fedora 33 rhpkg build bug- makedumpfile: add support for ARMv8.2 LVA 52 bits- Doc: improve mkdumprd man page- Rework on dracut-module-setup.sh: Use systemctl call to replace ln_r- dracut-module-setup.sh: Use systemctl call to replace ln_r- Don's try to restart dracut-initqueue if it's already failed
- fadump-howto: update about 'nocma' and 'off' options for 'fadump=' parameter
- dracut-module-setup.sh: use auto6 for ipv6
- module-setup.sh: enable vlan on team interface
- Fix rootfs detection in dump_fs
- Remove RHEL-only patch: kexec-tools-2.0.18-makedumpfile-arm64-Add-support-for-ARMv8.2-LVA-52-bi.patch
- Rebase to makedumpfile-1.6.8 (step1)- Doc: improve the usage documentation of the logger
- Update the kdump sysconfig
- Capitalize the configuration name of log level
- Add the rd.kdumploglvl option to control log level in the second kernel
- Appropriately converts logger numeric level to syslog log level
- Remove unused log levels for kdump logger
- Add sanity checks for the log levels
- Add code comments to help better understanding
- Doc: add a documentation for the usage of logger
- Improve debugging in the kdump kernel
- kdumpctl: add the '-d' option to enable the kexec loading debugging messages
- kdump.sysconfig: add the kdump logger configurations
- enable the logger for kdump
- introduce the kdump logger from the dracut- arm64: Enable 'kexec_file_load' by default
- Fix, Add a kernel install hook to clean up kdump initramfs- module-setup.sh: Instead of drop journalctl log, just don't read kmsg
- s390x: enable the kexec file load by default
- increase makdumpfile default message level to 7
- Rework check_config and warn on any duplicated option
- kdumpctl: Error out if path is set more than once.
- Don't drop journalctl content if failure action is "shell"
- dracut-module-install: Move systemd conf install code to a function
- kdump-lib.sh: Remove is_atomic
- Refactor kernel image and initrd detection code
- early-kdump: Use consistent symbol link for kernel and initramfs
- kdump-lib: strip grub device from kdump_bootdir
- kdumpctl: fix driver change detection on latest Fedora
- Revert "kdump-lib: disable efifb if hyperv_fb is in use"
- kdump-lib.sh: detect secure boot on s390
- Add a kernel install hook to clean up kdump initramfs- kdump-lib: disable efifb if hyperv_fb is in use- sadump, kaslr: fix failure of calculating kaslr_offset due to an sadump format restriction- kdumpctl: exit if either pre.d or post.d is missing- ppc64/kdump: use kexec_file_load when secureboot is enabled
- kdump_pre: make notes more precise
- dracut-kdump.sh: exit shell when machine reboot
- kdump.conf: fix a grammar issue
- kdumpctl: detect modification of scripts by its directory's timestamp
- module-setup.sh: suppress false alarm
- kexec-tools.spec: make the existence of p�x�������������p�������XK�%�
���������������!�$�����������������!�!�!�%&	PR	RRR
RRRRRRRRRR
RRRRRRRRRRRRRRRP
RRPPPRPPutf-847889973a68c85c49b3591062ac45e9141e379d82f5daea417cefa9e4961da2d?���0��3!�^���P,��*����%�h�>w
	*����%�ݿ�i<������W���S����Um�HP�e��މ���� ~�3� �"NDd�e��kF=f��]}�����d	x�?�#~]3X�x��`I�ƾh���̵��P��4(�	)q��O�jPX&Ad��3�nmJ(9D�bK�����~�V��t�����	���B�0M�V�B�<~����j��A�G�j���B��
��e��,wـI��֨���KݍI'k �����QՎ��CT�w%��@���+�R=�lH~�^;3x�c�4wf7��Ҝ?������
�~�(>r�?tǔ�H~��1"�u	T��#�@A"Ė�A�;��<�z�RȦ�W^Xu<�N*	�k��g��D�@H|f�Hm:�,y��(pd"5�'��7�o�����i�#�N��;Dl�*7�6�b
6��_=�W�w{_��b|E,��Kn
/��Nh�a���8�yX,+�b�y%"	G�'8�O�C����3�_at��o뗲�2�Јx���������������������XL�%�
��8�����o!�$����������������o!n!p!�98725220364f8ad92896db57954e47c60186205f594791cfa614fa446cfbd749cb80f143148a24ea8618619bd9ba374117201d9b7ea3ed7ac68d0706eb5746e6189f816d4d074d2206ab40a1de8dbe8d51b4bee6fecd545e1a7eb18e5af55605b76a43ba94b841d3546df264088bd407820560521a22e05b4baf8b68ab2d79e39956b466bebb13de754c00d6715cefe3207b61967b9f4f2be80275c07dfb687d3687f69bb6a81d7d36a62df352255281420f6bcca86ebc4d5f47700dc9bffd0b973d5dc56e0e8aec04688ba377fb4eab196d9648af8102aa0acf54dc88225ad7a037c4f56014700ca07dda13556b6331ca018946149d8e9c09e299cb02212ef59e46b1d5d61c17ccf3c95bca6ff2c7d935a1e5d5918cbc37fb68e25221b81754f852179cecc47e3f636cf7b1a4b0df21c1f573866a225ed89733d3e524a413a7b7cf34e46360789a48c9a97cdcc98c094e58212b7b09a9c7c1022fd99d7a46e91e609c75d3e8bd0b2587460dac6ae4eac1bfad7bea0b80f38fa0c61bed9eeac2a73c14cc998af877b5083a094a2fad4ef21447f657dfc3b3aec86555c3929a0eae913af3e3939192d1df75524bb68d51eaedfd07e037c3003c1e55d3ff7d12f009c0e805764588991867460a489ac25bb767a5e4a65eedf34fef02f89990a075b69acbb1828b0fab5373e1f1ca7e1a56f6116fb05a41bf605337556e6ab783550b9d6be3a42f543b6dfb92b32ef4e25019e93fd51d4b14fea6f8e805b13b98636c3ba655c88be46dff6d81de0145d82bafca3ecee8e9b2904ef1667ba6110a846ed4e05d0f9710ff1fcabfe49827682ef7d05640ca8b9329d003c99d2ea63de24ba61a39adc2ba54eae4f246a674bb63b6ad0f1636f81e3df5e6003e017c3c9a794624dae79dc45e0b786b1f6629abcc4ee01c6b0eec0b138269a0fa5f919da45d1b51ac81b0c23d43b9a22e7736338dda57699c16adbdcceb78f9edd006b97025f12ae12a3e0907c1fcf54d23386cd3c1680105108a70f59d32b3a9589dff81582331ca4e0f52eb2fe914f27c91395679c9bf5fb4297167e154a750a7f8551315fa0bc88b7e4406d1d6dc1bca67619513006b53549c4fae77b7ba006170169fb589bd901a530917e85655276ecf1c02b20a264dc1a9e5aba038af5b3d95cb04903e62d789b1547947155bea3f067ffc2f8929f43268da2b6d15d4dce7a7cee8300feaff3b47f9146023fbee052bda0b8bede709598ce65d0197f451c33336f3522c4cd57769a111eda3714299fbc1b9cb711cf12d2c5e893fda44e1d7e064e281f411fa3dedb08e299cc1b99bc30b107d8289fda392c9d41059b654d40959d0d28ff5aeec1a2ffb6f39ada14aca04618127bf6d986d9cf2f599658b8e0f19028d73daf178555b21b44323dd41e08f4a0b4e209046e31fed61ad56dd7fce8cd057a5d0cbf93b8117fdf102b8696e21b1601ad7add1ed9379d41a5245ec0b3aaf36fe448789e2b61a27039ed3abf1e00ba33552fe733c703e3ca7d08165d55fdd884ba009c813f60dfe5184e0a1a22d35bc3e073f632f2af2881e9ee5d1325eb971cdd4ace9e45b90b037787a6b04cda6c4f6fa86769781ae4c8ba68882f55ef5a529a2fa767e4d41364c57c3b051284f4793210bdcd26fe0c58ba5ed2a188e84073c4a712dc77307c7a26211e675875323383f45e9f65394b6920bdba1db5f3aa881316ac7312d7bf932ed67482e3b643f40508ac4bbffb5bd9e53be190b791f8d3e3165d13cae81a96a448b02d1e5d918ef0285292fabbf9c32d196549788d28fababee6d6817986ff0b32070ee93ef726851c97325ea0ccc5cae1c402224ca1dcdae833d4ec7ed09f1a6994f88a6c3d49a3ad2c3259a6c4154064c2d642d48cc21a37f9d2f752d9d5e732149f9d34dd6371e837007f821dc02c563993d374017bca5ac3cabec7adb83f7b5a2dd4944f8724142d98fe7cc78595aa8d5019480d7f988d984924d36fda6acde92870f910fe6d64ed1f423ed1b91e9c364a45e17f3625c6d5d23e43476e0be24985c1ce73a76b060de5883a6eb061e489048635492973cd41714e9b12259691b528873b2fe6eb474d0818d8d1885ad4254841af12500add234763193d3835b496460fcfb064782761caf443d0bddffbbb7caf9c5d3a4c147cea9759bebb57075acc136c10e264f80c68c2505813fe4fbc5f45089bd101a12d3e23d71e4302a2f00e551fb17bdee2b0fd1b0f0d0ffd544d3a7b5e3be1c5b9c31ab2664bd977f0dc8d8dea43fb70cc3db8001f80941bce5992b651412bd684377cffacfd1ec6cf6d47778873e98c341bb54ce82d29fb326508ef606ea91225f661d8a6d7783371cb003bba513283459172d21ce19cb9acc4fe4b2da487fb465dc4c821e74970ecf607b02426c3ce40c37ac1441d51df391c4d7dfde4ee27af9cb7cc0b8f7cb28277ce0f82ccd675a3f4cc20f89b3cccad00edb0109f41f153e99466154bf12e3f57d87e557be10fa8b7d39a766f790e24eda7ecdb5ae94413d4ef5a85f18dbaaa82a2e8d5f30f93dd7194fc52bf0f847835553331768dbbd6ac9a0b0447ac1b6387d126ff1755a978f0e2a3cf56ff8c58f453dce867f491635b1d732377442a067d6e519a07464c603ba7c9b9bcd96a9a7adec89b83455149dd07fa43977588a591988a4ebe3a7c159a07b7308f3089085791714f700df1a68de73bf459af5b3eae294b141166d37e3cc3afc96d100fb6df22e7984ed0d2a7c6038d6a44c8a32e6ba20068c0eabd3dc3cc8cd2fe82b5f0fe76092f440457672926d71bf4ed5d652c388f4163825�x�������������`��������XM-$�
pM
�8���������$n�����������������������m verify subcommand
    resolves: rhbz#1212836
  - do not install tuned kernel command line to rescue kernels
    resolves: rhbz#1223864
  - add variables support
    resolves: rhbz#1225124
  - add built-in support for unit conversion into tuned
    resolves: rhbz#1225135
  - fix vm.max_map_count setting in sap-netweaver profile
    resolves: rhbz#1228562
  - add tuned profile for RHEL-RT
    resolves: rhbz#1228801
  - plugin_scheduler: added support for runtime tuning of processes
    resolves: rhbz#1148546
  - add support for changing elevators on xvd* devices (Amazon EC2)
    resolves: rhbz#1170152
  - add workaround to be run after systemd-sysctl
    resolves: rhbz#1189263
  - do not change settings of transparent hugepages if set in kernel cmdline
    resolves: rhbz#1189868
  - add tuned profiles for RHEL-NFV
    resolves: rhbz#1228803
  - plugin_bootloader: apply $tuned_params to existing kernels
    resolves: rhbz#1233004- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- fixed configobj class imports
  resolves: rhbz#1217327- fixed bash completion
  resolves: rhbz#1207668- fixed KeyError exception in powertop2tuned- remove 00_tuned grub2 template upon tuned uninstall
  resolves: rhbz#1178310- new-release
  - fixed return code of tuned grub template
    resolves: rhbz#1151768
  - plugin_bootloader: fix for multiple parameters on command line
    related: rhbz#1148711
  - tuned-adm: fixed traceback on "tuned-adm list"
    resolves: rhbz#1149162
  - plugin_bootloader is automatically disabled if grub2 is not found
    resolves: rhbz#1150047
  - plugin_disk: set_spindown and set_APM made independent
    resolves: rhbz#976725- new-release
  resolves: rhbz#1093883
  - fixed traceback if profile cannot be loaded
    related: rhbz#953128
  - powertop2tuned: fixed traceback if rewriting file instead of dir
    resolves: rhbz#963441
  - throughput-performance: altered dirty ratios for better performance
    resolves: rhbz#1043533
  - latency-performance: leaving THP on its default
    resolves: rhbz#1064510
  - used throughput-performance profile on server by default
    resolves: rhbz#1063481
  - network-latency: added new profile
    resolves: rhbz#1052418
  - network-throughput: added new profile
    resolves: rhbz#1052421
  - recommend.conf: fixed config file
    resolves: rhbz#1069123
  - systemd: added cpupower.service conflict
    resolves: rhbz#1073392
  - balanced: used medium_power ALPM policy
  - added support for >, < assignment modifiers in tuned.conf
  - handled root block devices
  - balanced: used conservative CPU governor
    resolves: rhbz#1124125
  - plugins: added selinux plugin
  - plugin_net: added nf_conntrack_hashsize parameter
  - profiles: added atomic-host profile
    resolves: rhbz#1091977
  - profiles: added atomic-guest profile
    resolves: rhbz#1091979
  - moved profile autodetection from post install script to tuned daemon
    resolves: rhbz#1144067
  - profiles: included sap-hana and sap-hana-vmware profiles
  - man: structured profiles manual pages according to sub-packages
  - added missing hdparm dependency
    resolves: rhbz#1144858
  - improved error handling of switch_profile
    resolves: rhbz#1068699
  - tuned-adm: active: detect whether tuned deamon is running
    related: rhbz#1068699
  - removed active_profile from RPM verification
    resolves: rhbz#1104126
  - plugin_disk: readahead value can be now specified in sectors
    resolves: rhbz#1127127
  - plugins: added bootloader plugin
    resolves: rhbz#1044111
  - plugin_disk: added error counter to hdparm calls
  - plugins: added scheduler plugin
    resolves: rhbz#1100826
  - added tuned-gui- added kernel-tools requirement
  resolves: rhbz#1072981- fixed race condition in the start/stop code
  resolves: rhbz#1028119
- improved tuned responsiveness
  resolves: rhbz#1028122- new-release
  resolves: rhbz#1020743
  - audio plugin: fixed audio settings in standard profiles
    resolves: rhbz#1019805
  - video plugin: fixed tunings
  - daemon: fixed crash if preset profile is not�x�����@U
x��������XN�%�
X�h���$U��������������������ttps://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- apply patch to workaround msgfmt bug that counts warnings as errors- update to 0.19 release
- remove upstreamed -Wformat-security patch- update to 0.18.3.2 release
- apply patch to suppress -Wformat-security warnings in gnulib-tests- update to 0.18.3.1 release- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- update to 0.18.3 release- add a man page for msghack
- fix bogus date in %changelog- update to 0.18.2.1 release (not really necessary though)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- update to 0.18.2 release (based on the spec patch by Jens Petersen)- move gettextize to the devel subpackage with its source data files
- update msghack to GPL v3- patch gnulib since glibc and C11 dropped gets- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- add upstream patch from debian to fix xgettext segfault in
  remember_a_message_plural (#826138)- base package now provides bundled(gnulib) to make it clear that
  gettext is built with bundled gnulib (#821757)- add filesystem guard- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- rebuild for gcc 4.7- correct the configure --with-pic option syntax (Gilles Espinasse)- add gettext-readlink-einval.patch to fix build on kernel >= 2.6.39 (#739188)
- add optional buildrequires suggested in the DEPENDENCIES file- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- remove internal libgettextlib.so and libgettextsrc.so (#650471)- fix license field of gettext-libs since libgettextpo is GPLv3+ (#640158)- subpackage archive.git.tar.gz to avoid multilib conflicts (#631733)
- update msghack.py header- merge autopoint subpackage into devel to simplify deps (#625325)
- have ABOUT-NLS only in the base package datadir- correct license tag from GPLv3 to GPLv3+
- subpackage autopoint which requires git (#574031)
- no longer require cvs (#606746)
- add bcond for git- update to 0.18.1.1 release (#591044)
- gettext-0.17-autopoint-CVS-441481.patch, gettext-0.17-long-long-int-m4.patch
  gettext-0.17-open-args.patch, and
  gettext-xgettext-python-unicode-surrogate-473946.patch are upstream
- move libintl.jar to lib subpackage to avoid multilib problems
  (reported by Jim Radford in #595922)
- disable java for now
- use chrpath to get us out of rpath hell instead of complicated libtool hacks
- enable git support- create emacs subpackages for po-mode.el (thanks for patch from
  Jonathan Underwood, #579452)
- provide emacs-po-mode
- move libgettextlib and libgettextsrc from base to libs subpackage
  (requested by Peter Robinson for blender, #579388)- fix FTBFS by removing openmp.m4 which conflicts with recent autoconf (#539211)
- cleanup gettext-0.17-rpathFix.patch
  - separate gl_AC_TYPE_LONG_LONG replacement to another patch
  - use trailing ':' for tests LD_LIBRARY_PATH
- run autogen.sh with --quick and --skip-gnulib- bring back autopoint requires cvs (#517361)
- requires info rather than /sbin/install-info
- drop install_info and remove_install_info macros- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- buildrequire automake (#507275)
- run autogen- move intl/ and po/ to base package for gettextize
  (reported by Serge Pavlovsky, #496902)- use bcond's for build switches- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add buildjava switch to allow turning off the java bits completely
- add buildcheck to allow turning off make check
- drop cvs requires for autopoint (Karl Lattimer, #469555)
- add upstream gettext-xgettext-python-unicode-surrogate-473946.patch by
  Bruno Haible to fix xgettext handling of utf16 surrogates in python (#473946)- Fix the build failure with koji.- Remove the gettext-libs docs, as they are talking about autoconf, libtool, 
  which are not directly related to the gettext-libs.
- Remove unused definition and trailing space.
- Fix the build failure with mock .- Fixed Bug 456666 msghack doesn't check for mandatory cmd line �x�������������P��������XO�%�
p�������������Q��$A����������������Q�P��K(t?�d����(�	,�	S�����������Z�	���������\�	��
!��0����
���
����220�@��L[Mp[T'[(T�8T��9[�:���BO�GO��H^D�Il��Xp��Yr��Zu�[u�\u��]�p�^���b��d�Ce�Hf�Kl�Mt�h�u��v�)w�x�x�y���p�t�z����6"
"6
$P$y�$�$��(hg(lh(pCperl-interpreter5.26.3423.el8_10Standalone executable Perl interpreterThis is a Perl interpreter as a standalone executable /usr/bin/perl
required for handling Perl scripts. It does not provide all the other Perl
modules or tools.

Install this package if you want to program in Perl or enable your system to
handle Perl scripts with /usr/bin/perl interpreter.

If your script requires some Perl modules, you can install them with
"perl(MODULE)" where "MODULE" is a name of required module. E.g. install
"perl(Test::More)" to make Test::More Perl module available.

If you need all the Perl modules that come with upstream Perl sources, so
called core modules, install perl package.

If you only need perl run-time as a shared library, i.e. Perl interpreter
embedded into another application, the only essential package is perl-libs.

Perl header files can be found in perl-devel package.

Perl utils like "splain" or "perlbug" can be found in perl-utils package.h�02x64-builder03.almalinux.org۴DAlmaLinuxAlmaLinux(GPL+ or Artistic) and (GPLv2+ or Artistic) and BSD and Public Domain and UCDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.perl.org/linuxx86_641�1�?8A325<097/5698A84+6F:31'0;7042419:+:371)07122/84)92'23<z��^06~�y��Ob��:3[bt^�	�p	O>N���X�/
�
�rHD�M���!9��\]���L]^_^�u�cOB!a�^HP�8n�ON�>N�N�_H��nH>@>�^��8�>0^�>0^pi���<��m��yl��
����>3����/ck�'
+����,N�N	��������w0%�m5|<&v�u�'s�
56H0TVt >	��	�	�/
�V�US
d?kc�N����iP��X-ѧ�
����8���*h�s��`���g��"�S�J���n��� G�l�����*�[-��$F��<#���ntrN�$��h1�N�l9�*�B��#���(��v�<}rf�x����������������������XP�%�
U
0�������t!�$d����������������t!s!u!�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-5.26.3-423.el8_10.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������libperl.so.5.26()(64bit)perl(:MODULE_COMPAT_5.26.0)perl(:MODULE_COMPAT_5.26.1)perl(:MODULE_COMPAT_5.26.2)perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(:WITH_64BIT)perl(:WITH_ITHREADS)perl(:WITH_LARGEFILES)perl(:WITH_PERLIO)perl(:WITH_THREADS)perl(XSLoader)perl(integer)perl(re)perl(strict)perl(unicore::Name)perl(utf8)perl(utf8_heavy.pl)perl(warnings)perl-libsperl-libs(x86-64)@@@@@@@@@@@@@@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libutil.so.1()(64bit)perl(Carp)perl(Encode)perl(Exporter)perl(XSLoader)perl(integer)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsX�x�������������0q�������XQ&�
X�x���$��������������������ute
  * repodata_lookup_num now works like the other lookup_num functions
- new functions:
  * selection_make_matchsolvable
  * selection_make_matchsolvablelist
  * pool_whatmatchessolvable
  * repodata_search_arrayelement
  * repodata_lookup_kv_uninternalized
  * repodata_search_uninternalized
  * repodata_translate_dir
- new repowriter interface to write solv files allowing better
  control over what gets written
- support for filtered file lists with a custom filter
- dropped support of (since a long time unused) REPOKEY_TYPE_U32
- selected bug fixes:
  * fix nasty off-by-one error in repo_write
  * do not autouninstall packages because of forcebest updates
  * fixed a couple of null pointer derefs and potential memory
    leaks
  * made disfavoring recommended packages work if strong recommends
    is enabled
  * no longer disable infarch rules when they don't conflict with
    the job
  * repo_add_rpmdb: do not copy bad solvables from the old solv file
  * fix cleandeps updates not updating all packages
- new features:
  * support rpm's new '^' version separator
  * support set/get_considered_list in bindings
  * new experimental SOLVER_FLAG_ONLY_NAMESPACE_RECOMMENDED flag
  * do favor evaluation before pruning allowing to (dis)favor
    specific package versions
  * bindings: support pool.matchsolvable(), pool.whatmatchessolvable()
    pool.best_solvables() and selection.matchsolvable()
  * experimental DISTTYPE_CONDA and REL_CONDA support- Backport patch to add support for modular updateinfoxml data- Backport patches for: Install of update of nss.x86_64 adds i686 into transaction (RhBug:1663136)- Backport patch: Fix memory leaks, memory access, not used values- Update to 0.6.35
- Backport patch: Make sure that targeted updates don't do reinstalls- Conditionalize the python2 subpackage- Update to 0.6.34- Update to 0.6.33- Update to 0.6.32- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 0.6.31- Use librpm to access rpm headers- Use librpm to access DB- Switch to %ldconfig_scriptlets- Disable librpm from accessing DB- Allow disabling python2 bindings- Switch to ninja-build- Update to latest git version
- Switch to use librpm for accessing headers / rpmdb- Update to latest snapshot- Better error message on DB_VERSION_MISMATCH errors- Update to 0.6.30- Band-aid for DB_VERSION_MISMATCH errors on glibc updates- Update to 0.6.29- Rebuilt after RPM update (№ 3)- Rebuilt for RPM soname bump- Rebuilt for RPM soname bump- Add support for REL_WITHOUT- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Backport patch for fixing yumobs- Update to 0.6.28- Backport few fixes for bindings- Update to 0.6.27- Update to latest snapshot- Enable AppData support (#1427171)- Update to latest git
- Switch to libxml2- Use %{__python3} as PYTHON3_EXECUTABLE- Update to 0.6.26- Update to 0.6.25- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.4- Rebuild for Python 3.6- Use upstream python build options- Update to 0.6.24- Typo fixes in spec: s/MULTI_SYMANTICS/MULTI_SEMANTICS/- Trivial fixes in spec- Enable suserepo on Fedora to enable making openSUSE containers with Zypper- Enable helixrepo on Fedora- Backport patch to fix dnf --debugsolver crash (RHBZ #1361831)- Update to 0.6.23- Backport couple of patches from upstream- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Update to 0.6.22
- Backport patch which will help to not autoremove needed packages
  (RHBZ #1227066, #1284349)- Enable deb/arch support for non-rhel distros- Modify enabled/disabled features- Update to 0.6.21- Backport patch to fix crashing on reading some repos (RHBZ #1318662)
- Backport patch to fix installing multilib packages with weak deps
  (RHBZ #1325471)- Update to 0.6.20- Reorganize spec file
- Enable helixrepo feature
- enable appdata feature- Apply 9 patches from upstream- Update to 0.6.19- Explicitly add rubypick and�x��������������`�������XR$%�
)�������d�$"�����������������d�d�d�onse_status.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_resp_find_status.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_VERSION_NUMBER.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_malloc.3ssl.gzSSL_CIPHER_get_name.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_fork_prepare.3ssl.gzOPENSSL_fork_prepare.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_instrument_bus.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_config.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_malloc.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_expect.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_expect.3ssl.gzOSSL_STORE_LOADER.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOpenSSL_add_all_algorithms.3ssl.gzOpenSSL_add_all_algorithms.3ssl.gzSSL_library_init.3ssl.gzOPENSSL_VERSION_NUMBER.3ssl.gzOPENSSL_VERSION_NUMBER.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzPEM_read_bio_ex.3ssl.gzPEM_read_bio_ex.3ssl.gzPEM_read_bio_ex.3ssl.gzPEM_bytes_read_bio.3ssl.gzPEM_read.3ssl.gzPEM_read.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3�x������������� P�������XS�%�
���������������*X�$:����������������*X+X)X��x��������������?�������XT%�
��������@[�d�$^�����������������d�d�d�'
z�U ""
��d%%'
��+"�����
&b0
�'.P$$�
�#�!)�!	�
�	��%�	s'	�
\	�		!!	�#%(}
8H�#########
**p*�":
K""	�"��<
�
�%%	s(�	A!!%%^
2
K"	�	"	+""#..
��""#$$	�
�'
(	u
�i�'%%'��
+"	=&"&&�&"�+*%%'
K'!!'%'%  '%%'"++""
�&
�'.'$$###	U@	�%Mf
��
�$!!!!!!!���""""b"""""
�""�"
�"""<
v	
%%%%%%  $$$$$$% N $$%$$%$%%   $w	�%%%%%%%%%%%	�%%%%%%%%%%%%%�%#################�#####	e�	�	�
��
K
�   e
� 	� �   $
O
�
�"  D
� 
�	E�x�������������/�������XU�$�
�!@O������e�$u����������������edf�891)- fix #214891 - add mount.conf and MTAB_LOCK_DIR= option- upgrade to 2.16
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.16/v2.16-ReleaseNotes
- enable built-in libuuid (replacement for the old uuid stuff from e2fsprogs)
- new commands switch_root, uuidgen and uuidd (subpackage)- upgrade to 2.15.1- set BuildRequires: e2fsprogs-devel
- add Requires: e2fsprogs-devel to libblkid-devel- upgrade to 2.15.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.15/v2.15-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.15/v2.15.1-rc1-ChangeLog 
- merged patches:
  util-linux-ng-2.14-login-remote.patch
  util-linux-ng-2.14-fdisk-4k-I.patch
  util-linux-ng-2.14-fdisk-4k-II.patch
  util-linux-ng-2.14-fdisk-4k-III.patch
  util-linux-ng-2.14-dmesg-r.patch
  util-linux-ng-2.14-flock-segfaults.patch
  util-linux-ng-2.14-renice-n.patch
- new commands: lscpu, ipcmk
- remove support for "managed" and "kudzu" mount options
- cleanup spec file
- enable built-in libblkid (replacement for the old blkid from e2fsprogs)- fix #490769 - post scriptlet failed (thanks to Dan Horak)- fix some nits in mount.tmpfs- fix #491175 - mount of tmpfs FSs fail at boot- fix #489672 - flock segfaults when file name is not given (upstream)
- fix #476964 - Mount /var/tmp with tmpfs creates denials
- fix #487227 - fdisk 4KiB hw sectors support (upstream)
- fix #477303 - renice doesn't support -n option (upstream)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add -r option to dmesg(1)- fix typo in spec file- upgrade to stable 2.14.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.14/v2.14.2-ReleaseNotes- fix #480413 - util-linux-ng doesn't include scriptreplay
- fix #479002 - remove dependency on ConsoleKit-libs
- upgrade to 2.14.2-rc2- upgrade to 2.14.2-rc1
- refresh old patches- fix #472502 - problem with fdisk and use +sectors for the end of partition- fix #465761 -  mount manpage is missing uid/gid mount options for tmpfs
- refresh util-linux-ng-2.14-mount-file_t.patch (fuzz=0)- remove obsolete pam-console support- upgrade to stable 2.14.1- upgrade to 2.14.1-rc1
- refresh old patches- update util-linux-ng-2.14-mount-file_t.patch to make
  the SELinux warning optional (verbose mode is required)- fix #390691 - mount should check selinux context on mount, and warn on file_t- upgrade to stable util-linux-ng release- upgrade to 2.14-rc3
- remove arch(8) (deprecated in favor of uname(1) or arch(1) from coreutils)
- add a new command ldattach(8)
- cfdisk(8) linked with libncursesw- fix audit log injection attack via login- fix location of the command raw(8)- fix 244383 - libblkid uses TYPE="swsuspend" for S1SUSPEND/S2SUSPEND- fix 439984 - backport mkswap -U- clean up sparc conditionals- Autorebuild for GCC 4.3- upgrade to new upstream release
- fix #427874 - util-linux-ng gets "excess command line argument" on update- update to upstream 2.13.1-rc2- Fix pam files so that pam_keyinit happens after pam_selinux.so- remove viwp and vigr (in favour of shadow-utils)- update to the latest upstream stable branch
  (commit: fda9d11739ee88c3b2f22a73f12ec019bd3b8335)- fix #354791 - blockdev command calls the blkpg ioctl with a wrong data structure- fix mount -L | -U segfault
- fix script die on SIGWINCH- update to the latest upstream stable branch- upgrade to stable util-linux-ng release- add release number to util-linux Provides and increment setarch Obsoletes
- fix #254114 - spec typo
- upgrade to floppy-0.16
- add BuildRequires: popt-devel- Obsolete a sufficiently high enough version of setarch- fix #253664 - util-linux-ng fails to build on sparc (patch by Dennis Gilmore)
- rebase to new GIT snapshot- fix obsoletes field- util-linux-ng includes setarch(1), define relevat Obsoletes+Provides- port "blockdev --rmpart" patch from util-linux
- use same Provides/Obsoletes setting like in util-linux- fix #252046 - review Request: util-linux-ng (util-linux replacement)- rebase to util-linux-ng (new util-linux upstream fork,
		based on util-linux �x���������������������XV�%�
��������@(������-��$=����������������-�.�,��PUTENV to ccflags (#508496)- #504386 update of Compress::Raw::Zlib 2.020- update File::Spec (PathTools) to 3.30- fix #221113, $! wrongly set when EOF is reached- do not use quotes in patchlevel.h; it breaks installation from cpan (#495183)- update CGI to 3.43, dropping upstreamed perl-CGI-escape.patch- fix CGI::escape for all strings (#472571)
- perl-CGI-t-util-58.patch: Do not distort lib/CGI/t/util-58.t
  http://rt.perl.org/rt3/Ticket/Display.html?id=64502- Move the gargantuan Changes* collection to -devel (#492605)- update module autodie- update Digest::SHA (fixes 489221)- drop 26_fix_pod2man_upgrade (don't need it)
- fix typo in %define ExtUtils_CBuilder_version- apply Change 34507: Fix memory leak in single-char character class optimization
- Reorder @INC, based on b9ba2fadb18b54e35e5de54f945111a56cbcb249
- fix Archive::Extract to fix test failure caused by tar >= 1.21
- Merge useful Debian patches- remove compatibility obsolete sitelib directories
- use a better BuildRoot
- drop a redundant mkdir in %install
- call patchlevel.h only once; rm patchlevel.bak
- update modules Sys::Syslog, Module::Load::Conditional, Module::CoreList,
  Test::Harness, Test::Simple, CGI.pm (dropping the upstreamed patch),
  File::Path (that includes our perl-5.10.0-CVE-2008-2827.patch),
  constant, Pod::Simple, Archive::Tar, Archive::Extract, File::Fetch,
  File::Temp, IPC::Cmd, Time::HiRes, Module::Build, ExtUtils::CBuilder
- standardize the patches for updating embedded modules
- work around a bug in Module::Build tests bu setting TMPDIR to a directory
  inside the source tree- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add /usr/lib/perl5/site_perl to otherlibs (bz 484053)- build sparc64 without _smp_mflags- limit sparc builds to -j12- update IPC::Cmd to v 0.42- 455410 http://rt.perl.org/rt3/Public/Bug/Display.html?id=54934
  Attempt to free unreferenced scalar fiddling with the symbol table
  Keep the refcount of the globs generated by PerlIO::via balanced.- add missing XHTML.pm into Pod::Simple- 295021 CVE-2007-4829 perl-Archive-Tar directory traversal flaws
- add another source for binary files, which test untaring links- to fix Fedora bz 473223, which is really perl bug #54186 (http://rt.perl.org/rt3//Public/Bug/Display.html?id=54186)
  we apply Changes 33640, 33881, 33896, 33897- change summary according to RFC fix summary discussion at fedora-devel :)- update File::Temp to 0.20- Include fix for rt#52740 to fix a crash when using Devel::Symdump and
  Compress::Zlib together- rt#33242, rhbz#459918. Segfault after reblessing objects in Storable.
- rhbz#465728 upgrade Simple::Pod to 3.07- also preserve the timestamp of AUTHORS; move the fix to the recode
  function, which is where the stamps go wrong- give Changes*.gz the same datetime to avoid multilib conflict- remove Tar.pm from Archive-Extract
- fix version of Test::Simple in spec
- update Test::Simple
- update Archive::Tar to 1.38- 462444 update Test::Simple to 0.80- move libnet to the right directory, along Net/Config.pm- do not create directory .../%{version}/auto- 457867 remove required IPC::Run from CPANPLUS - needed only by win32
- 457771 add path- CGI.pm bug in exists() on tied param hash (#457085)
- move the enc2xs templates (../Encode/*.e2x) to -devel, (#456534)- 455933 update to CGI-3.38
- fix fuzz problems (patch6)
- 217833 pos() function handle unicode characters correct- rebuild for new db4 4.7- remove db4 require, it is handled automatically- 453646 use -DPERL_USE_SAFE_PUTENV. Without fail some modules f.e. readline.- 451078 update Test::Harness to 3.12 for more testing. Removed verbose 
test, new Test::Harness has possibly verbose output, but updated package
has a lot of features f.e. TAP::Harness. Carefully watched all new bugs 
related to tests!- bump the release number, so that it is not smaller than in F-9- CVE-2008-2827 perl: insecure use of chmod in rmtree- 447371 wrong access permission rt49003- make config parameter list consistent for 32bit and 64bit platforms,
  ad�x��������������
�������X#%�
x������0��d�����$T�����������������d�d�d�ec09c45c2634673d1b9b1a79adbd6ec32bdff94287308e2bb27408e537f4e527987e296a26fc1c06f4f896baa5f457b7e67f94957d176eed469b0fe602bd9d73a8b1a6f979fc0f4df81098a21d3b2d2a3cdfc9013afde044310e3e03b84018d7c54e6f19c3230af063f4dbc8523f1450528a4af15a97a0a1ff3fb3ba380ec7330c122ae2b3174df95ddecea65ff661a6152cd0192529dd1411ef3f62a1cfbbc3434b56c4671080326aeb8c3d007dab7d2c3621d5146c11aba347158b80c73a57b1919601ff8c04f2dc9c62dbd130ef2d3ae39bb0fcdf25bc9e6eaf327a433419f93a8ea3142c76be6f38d437ae84e9fd3ef6a2eda88cd3267a3760adfe911746b1b1c46049ff346cfa35936478dcbb06b78cf92a6a3e54949a19a2cee8c0870c37caa77734d86e3496339e57fc318c3a6b62881a6e33fcaa504f3cb9d33a90589e6e7d9f4b23b6cb24e4229ac30fb81d9677080c2b2a8ef4d552b9c8cf32d62036d0c35d03fe7f7ddaaffe3caeafcf984ec16e4db7ed19d3e202e9d7ba6833ee5712125d1ce8f7b52437a752e40c2f4793276859a8228c0de71d35c3e0d91c6016f3c1ba70683b92fde55500ec334777defb6486c41b0a9c4e402aa29597c129c6c9a493d7e5d3af123d96040d87c4e54fc5e41aec450832cb32a634d6b7340727a0480f351823b669f55cd3989c065d373c8cf6ff8745b8356f61d5ffcdc3505c9bb9168a6fad434dd9d9a49ad630b9ae9216bd665b11051e04a709bcecee11e9fbddab20f78a018009e6a2daf287ff5df00679298b137fe9996d9386816fc66b1431d960966f5b3b04fd2760e7391d6a298441e4d571c2303150870c12379cc0a7f168cbff8e08828da72dc0e87773bc6c3bd14c4b57506339b61fa585e01e2c33b07372f559d03e9c7437a2985ccd065d24873e2069b0c0c566c878ec2b9196898bbc45ff2ab00204f93a6f20c974225510f29097ad69a6eeebcdfe6fc023442f524349685d13d50854ad773b12b8c7a153d72d615ab27dd4a3d609c238954a1df23f52362d6e5fa78df2c7a5a2ad6ef9536e489f0a23295efa0cab8c74b93c10a9e83abc17ced3a8021af7506f39a0fadab07b5db2d4faebcf68b67864e95b61605f26f15e4f8f05df45c6c8527107871f06293a6213afdae148647a29b483f9f6faf8e1b4dbaebc72203a3ceb7b0fe8c6a395b18fbbc0a6dd141657665dabb37f4f0bd853539d93c64cb8adf37fd9552dc9fad215cc8f47a991c46bf2373dfb10dc5cbc626cf2fe86b9b1c82373d799bdd6be13eedaf7d4540d550bb6745481ac56b67f450d09033e813bf8f6a5f2025e90d5eb539eab1ad5e32382a08bf9a866dec1b7deb66b4077690cee0f6caf91eb00136c5eed4e8d943d06e50e2dd5df6a0db219091cd1c6768a6d319ef6485b16e1f361fce43067847626a5515c4c5059d59327c9e6a4e50f95e7b298fbd79060c65a19cde389327e73e07fb557a32488ad44a25420abff8279abd0bd1f4ab768e73d3e1d5c2dab36c0c5d04cfec2a9f9da2aa299f55884215e200b490a6e0a9423255262648bd8a6d1c04799ae1dca959b00d3a826026c858ace5f52c42f8660c60f0a2ab6939a2453ce45ba803bbe14007e494bb24b2ca954f6362ef700a10480efa3d2f3acb159deec1105bad1a309d3122a2cfbdc4098a33e33d50c8118e70bb332f3b7d6ef2bbb58071c66bcc03ed5c2a24f1964f45e8d1a633f3cb4b183c718ded3e25312f8c4e00c9e026a5932a2432e3cdf7defb789610c4272010e51e5ff0471809eabb7aa2dd4104ca8720332b9852f4725d4660a6cf77a52b587e7d96ec263e996c1d0ae2f9bd039ebce7bf6b6e71fc9667e44e017fc0cb7c79c023be1c965894e61b79238b6e1bbc8c53e4f7c054768dec55272d001dfbfee788a85ba8b0c069e08cbbe85903696bd5b9908530f8a8578fef47721f47f3fe8507bac7761473e925e942159f5ea3f5d2e7beb3e81db8c23c6e618e38e511c213fd93a11ef51b9ae4ad03619bb39377c702d9765547ce95f9e758b46a54ee4e2689f892033cf2a4ea57d5d0b38750722d1737083fa8caedfccd3bce574080e35692010d2f91dd303b154af69f1b8b356d649da24236d5aabdfafe047b516b2008d8d5d09da5e99fbc4b4a98cf621ac4c38a89bd010656ca00937773126a7ef348b29a14b04cc5ec5c095b531622499b9aaa546957c802da9aee36794c24c9c7d2e105ae69b47841ecdac6b7a9194b49c21e2cfb96924306d06fdd1df761948e203a9408d16899e5e7abf3c870e55368c874daa18a8074886aedf6dd0f9b84c5df5f70821e6da5087d9b321c078062fd8b6eed35b8c68ea4ad67e9e91850e59c8b2426b2cc16217323b11080fd66ed9c5e0fd0d2b91598c9afa7808d3d965329083c741e60b39961c3a165c55aecf3bffbcda6453df75b48803d8a7347b026b2e4bac280e4b169b1fbd292565228a623825dcb3796b04f5bca83fda96887769384e608fc27a9cac547fb48638d4d533c35de16586239014d1907eaf3d064b3f8f83e9d64aece6d0b1f730f0b07d9a49b0d41e201adaa2e1b336f2073e23cb3ad8962c187dccc5dcdb3037e652866d9c248c639685e3451787b5fcf1c8abce4a7b02c304928f7d562502f04ad4fa803f66611ff2c512e5260c8fcede73d8fae4785b8444a123e49243b6f14181ff1bb368ede2b12672c8d06968d93f23981b26c2d00712757836c8dec46b0a22920812479b7d495ff723cacc1095940cbe04ca6bdd4de8025ad9fc778e34ca0e�x�������������x��������XX�%�
�\�������K��$[����������������K�L�J��0a643b1768617839bb5c3be226f02f13835468e87f34b5d702f460ddf8ded6970ed08a91f15348d5a116bff0ee712ee54ee9ee6b7f277cd67458793e94116c43c88bdf308e504d13829b680130a26b8b459b0884b30caf8693608683c7c2678d0c6afa8a362699dcc905408cf088108922d9ad9a2cbc98b66eba4fcdb7de2f013e612739e8fd5b0536fb1abbbf8e1cb0b56339bdee6e10017722d9e7290c092a5a0a3d02bb75541f237e4239de9b2aa9d37d70e1d869b2377f695dccffe680abc7a92d0722006b2792c0bbd0861ee796d5ff4c55259a79b37e380fd0b458c1a19428ac11dcda83570cb6dd817a731b650756aed5ab8c079482a75f564e171bb208b81313e51f55fed7cf1c789c5d6592d067b1409cbea4ac93857d9a41827e2c2aa5005608ee4f1a80de1cdd72805a675358187c44b41d05b69a7f9051decc0451d8f64d4c44fc874867ad8d4b7a6501f867bc69ba1911f3e55baf8aa7dc90b3e3f5c024e5814bce2fe09bd002c915ceec2a88194137a45162579ae0e7aa3b8b7c24d47bd8ecec457345865c7947a31df2749fa2d499ccd0fbd10f8d1254db8868dcfc487a1b3ec702ce961335fa477aa1175095f0d430c1f3d893996431781ef732696a34f82dbb9902b12e80ad9e52dd133d36fda30901c6b0ce931f02dad66d3c2e5365874d09d3f7c1af30cdf7170c7c41c470dde545ea7b1a304897dd60c099f4a7024c98356f662015c1b9bbbffbc9e5c2b28680075400a0a6ec3b3b84df2d4a5bb271bba3bbb5381cdfc8ba9dbcf26204ca125515d7d4ab9a59ceaab478e9251bbc75e48a2f117dfc5bcafc5fef91d9b61ae90da57af3e6d92a8e2a14bdaa27fe8dfbf6e011a36a1eb125c38fda4c1cd0c3c2ff09c74d8e0907a18f6180cbe79f732ad0245155760353b223b3376617c96781709e1df36fb868088121e6450b377d9eee54f36282858396c8e48af4ed7fd2f93f9bf8e337e05872811c6a08a6c891d25de8c2ed5493f032cbe75ef5ff0f995ea27b2d4295dc43ad9cacd3f53e07616a5708b23609aef6ef96a4c70d4e611a8b4a1164393acf847d1341f9e2b73d6a7d908ea2da124f369352ed3c5333af28c436be377f25a52068259111f03572fe3b5a7388498de1b1630d7abf0f5bb547c545583d29f385ec765f156254d19fe851a6864869979ed32b8bdf46899344dd5e24221db21451c8fa9458993000f50455ace1acd6ae4152b1f0ec17ad39e91621bbd6bd6f8b3b55b8fdb041a068531ace5f575757d6d5e85685f61658c634800da1df66b27172ded62584b6c102ece2fa14fc73ddf934d9fa2990160448b0de000adc79abfb6139afe8932ad9fef74bf585555d0826f011cd853bed7f39791cd2629bf40489762ecc29522803db85b25bf5b993eca6f7cf4c2312fd373ab8a5d52f075f30dc47014c9f28a9385b739eed9f5a8966a25922a52844a3f5b21e8e019187b4e6b40e518207bb96d6062a289133e0737540ef606f761f6a7e36ac5267292d800e74fcfeaaf01b671aa11d6b34df4bd892950a458f8ab9d71ed1f15ada0366279285186a92dc8110764a9c176a3b3cd7233af0477e810d7c40dbfd5c3d1d3fc59eda78be59df309819b7a14dd995ec42a4fad5b404660f6fe5cd400ffe48e1f005061451a88355a836c43bd7b1b4aa2f23edf189995fdda564b9f249f90774670e02592ff29ad93a4f41f8f9c8bee1a986a8977ab110a6f9fd7f29668af299a2582ea71f6924486a44fa840a664c0a4e46b2b526ab94e622af637df3a59720290f647f60600081fa0c87981bc4f2b1bf51001497e6f32353a26d5c0cdd0760e1fcaa8b27b2c9aced41fe5e43273a8bc7436784fb6babcdd4c85cc5d9df65553510067c50b6045d4278a7a7ad77ef5bb03bd64ec0693cbf19cd1d94b269f2bec56f746b049191b85c9a75d72a9f07ff45ecf5e0ad7d7aee29743b8f34baee34a884d77a20af98dc78981b614f4dad2b6272f09fcaed7bdce2a830c20954a25a814820aab72355e18a2b9f19c216a5399317aa6608c9b41a46c99d569e90a3a2879c422f2c925fac3f45be7c699cf521434f4f6bf5ddfbabff984cc3ff074db1ad6ee258da9fcc8adbb6cf5ad85aa1e003625afeac105796e080cb0589c0691b1b174a6d960a8964ac762c48bb5997e390b8c4e73f182d07502ee5101038e7032018184974b70f4b1ec9c3a6651f7a9a24e71668c95f0fb2d9155e1a6b192c8b711451ad2338e58a395209682e80b6df66cc871060808ef260113f6d0021426b9c078bd0f768609bb588e292e4086a6466228ab79e3a5f72ea4cb8a70fe22b3ea97584a6718f830d8b24a4bd1f3338be7d1fd22c4fcb186e310da0f278e31b6187b9a24e46c3fcd65fc5ee9b745165d9c81dc8a69239083b3315e887fb7f9456b747e991f55ee3f69e895704f3ffd0e2f1147d43c283d072e15811a9e7df891fe07d72dc1501845476119b4219215496ffab8b35cfcddaf169a9074c3f42d294794f4c151422e0ff70c1bde51e1066eb49b61e094c4f521b8410a6a48edbef28f09ecfa1a2c578bc21793f90682ce0ac34d6cb77a81ffbd1d1b42870490b5fc531b3b19c3d43e1331e64474e751b589a8e38e1c5fecc7d283ee333c6db43c68b9d0b5aec9d3507dedf360e800031d95785f38608e23d0cad519a3ba2b01008c331dc869b3db3013eef5e79a2f489bb9ff4aba101a7bacddca31ca913d39b55869e57e24e5014ea928d5a24b9cbd35cce3d5634a29c995867b58dd0ffdf1cff3cdb2a480f21fff9f0eb8370435b162065ed281fa2e2e78394a9d9486f�x��������������������XY�$�
��������x�h�$x����������������hgi� vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only use reserve ports when necessary
  (bz# 141773)- Update to util-linux-2.12p. This changes swap header format
  from - you may need to rerun mkswap if you did a clean install of
  FC3.- Update to util-linux-2.12j- Corrected a buffer overflow problem with nfs mounts.
  (bz# 141733)- Patches for various bugs.- Made NFS mounts adhere to the IP protocol if specified on
  command line as well as made NFS umounts adhere to the
  current IP protocol. Fix #140016- Add include_raw macro, build with it off for Fedora- Add raw patch to allow binding of devices not yet in /dev- Add David Zeuthen's patch to enable the pamconsole flag #133941- Restore raw utils (bugzilla #130016)- Add the missing remote entry in pam.d- Rechecked in some missing NFS mounting code.- Make swaplabel support work with swapon -a -e- Updated the NFS and NFS4 code to the latest CITI patch set
  (in which they incorporate a number of our local patches).- Fix #132196 - turn on SELinux support at build-time.- Fix #91174 with pamstart.patch- Fix #16415, #70616 with rdevman.patch
- Fix #102566 with loginman.patch
- Fix #104321 with rescuept.patch (just use plain lseek - we're in _FILE_OFFSET_BITS=64 land now)
- Fix #130016 - remove raw.
- Re-add agetty (replacing it with mgetty is too much pain, and mgetty is much larger)- Made the NFS security checks more explicit to avoid confusion
  (an upstream fix)
- Also removed a compilation warning- Remove unused mount libdevmapper inclusion.- Add device-mapper mount-by-label support
- Fix segfault in mount-by-label when a device without a label is present.- Updated nfs man page to show that intr are on by
  default for nfs4- modified warning causing heart attack for >16 partitions, #107824- Fix #126623, #126572
- Patch cleanup
- Remove agetty (use mgetty, agetty is broken)- rebuilt- Update to 2.12a
- Fix #122448- Change pam_selinux to run last- Fix #122448 (autofs issues)- Fix #119157 by editing the patch
- Add patch145 to fix #119986- Fix #118803- mkcramfs: use PAGE_SIZE for default blocksize (#118681)- Updated the nfs-mount.patch to correctly 
  handle the mounthost option and to ignore 
  servers that do not set auth flavors- Fix selinux ordering or pam for login- Make RPC error messages displayed with -v argument
- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running
- Ping NFS v4 servers before diving into kernel
- Make v4 mount interruptible which also make the intr option on by default- Reworked how the rpc.idmapd and rpc.gssd checks were
  done due to review comments from upstream.
- Added rpc_strerror() so the '-v' flag will show RPC errors.- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running.- Reworked and updated the nfsv4 patches.- Bump version- Tried to make nfs error message a bit more meaninful
- Cleaned up some warnings- Added pesudo flavors for nfsv4 mounts.
- Added BuildRequires: libselinux-devel and Requires: libselinux
  when WITH_SELINUX is set.- check for 2.6.3 kernel in mount options- Remove /bin/kill for #116100- rebuilt- rebuilt- Final 2.12 has been out for ages - might as well use it.- Added mount patches that have NFS version 4 support- Provides: mount losetup- Add multiple to /etc/pam.d/login for SELinux- 2.12pre-1
- Merge mount/losetup packages into the main package (#112324)
- Lose�x�������������h�������XZ�%�
��������������%��$5����������������%�&�V�odlib.podperlmodstyle.podperlmroapi.podperlnetware.podperlnewmod.podperlnumber.podperlobj.podperlootut.podperlop.podperlopenbsd.podperlopentut.podperlos2.podperlos390.podperlos400.podperlpacktut.podperlperf.podperlplan9.podperlpod.podperlpodspec.podperlpolicy.podperlport.podperlpragma.podperlqnx.podperlre.podperlreapi.podperlrebackslash.podperlrecharclass.podperlref.podperlreftut.podperlreguts.podperlrepository.podperlrequick.podperlreref.podperlretut.podperlriscos.podperlrun.podperlsec.podperlsolaris.podperlsource.podperlstyle.podperlsub.podperlsymbian.podperlsyn.podperlsynology.podperlthrtut.podperltie.podperltoc.podperltodo.podperltooc.podperltoot.podperltrap.podperltru64.podperltw.podperlunicode.podperlunicook.podperlunifaq.podperluniintro.podperluniprops.podperlunitut.podperlvar.podperlvms.podperlvos.podperlwin32.podperlxs.podperlxstut.podperlxstypemap.podsigtrap.pmsort.pmsubs.pmvars.pmvmsish.pmwarningsregister.pm/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/00//usr/lib/.build-id/07//usr/lib/.build-id/0b//usr/lib/.build-id/10//usr/lib/.build-id/11//usr/lib/.build-id/14//usr/lib/.build-id/16//usr/lib/.build-id/18//usr/lib/.build-id/1b//usr/lib/.build-id/20//usr/lib/.build-id/2f//usr/lib/.build-id/30//usr/lib/.build-id/31//usr/lib/.build-id/32//usr/lib/.build-id/36//usr/lib/.build-id/3c//usr/lib/.build-id/42//usr/lib/.build-id/44//usr/lib/.build-id/45//usr/lib/.build-id/4e//usr/lib/.build-id/50//usr/lib/.build-id/57//usr/lib/.build-id/5c//usr/lib/.build-id/5f//usr/lib/.build-id/63//usr/lib/.build-id/64//usr/lib/.build-id/66//usr/lib/.build-id/78//usr/lib/.build-id/7a//usr/lib/.build-id/7f//usr/lib/.build-id/80//usr/lib/.build-id/82//usr/lib/.build-id/84//usr/lib/.build-id/87//usr/lib/.build-id/8e//usr/lib/.build-id/95//usr/lib/.build-id/96//usr/lib/.build-id/98//usr/lib/.build-id/a1//usr/lib/.build-id/a2//usr/lib/.build-id/a9//usr/lib/.build-id/af//usr/lib/.build-id/b2//usr/lib/.build-id/b4//usr/lib/.build-id/b5//usr/lib/.build-id/b7//usr/lib/.build-id/c2//usr/lib/.build-id/c9//usr/lib/.build-id/cc//usr/lib/.build-id/ce//usr/lib/.build-id/d0//usr/lib/.build-id/da//usr/lib/.build-id/e0//usr/lib/.build-id/ee//usr/lib/.build-id/ef//usr/lib/.build-id/ff//usr/lib64/perl5//usr/lib64/perl5/B//usr/lib64/perl5/File//usr/lib64/perl5/Hash//usr/lib64/perl5/Hash/Util//usr/lib64/perl5/I18N//usr/lib64/perl5/PerlIO//usr/lib64/perl5/Sys//usr/lib64/perl5/Tie//usr/lib64/perl5/Tie/Hash//usr/lib64/perl5/asm-generic//usr/lib64/perl5/asm//usr/lib64/perl5/auto//usr/lib64/perl5/auto/B//usr/lib64/perl5/auto/Fcntl//usr/lib64/perl5/auto/File//usr/lib64/perl5/auto/File/DosGlob//usr/lib64/perl5/auto/File/Glob//usr/lib64/perl5/auto/GDBM_File//usr/lib64/perl5/auto/Hash//usr/lib64/perl5/auto/Hash/Util//usr/lib64/perl5/auto/Hash/Util/FieldHash//usr/lib64/perl5/auto/I18N//usr/lib64/perl5/auto/I18N/Langinfo//usr/lib64/perl5/auto/NDBM_File//usr/lib64/perl5/auto/ODBM_File//usr/lib64/perl5/auto/Opcode//usr/lib64/perl5/auto/POSIX//usr/lib64/perl5/auto/PerlIO//usr/lib64/perl5/auto/PerlIO/encoding//usr/lib64/perl5/auto/PerlIO/mmap//usr/lib64/perl5/auto/PerlIO/scalar//usr/lib64/perl5/auto/PerlIO/via//usr/lib64/perl5/auto/SDBM_File//usr/lib64/perl5/auto/Sys//usr/lib64/perl5/auto/Sys/Hostname//usr/lib64/perl5/auto/Tie//usr/lib64/perl5/auto/Tie/Hash//usr/lib64/perl5/auto/Tie/Hash/NamedCapture//usr/lib64/perl5/auto/arybase//usr/lib64/perl5/auto/attributes//usr/lib64/perl5/auto/mro//usr/lib64/perl5/bits//usr/lib64/perl5/bits/types//usr/lib64/perl5/gnu//usr/lib64/perl5/linux//usr/lib64/perl5/sys//usr/share/man/man1//usr/share/man/man3//usr/share/perl5//usr/share/perl5/B//usr/share/perl5/Class//usr/share/perl5/Config//usr/share/perl5/DBM_Filter//usr/share/perl5/ExtUtils//usr/share/perl5/ExtUtils/Constant//usr/share/perl5/File//usr/share/perl5/Getopt//usr/share/perl5/I18N//usr/share/perl5/I18N/LangTags//usr/share/perl5/IPC//usr/share/perl5/Net�x���������������������X[�%�
Ћ������x�����P��$@����������������P�Q�O�� ~
��6���~E�`!�	�;�6
�OG;�*p9�l�!
���	�j`}�H/k�p�*A��4�7�.b��	�q!�bU�H(p)bm-������#2�4�I`<"B<��"w���	y[�2P4E�8q* �H#MKE=��2�nm���|�/��B�sR}~SI
�@�If*�0���
%
�%�����n�X�
�`	��bm�

�	����&��&���,$
��
�1�
7�5�����
�B�c�f��g�
L	+�y�����*���	I�
�&	�
C
��^[
�[��
�b�"k	Ee�
�
�
�	�jL';
�
�D	�
g
:=�L���y1tO^NI�81VQ��	D��:��M&
��+'+��?�d'^���"Rm��p��2<
I����
�(�8a�
4��6�� _��.�j��]Dv	�	.��o�V&����*�&��Q�J^<��B�%�
��E�B��?�۰�����p\�'�%�X3��P�
�
�҇��"��*�0�$���*1U!l�� ,���������)����v��+ �b�Ҍ��O�u�ďKUb �&0z݂9
�%�S1j?��u��V��Z�F�W�)dI	�L4+@�J����5� A����	��*w-��,��Vg���+a/�c�F%l�/f�1�*�X/��+ ���h�<�$�l�=:��R��V�|dV28�Ev~|I����If���HA9�٩��.fHt~�!�;���b�{��
��x&&)|!,}B;c�5O��Zz2Ƈ��4Hï]���P	n�����A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A큤��������������������A큤����A�A큤��A큤A큤����������A큤��������A큤A�A큤����A�A큤����������������������������������������������A��A��A�A��A��A��A�A�A���A�A��A��A��A��A��A�A��A��A��A��A��A�A��A�A�A��A��A��A��A큤����������������������������������������������������������A큤��������������������������������������������������A큤����A큤����A큤����������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤������A큤A큤��A큤����������������A�A큤����������A큤��������������A큤A큤A큤����A큤������A큤��������A큤��A큤����A큤��A큤A큤��A큤����������������A큤������A큤A큤����������������������A큤��������������A큤������A큤������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤�x�������������X��������X\a%�
Pr������ Lud�$e����������������udvdtd�_g.3ssl.gzDSA_get0_key.3ssl.gzDSA_get0_p.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_priv_key.3ssl.gzDSA_get0_pub_key.3ssl.gzDSA_get0_q.3ssl.gzDSA_get_default_method.3ssl.gzDSA_get_ex_data.3ssl.gzDSA_get_ex_new_index.3ssl.gzDSA_meth_dup.3ssl.gzDSA_meth_free.3ssl.gzDSA_meth_get0_app_data.3ssl.gzDSA_meth_get0_name.3ssl.gzDSA_meth_get_bn_mod_exp.3ssl.gzDSA_meth_get_finish.3ssl.gzDSA_meth_get_flags.3ssl.gzDSA_meth_get_init.3ssl.gzDSA_meth_get_keygen.3ssl.gzDSA_meth_get_mod_exp.3ssl.gzDSA_meth_get_paramgen.3ssl.gzDSA_meth_get_sign.3ssl.gzDSA_meth_get_sign_setup.3ssl.gzDSA_meth_get_verify.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_set0_app_data.3ssl.gzDSA_meth_set1_name.3ssl.gzDSA_meth_set_bn_mod_exp.3ssl.gzDSA_meth_set_finish.3ssl.gzDSA_meth_set_flags.3ssl.gzDSA_meth_set_init.3ssl.gzDSA_meth_set_keygen.3ssl.gzDSA_meth_set_mod_exp.3ssl.gzDSA_meth_set_paramgen.3ssl.gzDSA_meth_set_sign.3ssl.gzDSA_meth_set_sign_setup.3ssl.gzDSA_meth_set_verify.3ssl.gzDSA_new.3ssl.gzDSA_new_method.3ssl.gzDSA_print.3ssl.gzDSA_print_fp.3ssl.gzDSA_security_bits.3ssl.gzDSA_set0_key.3ssl.gzDSA_set0_pqg.3ssl.gzDSA_set_default_method.3ssl.gzDSA_set_ex_data.3ssl.gzDSA_set_flags.3ssl.gzDSA_set_method.3ssl.gzDSA_sign.3ssl.gzDSA_sign_setup.3ssl.gzDSA_size.3ssl.gzDSA_test_flags.3ssl.gzDSA_verify.3ssl.gzDSAparams_dup.3ssl.gzDSAparams_print.3ssl.gzDSAparams_print_fp.3ssl.gzDTLS_client_method.3ssl.gzDTLS_get_data_mtu.3ssl.gzDTLS_method.3ssl.gzDTLS_server_method.3ssl.gzDTLS_set_timer_cb.3ssl.gzDTLS_timer_cb.3ssl.gzDTLSv1_2_client_method.3ssl.gzDTLSv1_2_method.3ssl.gzDTLSv1_2_server_method.3ssl.gzDTLSv1_client_method.3ssl.gzDTLSv1_listen.3ssl.gzDTLSv1_method.3ssl.gzDTLSv1_server_method.3ssl.gzECDH_get_ex_data.3ssl.gzECDH_get_ex_new_index.3ssl.gzECDH_set_ex_data.3ssl.gzECDSA_SIG_free.3ssl.gzECDSA_SIG_get0.3ssl.gzECDSA_SIG_get0_r.3ssl.gzECDSA_SIG_get0_s.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_set0.3ssl.gzECDSA_do_sign.3ssl.gzECDSA_do_sign_ex.3ssl.gzECDSA_do_verify.3ssl.gzECDSA_sign.3ssl.gzECDSA_sign_ex.3ssl.gzECDSA_sign_setup.3ssl.gzECDSA_size.3ssl.gzECDSA_verify.3ssl.gzECPARAMETERS_free.3ssl.gzECPARAMETERS_new.3ssl.gzECPKPARAMETERS_free.3ssl.gzECPKPARAMETERS_new.3ssl.gzECPKParameters_print.3ssl.gzECPKParameters_print_fp.3ssl.gzEC_GF2m_simple_method.3ssl.gzEC_GFp_mont_method.3ssl.gzEC_GFp_nist_method.3ssl.gzEC_GFp_nistp224_method.3ssl.gzEC_GFp_nistp256_method.3ssl.gzEC_GFp_nistp521_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GROUP_check.3ssl.gzEC_GROUP_check_discriminant.3ssl.gzEC_GROUP_clear_free.3ssl.gzEC_GROUP_cmp.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_dup.3ssl.gzEC_GROUP_free.3ssl.gzEC_GROUP_get0_cofactor.3ssl.gzEC_GROUP_get0_generator.3ssl.gzEC_GROUP_get0_order.3ssl.gzEC_GROUP_get0_seed.3ssl.gzEC_GROUP_get_asn1_flag.3ssl.gzEC_GROUP_get_basis_type.3ssl.gzEC_GROUP_get_cofactor.3ssl.gzEC_GROUP_get_curve.3ssl.gzEC_GROUP_get_curve_GF2m.3ssl.gzEC_GROUP_get_curve_GFp.3ssl.gzEC_GROUP_get_curve_name.3ssl.gzEC_GROUP_get_degree.3ssl.gzEC_GROUP_get_ecparameters.3ssl.gzEC_GROUP_get_ecpkparameters.3ssl.gzEC_GROUP_get_order.3ssl.gzEC_GROUP_get_pentanomial_basis.3ssl.gzEC_GROUP_get_point_conversion_form.3ssl.gzEC_GROUP_get_seed_len.3ssl.gzEC_GROUP_get_trinomial_basis.3ssl.gzEC_GROUP_have_precompute_mult.3ssl.gzEC_GROUP_method_of.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new_by_curve_name.3ssl.gzEC_GROUP_new_curve_GF2m.3ssl.gzEC_GROUP_new_curve_GFp.3ssl.gzEC_GROUP_new_from_ecparameters.3ssl.gzEC_GROUP_new_from_ecpkparameters.3ssl.gzEC_GROUP_order_bits.3ssl.gzEC_GROUP_precompute_mult.3ssl.gzEC_GROUP_set_asn1_flag.3ssl.gzEC_GROUP_set_curve.3ssl.gzEC_GROUP_set_curve_GF2m.3ssl.gzEC_GROUP_set_curve_GFp.3ssl.gzEC_GROUP_set_curve_name.3ssl.gzEC_GROUP_set_generator.3ssl.gzEC_GROUP_set_point_conversion_form.3ssl.gzEC_GROUP_set_seed.3ssl.gzEC_KEY_check_key.3ssl.gzEC_KEY_clear_flags.3ssl.gzEC_KEY_copy.3ssl.gzEC_KEY_decoded_from_explicit_params.3ssl.gzEC_KEY_dup.3ssl.gzEC_KEY_free.3ssl.gzEC_KEY_generate_key.3ssl.gzEC_KEY_get0_engine.3ssl.gz�x����������������������XM�%�
�������!�����$�����������������!!�!�ove bundled Module-Pluggable (bug #903624)- Run-require POD convertors by Module-Build and ExtUtils-MakeMaker to
  generate documentation when building other packages- Sub-package Pod-LaTeX (bug #904085)- Remove bundled Pod-Parser- Fix CVE-2012-6329 (misparsing of maketext strings) (bug #884354)- Do not package App::Cpan(3pm) to perl-Test-Harness (bug #893768)- Remove bundled Archive-Tar
- Remove bundled CPAN-Meta-YAML
- Remove bundled Module-Metadata- Remove bundled Filter modules- 5.16.2 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)- Remove bundled podlators (bug #856516)- Do not crash when vivifying $| (bug #865296)- Conflict perl-podlators with perl before sub-packaging (bug #856516)- Do not leak with attribute on my variable (bug #858966)
- Allow operator after numeric keyword argument (bug #859328)
- Extend stack in File::Glob::glob (bug #859332)- Put perl-podlators into perl-core list (bug #856516)- Remove bundled perl-ExtUtils-Manifest
- perl-PathTools uses Carp- Override the Pod::Simple::parse_file to set output to STDOUT by default
  (bug #826872)- Sub-package perl-podlators (bug #856516)- Do not access freed memory when cloning thread (bug #825749)
- Match non-breakable space with /[\h]/ in ASCII mode (bug #844919)
- Clear $@ before `do' I/O error (bug #834226)
- Do not truncate syscall() return value to 32 bits (bug #838551)- Move App::Cpan from perl-Test-Harness to perl-CPAN (bug #854577)- Remove perl-devel dependency from perl-Test-Harness and perl-Test-Simple- define perl_compat by macro for rebuilds
- sub-packages depend on compat rather than on nvr- apply conditionals for dual life patches- 5.16.1 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)
- Fixed reopening by scalar handle (bug #834221)
- Fixed tr/// multiple transliteration (bug #831679)
- Fixed heap-overflow in gv_stashpv (bug #826516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Move the rest of ExtUtils-ParseXS into its sub-package, so that the main
  perl package doesn't need to pull in perl-devel (bug #839953)- Fix broken atof (bug #835452)- perl-Pod-Perldoc must require groff-base because Pod::Perldoc::ToMan executes
  roff- Test::Build requires Data::Dumper
- Sub-package perl-Pod-Parser- Remove MODULE_COMPAT_5.14.* Provides- Perl 5.16 rebuild- perl_bootstrap macro is distributed in perl-srpm-macros now- Own zipdetails and IO::Compress::FAQ by perl-IO-Compress- Fix find2perl to translate ? glob properly (bug #825701)- Shorten perl-Module-Build version to 2 digits to follow upstream- upload the stable 5.16.0- clean patches, not needed with new version
- regen by podcheck list of failed pods. cn, jp, ko pods failed. I can't decide
  whether it's a real problem or false positives.- Enable usesitecustomize- Rebuild perl against Berkeley database version 5 (bug #768846)- perl-Data-Dumper requires Scalar::Util (bug #811239)- Sub-package Data::Dumper (bug #811239)- Sub-package Filter (bug #790349)- Fix searching for Unicode::Collate::Locale data (bug #756118)
- Run safe signal handlers before returning from sigsuspend() and pause()
  (bug #771228)
- Correct perl-Scalar-List-Utils files list
- Stop !$^V from leaking (bug #787613)- Rebuild again now that perl dependency generator is fixed (#772632, #772699)- perl-ExtUtils-MakeMaker sub-package requires ExtUtils::Install- Rebuild for gcc 4.7- Fix interrupted reading. Thanks to Šimon Lukašík for reporting this issue
  and thanks to Marcela Mašláňová for finding fix. (bug #767931)- Fix leak with non-matching named captures (bug #767597)- Sub-package ExtUtils::Install
- Sub-package ExtUtils::Manifest
- Do not provide private perl(ExtUtils::MakeMaker::_version)- Add $RPM_LD_FLAGS to lddlflags.- Sub-package Socket- Sub-package Pod::Perldoc- Increase epoch of perl-Module-CoreList to overcome version regression in
  upstream (bug #754641)- perl(DBIx::Simple) is not needed in spec requirement in CPANPLUS. It's genera�x�������������H��������X^�#�
��������Dz��$j����������������z�y�{��when no terminal (RhBug:1577889)
- Allow to ship alternative dnf.conf (RhBug:1752249)
- Don't check if repo is expired if it doesn't have loaded metadata (RhBug:1745170)
- Remove duplicate entries from "dnf search" output (RhBug:1742926)
- Set default value of repo name attribute to repo id (RhBug:1669711)
- Allow searching in disabled modules using "dnf module provides" (RhBug:1629667)
- Group install takes obsoletes into account (RhBug:1761137)
- Improve handling of vars
- Do not load metadata for repolist commands (RhBug:1697472,1713055,1728894)
- Fix messages for starting and failing scriptlets (RhBug:1724779)
- Don't show older install-only pkgs updates in updateinfo (RhBug:1649383,1728004)
- Add --ids option to the group command (RhBug:1706382)
- Add --with_cve and --with_bz options to the updateinfo command (RhBug:1750528)- Update to 4.2.11
- Improve modularity documentation (RhBug:1730162,1730162,1730807,1734081)
- Fix detection whether system is running on battery (used by metadata caching timer) (RhBug:1498680)
- New repoquery queryformat: %{reason}
- Print rpm errors during test transaction (RhBug:1730348) 
- Fix incorrectly marked profile and stream after failed rpm transaction check (RhBug:1719679)
- Show transaction errors inside dnf shell (RhBug:1743644)
- dnf-automatic now respects versionlock excludes (RhBug:1746562)
- [doc] Add user_agent and countme options
- [history] Don't store failed transactions as succeeded
- [history] Do not require root for informative commands
- [dnssec] Fix UnicodeWarning when using new rpm (RhBug:1699650)
- Apply excludes before modular excludes (RhBug:1709453)
- Improve help for command line arguments (RhBug:1659328)
- Add new modular API method ModuleBase.get_modules
- Mark features used by ansible, anaconda and subscription-manager as an API- Prevent reinstalling modified packages with same NEVRA (RhBug:1728252,1644241,1760825)- Remove patch to not fail when installing modular RPMs without modular metadata- Fix: --setopt and repo with dots (RhBug:1746349)- Prevent printing empty Error Summary (RhBug:1690414)- Update localizations from zanata (RhBug:1689982)
- Accept multiple specs in repoquery options (RhBug:1667898,1656801)
- Prevent switching modules in all cases (RhBug:1706215)
- Change synchronization of rpm transaction to swdb (RhBug:1737328)
- Print rpm error messages during transaction (RhBug:1677199)
- Report missing default profile as an error (RhBug:1669527,1724564)
- Describe a behavior when plugin is removed (RhBug:1700741)- Add patch to not fail when installing modular RPMs without modular metadata- Update to 4.2.7
- Fix package reinstalls during yum module remove (RhBug:1700529)
- Fail when "-c" option is given nonexistent file (RhBug:1512457)
- Reuse empty lock file instead of stopping dnf (RhBug:1581824)
- Propagate comps 'default' value correctly (RhBug:1674562)
- Better search of provides in /(s)bin/ (RhBug:1657993)
- Add detection for armv7hcnl (RhBug:1691430)
- Fix group install/upgrade when group is not available (RhBug:1707624)
- Report not matching plugins when using --enableplugin/--disableplugin
  (RhBug:1673289) (RhBug:1467304)
- Add support of modular FailSafe (RhBug:1623128)
- Replace logrotate with build-in log rotation for dnf.log and dnf.rpm.log
  (RhBug:1702690)- Update to 4.2.6
- Use improved config parser that preserves order of data
- Follow RPM security policy for package verification
- Update modules regardless of installed profiles
- [conf] Use environment variables prefixed with DNF_VAR_
- Allow adjustment of repo from --repofrompath (RhBug:1689591)
- Allow globs in setopt in repoid part
- Add command abbreviations (RhBug:1634232)
- Installroot now requires absolute path
- librepo: Turn on debug logging only if debuglevel is greater than 2 (RhBug:1355764,1580022)
- Document cachedir option (RhBug:1691365)
- Enhance documentation - API examples
- Enhance documentation of --whatdepends option (RhBug:1687070)
- Update documentation: implemented plugins; options; deprecated commands (RhBug:1670835,16732�x����������������������X_�%�
U
x
	��$V��������������������params 
  by adding checking statements and display usage (msghack.py modified)
- rpath patch for binary-or-shlib-defines-rpath in x86_64.- fix autopoint messing up CVS files with upstream patch (#441481)- if %buildjar is off make sure libintl.jar does not get installed (#433210)- turn on building of libintl.jar now that we have gcc43- rebuild with gcc43- update to 0.17 release
  - update License field to GPLv3
  - add gettext-0.17-open-args.patch to fix build from upstream
  - gettext-tools-tests-lang-gawk-fail.patch, gettext-php-headers.patch,
    gettext-php-prinf-output-237241.patch, and
    gettext-xglade-define-xml-major-version-285701.patch are no longer needed
- drop superfluous po-mode-init.el source
- no need to run autoconf and autoheader when building
- pass -findirect-dispatch to gcj to make java binaries ABI independent
  (jakub,#427796)
- move autopoint, gettextize, and {_datadir}/{name}/ to main package
- force removal of emacs/ so install does not fail when no emacs- add a libs subpackage (suggested by Dwayne Bailey, #294891)
- move preloadable_libintl.so to the devel subpackage- remove gettext-xglade-include-expat-285701.patch, add
  gettext-xglade-define-xml-major-version-285701.patch to determine
  XML_MAJOR_VERSION from expat.h and define it in config.h (#285701)- buildrequire expat-devel
- add gettext-xglade-include-expat-285701.patch to include expat.h
  to get xgettext to dl the right libexpat (Nils Philippsen, #285701)- specify license is GPL and LGPL version 2 or later- fix encoding of msghack script (Dwayne Bailey, #250248)- add gettext-php-prinf-output-237241.patch to workaround php test failure
  (#237241)
- add gettext-php-headers.patch to correct php test headers
  (Robert Scheck, #232832)- set preloadable_libintl.so executable in %install so it gets stripped
- force removal of infodir/dir since it is not there when /sbin is not in path- add buildjar switch for building of libintl.jar
- lots of spec file cleanup (Mamoru Tasaka, #225791):
- preserve timestamps of installed files
- disable building of static library
- use %find_lang for .mo files
- remove examples from -devel package
- do not own en@*quot locale dirs
- set preloadable_libintl.so executable
- add ChangeLog to -devel package
- add %check to run make check
- add gettext-tools-tests-lang-gawk-fail.patch to work around gawk test failure- rebuild to pick up dependency on libgcj.so.8rh instead libgcj.so.7rh- protect install-info in devel %post and %preun too (Ville Skyttä, #223689)
- forward port fix to reset of timestamp of examples ChangeLog for
  brp-java-repack-jars libintl.jar multilib conflict (#205207)- protect install-info in %post and %preun (Ville Skyttä, #223689)- update to 0.16.1- re-enable openmp on ia64- update to 0.16 release
- disable openmp on ia64 (#216988)- update to 0.15 release
- mkinstalldirs and libintl.jar are gone
- javaversion.class added- buildrequire zip and unzip to fix libintl.jar multilib conflict (#205207)- move libgettext*.so devel files to devel package (Patrice Dumas, #203622)- update to 0.14.6
- include preloadable_libintl.so again (Roozbeh Pournader, #149809)
- remove .la files (Kjartan Maraas, #172624)
- cleanup spec file- Bump release number.- rebuild- --disable-csharp, otherwise it'll build a dll when mono is 
  installed in the buildroot.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt again- rebuilt- convert spec to UTF-8
- remove old tarballs from sources- updated to 0.14.5
- Add cvs as Requires for gettext-devel- updated to 0.14.3
- fixed compiling problem on gcc4 (#150992)
- fixed Group for -devel (#138303)
- moved gettextize and autopoint to -devel (#137542, #145768)
- moved some of the man pages- rebuilt with gcc 4.0- Add env var to redirect use fastjar instead of jar
- BuildRequires fastjar and libgcj- fix call on phase0_getc()
- fix temp file issue (#136323 - CAN-2004-0966 - mjc)- fixed typo on %preun on -devel- fix install_info
- add gcc-java build requirement- mo�x�������������8y�������X`
%�
��������0m�d�$Y�����������������d�d�d�g��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g��g�ng�ng�ng�`\�`\�`\�g��g��g�qg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�qg��g��g��g��g��g��g��g�rg��g�rg��g�rg��g��g��g��g��g��g��g�rg�rg��g�rg��g��g��g��g��g��g��g��g��g��g��g��g�rg��g��g��g��g��g�rg��g��g��g��g��g��g��g��g��g��g��g�qg��g��g��g��g��g��g��g��g��g�rg��g��g��g��g��g��g��g��g�rg��g��g��g��g��g��g��g��g��g��g��g�rg��g��g��g�rg�rg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�rg�rg��g��g��g��g��g��g��g��g��g��g��g�rg�rg�rg�rg�rg�sg�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�sg��g�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�sg��g��g��g��g��g��g��g��g��g��g��g�sg�sg��g��g��g��g��g��g��g��g��g��g��g��g�sg��g��g�sg��g�sg��g�sg��g��g��g��g��g�sg�sg�sg�sg�sg�sg�sg��g�sg��g��g��g��g��g��g��g��g�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g�tg��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g�tg�tg��g�tg��g��g��g��g��g��g��g��g�tg�tg��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g�tg�tg��g��g��g��g��g��g��g�tg��g��g��g�tg��g��g��g��g��g��g��g�tg��g��g��g��g�tg�tg��g��g��g��g�tg��g��g��g��g��g��g�tg��g��g��g�ug��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�ug��g��g��g��g��g�ug�ug�ug�ug�ug�ug�ug�ug��g��g��g�ug�ug��g��g��g�ug�ug�ug�ug�ug��g�ug��g�ug��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g�ug��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g�vg��g��g��g��g�vg��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg�vg��g��g��g��g��g�vg��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g�vg�vg��g��g�x������m	`h�������XS�%�
X�Ѕ������w!�$g����������������w!v!x!�Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.0-281Petr Pisar <ppisar@redhat.com> - 4:5.16.3-280Petr Pisar <ppisar@redhat.com> - 4:5.16.3-279Petr Pisar <ppisar@redhat.com> - 4:5.16.3-278Petr Pisar <ppisar@redhat.com> - 4:5.16.3-277Petr Pisar <ppisar@redhat.com> - 4:5.16.3-276Petr Pisar <ppisar@redhat.com> - 4:5.16.3-275Petr Pisar <ppisar@redhat.com> - 4:5.16.3-274Petr Pisar <ppisar@redhat.com> - 4:5.16.3-273Petr Pisar <ppisar@redhat.com> - 4:5.16.3-272Petr Pisar <ppisar@redhat.com> - 4:5.16.3-271Petr Pisar <ppisar@redhat.com> - 4:5.16.3-270Petr Pisar <ppisar@redhat.com> - 4:5.16.3-269Petr Pisar <ppisar@redhat.com> - 4:5.16.3-268Petr Pisar <ppisar@redhat.com> - 4:5.16.3-267Petr Pisar <ppisar@redhat.com> - 4:5.16.3-266Petr Pisar <ppisar@redhat.com> - 4:5.16.3-265Petr Pisar <ppisar@redhat.com> - 4:5.16.3-264Petr Pisar <ppisar@redhat.com> - 4:5.16.3-263Petr Pisar <ppisar@redhat.com> - 4:5.16.3-262Petr Pisar <ppisar@redhat.com> - 4:5.16.3-261Petr Pisar <ppisar@redhat.com> - 4:5.16.2-260Petr Pisar <ppisar@redhat.com> - 4:5.16.2-259Petr Pisar <ppisar@redhat.com> - 4:5.16.2-258Petr Pisar <ppisar@redhat.com> - 4:5.16.2-257Petr Pisar <ppisar@redhat.com> - 4:5.16.2-256Petr Pisar <ppisar@redhat.com> - 4:5.16.2-255Petr Pisar <ppisar@redhat.com> - 4:5.16.2-254Petr Pisar <ppisar@redhat.com> - 4:5.16.2-253Petr Pisar <ppisar@redhat.com> - 4:5.16.2-252Petr Pisar <ppisar@redhat.com> - 4:5.16.2-251Petr Pisar <ppisar@redhat.com> - 4:5.16.2-250Petr Pisar <ppisar@redhat.com> - 4:5.16.2-249Petr Pisar <ppisar@redhat.com> - 4:5.16.2-248Petr Pisar <ppisar@redhat.com> - 4:5.16.2-247Petr Pisar <ppisar@redhat.com> - 4:5.16.2-246Petr Pisar <ppisar@redhat.com> - 4:5.16.2-245Petr Pisar <ppisar@redhat.com> - 4:5.16.2-244Petr Pisar <ppisar@redhat.com> - 4:5.16.2-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.2-242Petr Pisar <ppisar@redhat.com> - 4:5.16.1-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.1-240Petr Pisar <ppisar@redhat.com> - 4:5.16.1-239Petr Pisar <ppisar@redhat.com> - 4:5.16.1-238Petr Pisar <ppisar@redhat.com> - 4:5.16.1-237Petr Pisar <ppisar@redhat.com> - 4:5.16.1-236Petr Pisar <ppisar@redhat.com> - 4:5.16.1-235Petr Pisar <ppisar@redhat.com> - 4:5.16.1-234Petr Pisar <ppisar@redhat.com> - 4:5.16.1-233Petr Pisar <ppisar@redhat.com> - 4:5.16.1-232Petr Pisar <ppisar@redhat.com> - 4:5.16.1-231Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-230Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-229Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.1-228Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.16.0-227Paul Howarth <paul@city-fan.org> 4:5.16.0-226Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.0-225Petr Pisar <ppisar@redhat.com> - 4:5.16.0-224Petr Pisar <ppisar@redhat.com> - 4:5.16.0-223Petr Pisar <ppisar@redhat.com> - 4:5.16.0-222Petr Pisar <ppisar@redhat.com> - 4:5.16.0-221Petr Pisar <ppisar@redhat.com> - 4:5.16.0-220Petr Pisar <ppisar@redhat.com> - 4:5.16.0-219Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.0-218Petr Pisar <ppisar@redhat.com> - 4:5.16.0-218Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-217Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-RC2-217Petr Pisar <ppisar@redhat.com> - 4:5.14.2-216Petr Pisar <ppisar@redhat.com> - 4:5.14.2-215Petr Pisar <ppisar@redhat.com> - 4:5.14.2-214Petr Pisar <ppisar@redhat.com> - 4:5.14.2-213Petr Pisar <ppisar@redhat.com> - 4:5.14.2-212Petr Pisar <ppisar@redhat.com> - 4:5.14.2-211Paul Howarth <paul@city-fan.org> - 4:5.14.2-210Iain Arnell <iarnell@gmail.com> -4:5.14.2-209Paul Howarth <paul@city-fan.org> - 4:5.14.2-208Petr Pisar <ppisar@redhat.com> - 4:5.14.2-207Petr Pisar <ppisar@redhat.com> - 4:5.14.2-206Petr Pisar <ppisar@redhat.com> - 4:5.14.2-205Ville Skyttä <ville.skytta@iki.fi> - 4:5.14.2-204Petr Pisar <ppisar@redhat.com> - 4:5.14.2-203Petr Pisar <ppisar@redhat.com> - 4:5.14.2-202Petr Pisar <ppisar@redhat.com> - 4:5.14.2-201Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-200Petr Pisar <ppisar@redhat.com> - 4:5.14.2-199Petr Pi�x�������������(X�������Xb|$�
xU"��$c�������������������	sor input, ASCII text (gzip compressed data, max compression, from Unix)C source, ASCII text (gzip compressed data, max compression, from Unix)	
#@AB
RRRRRRRRRRRRRRRRRRR*RR2R-R%RRRRRRRRR$R+RR2R,RR"R#R RRRRRRRRRRRR(R.R)R&RR
RRR+R'R!RR2RRRRRRR$R+RR2utf-8a6c6fe72bf799f0f5c48bc07f8b5dc47d24c1e0ce2941a98f795a24ceb1bebbc?���`9��3!�^���P,��*����%�f�~�
	*����%��͑�֭B-��,2��`����݋
�2/Y����˸1CqZ�=%d�fފ��W*��P����Qm#ˣ""��#@Wb��5�J��Dd7��C�(�Qvv���g2-��.���a�"E���Tiu`���E?��9�g�H������@{n����\�P�]/�Q����Z� 9�K���^w�2�B��f
�N�p�q7}"��%
&K�_�'9in�$��+�q���/Ȉb���[������f:�4Y�d�҆tō$��0"��xm`%�
)G�Ľ[�5{�aFY�q
�Y�%����n�<�N��r�� U9�3<�}����������Ֆ�lZ�����v ����xr"�5��@���Aw�n����Џ5Uj����ⷚ)jU�\� o4
�2���	���1zw/��H0χ�4/�JI8@�W/�4ɱ�G���U�hp�}��ˢ�ELJ���g������ت�����6�4z�"��ًd,ұybc�,��"w��c*Gn�Pn�'���]x��W�3!�^���P,��*����%�f�~�
	*����%�i��o
oU��Jpth�������$c��5�!��yƝ�f�"ƥ����˦��oE�$`��ò�KD������Df˵tưQa5���6xv3��
�G�Z$-_fk��W��fзHTV��K�;R5�Z�gG��< ��nŐ��#+�5`�K�~�ֈD���$�C�ܓ����J�Z���n�E�q
'�G�i�,uf�8��)�f�!���~���m^�L���jp�![K��I���a�l���=�'��W�/t9/���3��d�G>���'o�.��=ێ`�o�d'{���4�zf�e?x1g[��5���&k}k���������|Z�ĥD�9gm�����pi�k_eBkD��rL;� ������R\	��?+�/��w�w��\V>�����tt�D�~���wE�샹V�. �Z��
j�K�9�~� �З@LT�N�q+��:��?��7u�����ﮌB:3�*	�$L�͕i�1gI
��)����,�1B�'����ѽ2558e633a43a3e86cd4cbf06f993ff3f8878740181dafefe330c31eac000959f0fe76e63d35c2a77cd0871ecf439cf70ca32ec37f��`�f� Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: fix spelling mistake: "missign" -> "missing" (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: Mediatek: MT8183: Add machine driver with DA7219 (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: Mediatek: MT8183: Add machine driver with TS3A227 (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: rt5677-spi: Add ACPI ID (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: cs42l51: add multi endpoint support (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: tlv320aic32x4: Fix Common Pins (Jaroslav Kysela) [1683051]
- [sound] ALSA: us122l: Use alloc_pages_exact() (Jaroslav Kysela) [1683051]
- [sound] ALSA: Replace snd_malloc_pages() and snd_free_pages() with standard helpers, take#2 (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Make snd_timer_close() really kill pending actions (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Check ack_list emptiness instead of bit flag (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Make sure to clear pending ack list (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Unify timer callback process code (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl_audmix: Fix kbuild failure (Jaroslav Kysela) [1683051]
- [sound] ALSA: emux: Add support of loading GUS-patch (Jaroslav Kysela) [1683051]
- [sound] ALSA: hda/realtek - Fix speakers on Acer Predator Helios 500 Ryzen laptops (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: Add Audio Mixer machine driver (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: Add Audio Mixer CPU�x��������������G�������Xcc%�
x<	sd�$c����������������sdtdrd�3ssl.gzENGINE_set_default_ciphers.3ssl.gzENGINE_set_default_digests.3ssl.gzENGINE_set_default_string.3ssl.gzENGINE_set_destroy_function.3ssl.gzENGINE_set_digests.3ssl.gzENGINE_set_ex_data.3ssl.gzENGINE_set_finish_function.3ssl.gzENGINE_set_flags.3ssl.gzENGINE_set_id.3ssl.gzENGINE_set_init_function.3ssl.gzENGINE_set_load_privkey_function.3ssl.gzENGINE_set_load_pubkey_function.3ssl.gzENGINE_set_name.3ssl.gzENGINE_set_table_flags.3ssl.gzENGINE_unregister_DH.3ssl.gzENGINE_unregister_DSA.3ssl.gzENGINE_unregister_RAND.3ssl.gzENGINE_unregister_RSA.3ssl.gzENGINE_unregister_ciphers.3ssl.gzENGINE_unregister_digests.3ssl.gzENGINE_up_ref.3ssl.gzERR_FATAL_ERROR.3ssl.gzERR_GET_FUNC.3ssl.gzERR_GET_LIB.3ssl.gzERR_GET_REASON.3ssl.gzERR_PACK.3ssl.gzERR_add_error_data.3ssl.gzERR_add_error_vdata.3ssl.gzERR_clear_error.3ssl.gzERR_error_string.3ssl.gzERR_error_string_n.3ssl.gzERR_free_strings.3ssl.gzERR_func_error_string.3ssl.gzERR_get_error.3ssl.gzERR_get_error_line.3ssl.gzERR_get_error_line_data.3ssl.gzERR_get_next_error_library.3ssl.gzERR_lib_error_string.3ssl.gzERR_load_crypto_strings.3ssl.gzERR_load_strings.3ssl.gzERR_peek_error.3ssl.gzERR_peek_error_line.3ssl.gzERR_peek_error_line_data.3ssl.gzERR_peek_last_error.3ssl.gzERR_peek_last_error_line.3ssl.gzERR_peek_last_error_line_data.3ssl.gzERR_pop_to_mark.3ssl.gzERR_print_errors.3ssl.gzERR_print_errors_cb.3ssl.gzERR_print_errors_fp.3ssl.gzERR_put_error.3ssl.gzERR_reason_error_string.3ssl.gzERR_remove_state.3ssl.gzERR_remove_thread_state.3ssl.gzERR_set_mark.3ssl.gzESS_CERT_ID_dup.3ssl.gzESS_CERT_ID_free.3ssl.gzESS_CERT_ID_new.3ssl.gzESS_ISSUER_SERIAL_dup.3ssl.gzESS_ISSUER_SERIAL_free.3ssl.gzESS_ISSUER_SERIAL_new.3ssl.gzESS_SIGNING_CERT_dup.3ssl.gzESS_SIGNING_CERT_free.3ssl.gzESS_SIGNING_CERT_new.3ssl.gzEVP_BytesToKey.3ssl.gzEVP_CIPHER_CTX_block_size.3ssl.gzEVP_CIPHER_CTX_cipher.3ssl.gzEVP_CIPHER_CTX_ctrl.3ssl.gzEVP_CIPHER_CTX_flags.3ssl.gzEVP_CIPHER_CTX_free.3ssl.gzEVP_CIPHER_CTX_get_app_data.3ssl.gzEVP_CIPHER_CTX_get_cipher_data.3ssl.gzEVP_CIPHER_CTX_iv_length.3ssl.gzEVP_CIPHER_CTX_key_length.3ssl.gzEVP_CIPHER_CTX_mode.3ssl.gzEVP_CIPHER_CTX_new.3ssl.gzEVP_CIPHER_CTX_nid.3ssl.gzEVP_CIPHER_CTX_reset.3ssl.gzEVP_CIPHER_CTX_set_app_data.3ssl.gzEVP_CIPHER_CTX_set_cipher_data.3ssl.gzEVP_CIPHER_CTX_set_key_length.3ssl.gzEVP_CIPHER_CTX_set_padding.3ssl.gzEVP_CIPHER_CTX_type.3ssl.gzEVP_CIPHER_asn1_to_param.3ssl.gzEVP_CIPHER_block_size.3ssl.gzEVP_CIPHER_flags.3ssl.gzEVP_CIPHER_iv_length.3ssl.gzEVP_CIPHER_key_length.3ssl.gzEVP_CIPHER_meth_dup.3ssl.gzEVP_CIPHER_meth_free.3ssl.gzEVP_CIPHER_meth_get_cleanup.3ssl.gzEVP_CIPHER_meth_get_ctrl.3ssl.gzEVP_CIPHER_meth_get_do_cipher.3ssl.gzEVP_CIPHER_meth_get_get_asn1_params.3ssl.gzEVP_CIPHER_meth_get_init.3ssl.gzEVP_CIPHER_meth_get_set_asn1_params.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_set_cleanup.3ssl.gzEVP_CIPHER_meth_set_ctrl.3ssl.gzEVP_CIPHER_meth_set_do_cipher.3ssl.gzEVP_CIPHER_meth_set_flags.3ssl.gzEVP_CIPHER_meth_set_get_asn1_params.3ssl.gzEVP_CIPHER_meth_set_impl_ctx_size.3ssl.gzEVP_CIPHER_meth_set_init.3ssl.gzEVP_CIPHER_meth_set_iv_length.3ssl.gzEVP_CIPHER_meth_set_set_asn1_params.3ssl.gzEVP_CIPHER_mode.3ssl.gzEVP_CIPHER_nid.3ssl.gzEVP_CIPHER_param_to_asn1.3ssl.gzEVP_CIPHER_type.3ssl.gzEVP_CipherFinal.3ssl.gzEVP_CipherFinal_ex.3ssl.gzEVP_CipherInit.3ssl.gzEVP_CipherInit_ex.3ssl.gzEVP_CipherUpdate.3ssl.gzEVP_DecodeBlock.3ssl.gzEVP_DecodeFinal.3ssl.gzEVP_DecodeInit.3ssl.gzEVP_DecodeUpdate.3ssl.gzEVP_DecryptFinal.3ssl.gzEVP_DecryptFinal_ex.3ssl.gzEVP_DecryptInit.3ssl.gzEVP_DecryptInit_ex.3ssl.gzEVP_DecryptUpdate.3ssl.gzEVP_Digest.3ssl.gzEVP_DigestFinal.3ssl.gzEVP_DigestFinalXOF.3ssl.gzEVP_DigestFinal_ex.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit_ex.3ssl.gzEVP_DigestSign.3ssl.gzEVP_DigestSignFinal.3ssl.gzEVP_DigestSignInit.3ssl.gzEVP_DigestSignUpdate.3ssl.gzEVP_DigestUpdate.3ssl.gzEVP_DigestVerify.3ssl.gzEVP_DigestVerifyFinal.3ssl.gzEVP_DigestVerifyInit.3ssl.gzEVP_DigestVerifyUpdate�x�������������7�������Xd&�
X�A��������$��������������������a@U�@T���T��T��@S�@S�@S�;@S��@S���S�~@SZN@SX��SE6@R��@R��@R�G@Ro�@Q��Q��@Q�*@Q�@Q�4�Q��Q��@Qb�@Qb�@Q�P6@P
<�P
<�P��P@O�;�OЗ�O��@O��O}�@Oy��Oi�Oi�O1@O*z�Jaroslav Rohel <jrohel@redhat.com> - 0.7.20-6Jaroslav Rohel <jrohel@redhat.com> - 0.7.20-5Nicola Sella <nsella@redhat.com> - 0.7.20-4Lukas Hrazky <lhrazky@redhat.com> - 0.7.20-3Lukas Hrazky <lhrazky@redhat.com> - 0.7.20-2Pavla Kratochvilova <pkratoch@redhat.com> - 0.7.20-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.19-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.17-2Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.17-1Nicola Sella <nsella@redhat.com> - 0.7.16-2Nicola Sella <nsella@redhat.com> - 0.7.16-1Ales Matej <amatej@redhat.org> - 0.7.11-1Ales Matej <amatej@redhat.org> - 0.7.7-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-3Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-2Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-1Jaroslav Mracek <jmracek@redhat.com> - 0.6.35-6Jaroslav Mracek <jmracek@redhat.com> - 0.6.35-5Pavla Kratochvilova <pkratoch@redhat.org> - 0.6.35-4Jaroslav Mracek <jmracek@redhat.org> - 0.6.35-3Charalampos Stratakis <cstratak@redhat.com> - 0.6.34-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.34-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.33-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.32-1Fedora Release Engineering <releng@fedoraproject.org> - 0.6.31-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.31-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-9.git.2901.47fbaa2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-8.git.2900.8bdcce1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-7.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-6.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-5.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-4.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-3.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-3.git.2887.97b8c0cPanu Matilainen <pmatilai@redhat.com> - 0.6.30-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-1Panu Matilainen <pmatilai@redhat.com> - 0.6.29-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.29-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-8Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-7Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-5Fedora Release Engineering <releng@fedoraproject.org> - 0.6.28-4Fedora Release Engineering <releng@fedoraproject.org> - 0.6.28-3Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.27-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.27-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-5.git.20.668e249Neal Gompa <ngompa13@gmail.com> - 0.6.26-4.git.19.2262346Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-3.git.19.2262346Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.25-1Vít Ondruch <vondruch@redhat.com> - 0.6.24-4Charalampos Stratakis <cstratak@redhat.com> - 0.6.24-3Orion Poplawski <orion@cora.nwra.com> - 0.6.24-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.24-1Denis Ollier <larchunix@gmail.com> - 0.6.23-6Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-5Neal Gompa <ngompa13@gmail.com> - 0.6.23-4Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-3Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.22-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.22-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.22-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.21-3Igor Gnatenko <ignatenko@redhat.com> - 0.6.21-2Igor Gnatenko <ignatenko@redhat.c�x��������������&�������Xe�%�
X��G������i!�$y����������������i!h!j!���A큤A큤A큤A큤A큤A큤A큤A큤������������������A큤A큤A큤A큤A큤A큤��������������������������A큤��������A큤A큤��������������A큤��������������������������������������������������������������A큤A큤A큤A큤A큤A큤A큤A큤��������������������������������A큤����������������������A큤����������������������������������������A큤��������������������������������A큤��������A큤��������������������������������������A큤A큤A큤��A큤��A큤��A큤��A큤����A큤������������������������������������������������������������������������������������������������A큤A큤A큤������������������������������������������A큤A큤����������������������A큤A큤A큤������������������������������������������������������������������������������������A큤����������������������������������������������������������������������������������������A큤A큤A큤A큤��������������������A큤A큤������A큤h�0+h�0+h�0+h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�0.Z�V�Z���Z���h�0.Z���Z���h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/��x�����؂��������������X��$�
���\�W�$o�����������������W�WX�	

netstat.build-id02af365b659337a181e3bbc74c2081265a555a592ccb6154db43d8767dfa239c350c2120d02d465230f7800e8fc735d08c5f616808e7cbfdc95dfd2b40b7c9f8c4d55ac1108b0f1b54719ef7335de15963228349dc9a2c7d5608c8ab36cf98f6b09212df66d1da8dc35a2689564d55e21240382c810db0c768a7554a18ea9a7f506cadfa3d7a902349677c6c7a00217c1ffe409891288ea1c88b4abf972e1365814b605f356d262b51145367bec0e383ff3d983eb49a3a51086a05d35b08781e98d7ca2279eb4f86ee6cd6a112511ef4c948c1a73a115ecbf7e9e38ef6dcfaeb39c9920deba0f183ae63cf05dbe1fe8carp-ethers.servicearpether-wakeifconfigipmaddriptunnelmii-diagmii-toolnameifplipconfigrouteslattachnet-toolsCOPYINGnet-tools.monet-tools.monet-tools.monet-tools.monet-tools.moethers.5.gzarp.8.gzifconfig.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzethers.5.gzarp.8.gzifconfig.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzethers.5.gzarp.8.gzether-wake.8.gzifconfig.8.gzipmaddr.8.gziptunnel.8.gzmii-diag.8.gzmii-tool.8.gznameif.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzarp.8.gzifconfig.8.gznetstat.8.gzroute.8.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/02//usr/lib/.build-id/2c//usr/lib/.build-id/30//usr/lib/.build-id/40//usr/lib/.build-id/63//usr/lib/.build-id/66//usr/lib/.build-id/68//usr/lib/.build-id/7a//usr/lib/.build-id/81//usr/lib/.build-id/b4//usr/lib/.build-id/ee//usr/lib/.build-id/f6//usr/lib/systemd/system//usr/sbin//usr/share/licenses//usr/share/licenses/net-tools//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/et_EE/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/man/de/man5//usr/share/man/de/man8//usr/share/man/fr/man5//usr/share/man/fr/man8//usr/share/man/man5//usr/share/man/man8//usr/share/man/pt/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ee6cd6a112511ef4c948c1a73a115ecbf7e9e38e, strippeddirectoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2ccb6154db43d8767dfa239c350c2120d02d4652, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7a00217c1ffe409891288ea1c88b4abf972e1365, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=40b7c9f8c4d55ac1108b0f1b54719ef7335de159, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=632283�x���������������������Xgf%�
�o������������pd�$`����������������pdqdod�ustom.3ssl.gzEVP_PKEY_meth_set_digestsign.3ssl.gzEVP_PKEY_meth_set_digestverify.3ssl.gzEVP_PKEY_meth_set_encrypt.3ssl.gzEVP_PKEY_meth_set_init.3ssl.gzEVP_PKEY_meth_set_keygen.3ssl.gzEVP_PKEY_meth_set_param_check.3ssl.gzEVP_PKEY_meth_set_paramgen.3ssl.gzEVP_PKEY_meth_set_public_check.3ssl.gzEVP_PKEY_meth_set_sign.3ssl.gzEVP_PKEY_meth_set_signctx.3ssl.gzEVP_PKEY_meth_set_verify.3ssl.gzEVP_PKEY_meth_set_verify_recover.3ssl.gzEVP_PKEY_meth_set_verifyctx.3ssl.gzEVP_PKEY_missing_parameters.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new_CMAC_key.3ssl.gzEVP_PKEY_new_mac_key.3ssl.gzEVP_PKEY_new_raw_private_key.3ssl.gzEVP_PKEY_new_raw_public_key.3ssl.gzEVP_PKEY_param_check.3ssl.gzEVP_PKEY_paramgen.3ssl.gzEVP_PKEY_paramgen_init.3ssl.gzEVP_PKEY_print_params.3ssl.gzEVP_PKEY_print_private.3ssl.gzEVP_PKEY_print_public.3ssl.gzEVP_PKEY_public_check.3ssl.gzEVP_PKEY_security_bits.3ssl.gzEVP_PKEY_set1_DH.3ssl.gzEVP_PKEY_set1_DSA.3ssl.gzEVP_PKEY_set1_EC_KEY.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_engine.3ssl.gzEVP_PKEY_set_alias_type.3ssl.gzEVP_PKEY_sign.3ssl.gzEVP_PKEY_sign_init.3ssl.gzEVP_PKEY_size.3ssl.gzEVP_PKEY_type.3ssl.gzEVP_PKEY_up_ref.3ssl.gzEVP_PKEY_verify.3ssl.gzEVP_PKEY_verify_init.3ssl.gzEVP_PKEY_verify_recover.3ssl.gzEVP_PKEY_verify_recover_init.3ssl.gzEVP_SealFinal.3ssl.gzEVP_SealInit.3ssl.gzEVP_SealUpdate.3ssl.gzEVP_SignFinal.3ssl.gzEVP_SignInit.3ssl.gzEVP_SignInit_ex.3ssl.gzEVP_SignUpdate.3ssl.gzEVP_VerifyFinal.3ssl.gzEVP_VerifyInit.3ssl.gzEVP_VerifyInit_ex.3ssl.gzEVP_VerifyUpdate.3ssl.gzEVP_aes.3ssl.gzEVP_aes_128_cbc.3ssl.gzEVP_aes_128_cbc_hmac_sha1.3ssl.gzEVP_aes_128_cbc_hmac_sha256.3ssl.gzEVP_aes_128_ccm.3ssl.gzEVP_aes_128_cfb.3ssl.gzEVP_aes_128_cfb1.3ssl.gzEVP_aes_128_cfb128.3ssl.gzEVP_aes_128_cfb8.3ssl.gzEVP_aes_128_ctr.3ssl.gzEVP_aes_128_ecb.3ssl.gzEVP_aes_128_gcm.3ssl.gzEVP_aes_128_ocb.3ssl.gzEVP_aes_128_ofb.3ssl.gzEVP_aes_128_wrap.3ssl.gzEVP_aes_128_wrap_pad.3ssl.gzEVP_aes_128_xts.3ssl.gzEVP_aes_192_cbc.3ssl.gzEVP_aes_192_ccm.3ssl.gzEVP_aes_192_cfb.3ssl.gzEVP_aes_192_cfb1.3ssl.gzEVP_aes_192_cfb128.3ssl.gzEVP_aes_192_cfb8.3ssl.gzEVP_aes_192_ctr.3ssl.gzEVP_aes_192_ecb.3ssl.gzEVP_aes_192_gcm.3ssl.gzEVP_aes_192_ocb.3ssl.gzEVP_aes_192_ofb.3ssl.gzEVP_aes_192_wrap.3ssl.gzEVP_aes_192_wrap_pad.3ssl.gzEVP_aes_256_cbc.3ssl.gzEVP_aes_256_cbc_hmac_sha1.3ssl.gzEVP_aes_256_cbc_hmac_sha256.3ssl.gzEVP_aes_256_ccm.3ssl.gzEVP_aes_256_cfb.3ssl.gzEVP_aes_256_cfb1.3ssl.gzEVP_aes_256_cfb128.3ssl.gzEVP_aes_256_cfb8.3ssl.gzEVP_aes_256_ctr.3ssl.gzEVP_aes_256_ecb.3ssl.gzEVP_aes_256_gcm.3ssl.gzEVP_aes_256_ocb.3ssl.gzEVP_aes_256_ofb.3ssl.gzEVP_aes_256_wrap.3ssl.gzEVP_aes_256_wrap_pad.3ssl.gzEVP_aes_256_xts.3ssl.gzEVP_aria.3ssl.gzEVP_aria_128_cbc.3ssl.gzEVP_aria_128_ccm.3ssl.gzEVP_aria_128_cfb.3ssl.gzEVP_aria_128_cfb1.3ssl.gzEVP_aria_128_cfb128.3ssl.gzEVP_aria_128_cfb8.3ssl.gzEVP_aria_128_ctr.3ssl.gzEVP_aria_128_ecb.3ssl.gzEVP_aria_128_gcm.3ssl.gzEVP_aria_128_ofb.3ssl.gzEVP_aria_192_cbc.3ssl.gzEVP_aria_192_ccm.3ssl.gzEVP_aria_192_cfb.3ssl.gzEVP_aria_192_cfb1.3ssl.gzEVP_aria_192_cfb128.3ssl.gzEVP_aria_192_cfb8.3ssl.gzEVP_aria_192_ctr.3ssl.gzEVP_aria_192_ecb.3ssl.gzEVP_aria_192_gcm.3ssl.gzEVP_aria_192_ofb.3ssl.gzEVP_aria_256_cbc.3ssl.gzEVP_aria_256_ccm.3ssl.gzEVP_aria_256_cfb.3ssl.gzEVP_aria_256_cfb1.3ssl.gzEVP_aria_256_cfb128.3ssl.gzEVP_aria_256_cfb8.3ssl.gzEVP_aria_256_ctr.3ssl.gzEVP_aria_256_ecb.3ssl.gzEVP_aria_256_gcm.3ssl.gzEVP_aria_256_ofb.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_bf_cfb.3ssl.gzEVP_bf_cfb64.3ssl.gzEVP_bf_ecb.3ssl.gzEVP_bf_ofb.3ssl.gzEVP_blake2b512.3ssl.gzEVP_blake2s256.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia_128_cbc.3ssl.gzEVP_camellia_128_cfb.3ssl.gzEVP_camellia_128_cfb1.3ssl.gzEVP_camellia_128_cfb128.3ssl.gzEVP_camellia_128_cfb8.3ssl.gzEVP_camellia_128_ctr.3ssl.gzEVP_camellia_128_ecb.3ssl.gzEVP_camellia_128_ofb.3ssl.gzEVP_camellia_192_cbc.3ssl.gzEVP_camellia_192_cfb.3ssl.gzEVP_camellia_192_cfb1.3ssl.gzEVP_camellia_192_cfb128.3ssl.gzEVP_camellia_192_cfb8.3ssl.gzEV�x�������������������Xh�%�
�������x������k!�${����������������k!j!l!�b51feaa57516b7fe10742fd4f38fdd08f74f87af36ba424dbac62d0b2e8a042ccc4c8af2d55404c8088de4a344f7c5149a58d518b6fbfbe870dac3497ad12ad774046ed9e25ab1f8c892144d777fcff065630a9b689a3a4676f048a11b8f24c44bb3cb20453548999f118bde7def64a6a41066e2b4ac0fcc6102a0902ee3948f415b55e974cee437be0fec71917862207509a5d4dcbfe7d06c7ac1503daa218837eb80df5a7262211647c634ce6bf7c3c49c2f8499a1c966b7e9ed3d2e110dbedd00331b6f23383ad51685882af50893f924dd5cf588389094d11cb08a7be56905c6cd78783b771877ea198988eb9f074300ed6974d022ec06c755e4e83b206773b4bbd98c91012db5ad56bebfd1e98a41e829bfa88bc8d24b6af30be8bf88c029b0509e1a7dd804af838035272514f9edababc4629ce365301e0ebb8fa13e1c7927b58b0febe5fcf0e17258a03006ee35489bf93ce8c311e68afd0ccc8eb7204b4c911854a4072e1b54df9bb9f251ce46fc182e45e6a9d9e6fbe837b48058ac2e4b328991fed9e46faaeb05b66919c9069e1e5579a270f8e98033f86c5ca1ec661b806efa2c2b68be1d91f12aebe960f6bb7072f5dcd2843e285195f09dd379c4003a543a954bbced910cc24a9631ff98632b415a8d3a388507dd0cb1b726e8774639940f0d8fb3395eb4ca01b69e6424e897bf9e486711172243b9ae2c935a9f510d7f2c278679a55406a45a9628b63205c39c30c2ae8954cbf34a7412f75b1523283490f44c4d9d3a71595702a760ee0599002aa5351f9b82cf633523284b28bd02d23ac16394df4c51efe7c49fd8ddaba8f9c290ae68de38065db1e3a3be17a8e53549a812195c8d3e2399bf896e2b9e5c9b01d5946687e562158d966a223d8fdc1f3fc8acbeb01b22f1b3328c051b8274cd0f3be05645869425b2f7a91a85b42152e1ba9c1a81652dca9e3f5248c373df00f320bde68ca6964aba56093047d4abfbe16584935d5f5e1601cabafcc2ad6bb6d73bf13e2e672a519a8f3277faae5f4038049e80410a543a7ccd8a4588617380e1cf54bc19e40dac720378d93b5e5f9b8cbbba186f08752ef2cd75aad8bd9770188f7ec5a905529c56036ac9af61c4445d5c1645fe4dd0bfb9a0c67fe0e21449bcb99989d65b1b4dd3f3045247a6f5612ec5cc9cdb8c2090e63828a0cba4419f4851aa230900b4f01aa4ac85d0147b4f900865d67709990791abde072bfd0b86b5e02cba0dd2b6120467a495a61952beae59929df8b162edcadb3d7951328bd2b0039a585d8edfa3f694d23b49d9491fa70650acb8914d4b1ca956dd62e24966de785bad3144c2493fd8be0e20ab887513569f56ee4054e4e8df52978b2313292938da772f85400107540753a601bdf002ab78bf0e41bf58b453bbed302817f3ff1bfbde925df5b4b0a284f2779b91c52157e280ba5f677a584a3bf0ca636056a1316c9e1084c7d80a4b476998c8dd15c91ccb150c8b27a0185d490628a1c39aa5e1eabd627dd782eae6e556d98f00f56cfa4b25b3632025e1b9b25b29fcb4242641632d697bd64e3335a8566bd23a7f6a39718e6822b11c605096b3b4191258fdcf87ed467acfd60a3843be971f1ea48f10f8fe79bda020dc28a8f0500bd2baa2d965943d11270037221c36328a7552a5895be8492c8d8c4f35858b7b38c90d6c773571df2c7aa106dd1de77cc830ab35d9d49b3a38d1f788b84ab087bad231fb75430b97d14131cbe5d6114d5c224aa74bf4a9113b65261220024bde69d9535595bbc8822fb13a214b54e144a9114a297d285207cd189b1e6b5d5e39f7a5cd78bf2d6a8784f9951069c4de087767aba803fac39d4ad50666628df989171c5fc36dff241dffb825fbbf301f0865b44d0178bf06b8d64db81f4970e70e8af616d221d0d0135abe2f789b46b30c8a8bd5eb5dcde4c28158c98cdcc7bb1445e9dd1b9aeb758ee3eee6a76d7d4d6813386b902881af5599410fb1fde8ce4bcb4dcc4f5096be533b6d51823a66974ead1646abc3ea448bfaf11d4c6b22d1b8062fd004ce20f18cb75b709da8166a85a7b38cb9e91f473ecd268ce85f24eb7f2c42bac734031887e217d3925e85db56a1d5e11358c3bb2863c74c3a66b2ab981cd39c42c19cf57d79a16afde0166cecefe177c99222906101818096bb189359eabd27a8882ce1d7848b4d3bd04a1c6c086dc1a2376e836d80d2b5046f573004d7b34a2de113f79ddcd9e882c78836fb5907a144b5b45b914103c5a8f19acaeff22500c335a28056962204a19668b9d1067ddda412066d8b6e8a13ff527b24b2bf2405972a6b54cb97d730e2f66fe20c6a566718bf0578c96b833e99e502fca4c95abba40456941347c1f766d5c027bac027e55c296b5af3e6a04f32681fb2ac17540894ad26048cba0d55333a3584e950e79fa494927933a7c2cbfaed0a1a527c3c16c3eea4ac9858bb4bb03388af33b1599e9a7a11d89d0d8a8ce5d51520e54aa60d0fa136f1f46b4f22ed85d3516bd2f058cb4aabf34b5d35b88a585fc158a375fb9fec1335a923a339dccb5b62cfce18b8a628de3554de6f41a2ec7009b7bafc4cc77c59a75b4f6a7a64626d8d162ee7dd8ac7d19dc6b58e6efe8af6df385a175a5e56b87ff984e1efc6ee11716e6c206ceeb6403e2801c2987b860885b69ae6fd831ac0b5b0cd249388591b2cd91996fb7dea644201f661855e03e1c75e03197dc7c71433f2fcb6a5fb3066e30ff3b7175bc7a4836e83f3f1dd5b1aa8ea084f673cc57dcfa45f191433e06fc714ecbb2917bc6056ab1481�x�������������p������Xi�%�
ؤ��������������N��$^����������������N�O�M��/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�3e988a918be8ddd0289b7a9d0e0a130f0bd68e7ff98881145b527cc4a0e8297b3e988a918be8ddd0289b7a9d0e0a130f0bd68e7ff98881145b527cc4a0e8297b24ade0e65ef1b3ac9a43fb272b3ae5b1c8668ddd1f0eddb30fb2a5fc4f4289c0319f2374f99145ec96cdd0d9b508766ea6eba7e804a1f1f35e22f4e0ab227ceb243f0d9554a5cae051ed2678441b8ece4420afce0e16bf075ca45f8bb13453073bcb33adc642fda10bddc272a4b3bf0d447bbc3d2ba69fa4e901670cd31464bf5baf2d3875ff1d6c92b2e144fd757c8e56e21dab19b3faa2570ac53df159217ea9674c31c73b804c3cbfefb2ae387869f7b39e86af4dbae915b900c66649ef4bd5df27a880b6a95583fc942411666c91e5854abb9f866f5f3144f6ec65077c4909c5e2ee35ee18d9043d95273f1cd37bc82e80567fd1372a1eb134c809c39504f8733a3187a07951a542ee393a01e6cd74a66f58767de4d4c15ccdacff2ecc40af3d93fd39ac15dc187be68af9eef36fe60def865f628999da8bd894cc1211c102cce578326ffb0393234fd16f4d4d2ce62deec827a6e62454df27e5a2d3d22ad368f4970279a97a108268c6e8399977f6fe221ad34b31d753495ab9b6f9d99c2042fd2fc694a0e9e01c33007dcfd998abadfbd19d90c4a92f4898746650a11e29b1db7f52d761940ad4108122fb75c6be6fd260ed4a0d42b11d64d6b34164876a412dc9e7127247d33be22a7be4c915109770dbed47c6c368a192387967a82f8941dd9aad3f7eef4d813803005bdaa4d22dac9984c64da1acfb3b8759c1ba7600ccb4fff6e9b6aed9433cdbca27b6c560d974976fbb4d052b15841a2e6ad90889f0f212c8770d7f228b0baac725f330e3c449de8c67ecd456da4fe4c3134022387acf63e8458b3a74e73d76b9d13920618e02915764644ceb2b8a7861456305765cc5b8ee54b1be3a3181d2b23fc1d4fdceef50c0c4788ce99a62d28f5c98ef904bfbb5c47c28ed4df69d251e7d90318d7ac7c01179ba9de1a28660eb65c9a4ae2e21488091ab272522de6910158f06d32382aa89f75c84581d0ecaf5ea3eb1ab85471a807140aaca7ebb7016a9df26f28a2bbf3bc300fdafbcf0326581e064778488f657288470f14c6c4d421aeda7e970943c27c049830532d653bec3854b1746eab95926b59d351e1116c6f6a417f12f181d3493e27372a62a56bb33f43282fb2b55e7e8627c6b04e6109332e8418d5a9c163236e3c2a5e13c5cb85b523fce35f295b7d125d886e647b4416ffe59caff6eb4af4656ecf86dc1a61c18aa66e3fd2963a1b19c6a1b24327e16e459fbec9db7cea9f5331e097c3b884697b7a82824d3679b1719c4a66579e9ce114c665eaad2ff40b4f2514e34b794226ec8c68ea14d655372ddb30ffeec94aa14bbcb98cd051fb6c1956fca772e822bd4cc4e112be004e9a96a242f39955d3c7d561a8c308b9cfa63c77cded987d845fd6876992a918a4e8d2c2927b1bc8048837457cb6d15552438fcbf3b13286ce82e4ba31f86d2801601f1a01bfa1fa4f139aec07b928e9093920e8147e9f7f75aa491af9db0bea641ebf0b141893419866d356227a1ec5c88ea7a4e905988cbd7a4376930ac066c3ea52685889c50ec45f1921287f224ac277b9ad9440e0374b7627ab497f4c8f29caf6f1d924385406847e55bf72164a2ade71e5617471dc95a3f8d5635cfea97083d732e7a005b8392e2719�x���������������������Xj�$�
��������@[[X�$K����������������[XZX\X�files location in /sbin.- Update to upstream
        * Merged more translations from Dan Walsh.
        * Merged patch to relocate setfiles to /sbin for early relabel
          when /usr might not be mounted from Dan Walsh.
        * Merged semanage/seobject patch to preserve fcontext ordering in list.
        * Merged secon patch from James Antill.- Fix seobject.py to not sort the file_context file.
- move setfiles to /sbin- secon man page and getopt fixes.
- Enable mass relabel audit, even though it doesn't work.- secon fixes for --self-exec etc.
- secon change from level => sensitivity, add clearance.
- Add mass relabel AUDIT patch, but disable it until kernel problem solved.- Update to upstream
        * Merged patch with updates to audit2allow, secon, genhomedircon,
          and semanage from Dan Walsh.- Fix exception in genhomedircon- Add rhpl dependancy- Add secon man page and prompt options.- Update to upstream
        * Fixed audit2allow and po Makefiles for DESTDIR= builds.
        * Merged .po file patch from Dan Walsh.
        * Merged bug fix for genhomedircon.- Fix exception on bad file_context- Update to upstream
        * Merged fix warnings patch from Karl MacMillan.
        * Merged patch from Dan Walsh.
          This includes audit2allow changes for analysis plugins,
          internationalization support for several additional programs
          and added po files, some fixes for semanage, and several cleanups.
          It also adds a new secon utility.- Fix genhomedircon to catch duplicate homedir problem- Add secon program
- Add translations- Fix check for "msg"- Ship avc.py- Add /etc/samba/secrets.tdb to restorecond.conf
- Update from upstream
        * Merged semanage prefix support from Russell Coker.
        * Added a test to setfiles to check that the spec file is
          a regular file.- added some missing buildrequires
- added Requires: initscripts for /sbin/service- use absolute path /sbin/service- Fix audit2allow to not require ausearch.
- Fix man page
- Add libflashplayer to restorecond.conf- Update from upstream
        * Merged audit2allow fixes for refpolicy from Dan Walsh.
        * Merged fixfiles patch from Dan Walsh.
        * Merged restorecond daemon from Dan Walsh.
        * Merged semanage non-MLS fixes from Chris PeBenito.
        * Merged semanage and semodule man page examples from Thomas Bleher.- Clean up reference policy generation in audit2allow- Add IN_MOVED_TO to catch renames- make restorecond only ignore non directories with lnk > 1- Make audit2allow translate dontaudit as well as allow rules
- Update from upstream
        * Merged semanage labeling prefix patch from Ivan Gyurdiev.- Fix audit2allow to retrieve dontaudit rules- Open file descriptor to make sure file does not change from underneath.- Fixes for restorecond attack via symlinks
- Fixes for fixfiles- Restorecon has to handle suspend/resume- Update to upstream- Add restorecond- Remove prereq- Fix audit2allow to generate all rules- Minor fixes to chcat and semanage- Add missing setsebool man page- Change audit2allow to use devel instead of refpolicy- Update from upstream
        * Merged semanage bug fix patch from Ivan Gyurdiev.
        * Merged improve bindings patch from Ivan Gyurdiev.
        * Merged semanage usage patch from Ivan Gyurdiev.
        * Merged use PyList patch from Ivan Gyurdiev.- Update from upstream
        * Merged newrole -V/--version support from Glauber de Oliveira Costa.
        * Merged genhomedircon prefix patch from Dan Walsh.
        * Merged optionals in base patch from Joshua Brindle.- bump again for double-long bug on ppc(64)- Fix auditing to semanage
- Change genhomedircon to use new prefix interface in libselinux- Update from upstream
        * Merged seuser/user_extra support patch to semodule_package
          from Joshua Brindle.
        * Merged getopt type fix for semodule_link/expand and sestatus
          from Chris PeBenito.
- Fix genhomedircon output- rebuilt for new gcc4.1 snapshot and glibc cha�x�������������`�������Xk�$�
8�x���$m��������������������encryption works also without volume keys put in kernel
  keyring service.
- Resolves: #1757783 #1750680 #1753597 #1743399- patch: Fix mapped segments overflow on 32bit architectures.
- patch: Take optimal io size in account with LUKS2 reencryption.
- Resolves: #1742815 #1746532- Update to cryptsetup 2.2.0 (final)
- Resolves: #1738263 #1740342 #1733391 #1729600 #1733390- Updates to reencryption feature.
- Resolves: #1676622- Update to cryptsetup 2.2.0
- remove python bits from spec file.
- Resolves: #1676622- Add gating tests.
- Resolves: #1682539- Update to cryptsetup 2.0.6
- Enables all supported metadata sizes in LUKS2 validation code.
- Resolves: #1653383- patch: fix device alignment bug when processing hinted
  value by device topology info.
- Resolves: #1614219- Update to cryptsetup 2.0.4.
- patch: Add RHEL system library paths in configure.
- patch: Increase default LUKS2 header size to 8 MiBs.
- patch: update tests to be compatible with larger headers.
- Set default format to LUKS2.
- Cleanup changelog.
- Resolves: #1564540 #1595257 #1595266 #1595881 #1600164- Update to cryptsetup 2.0.3.- Rebuilt for libjson-c.so.4 (json-c v0.13.1) on fc28- Update to cryptsetup 2.0.2./sbin/ldconfig/sbin/ldconfigcryptsetup-luks-libs	

csdadeesfifriditjanlplptrusrsvukvizh��2.3.7-7.el82.3.7-7.el82.3.7-7.el81.4.0	

cryptsetup.build-id8c384cf3ea462026aedc9924b6e569eec1e93cb2cryptsetup.conflibcryptsetup.so.12libcryptsetup.so.12.6.0cryptsetup-libsCOPYINGCOPYING.LGPLcryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mo/run//usr/lib//usr/lib/.build-id//usr/lib/.build-id/8c//usr/lib/tmpfiles.d//usr/lib64//usr/share/licenses//usr/share/licenses/cryptsetup-libs//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8c384cf3ea462026aedc9924b6e569eec1e93cb2, strippedPPRRRRRRRRR	RRR
RRRR
RRRRRRRRRRRR utf-8408545425e50238e80edb006c5232a5bf2f8b6a10a36�x�������������ز�������Xl�%�
���������A�������!�$�����������������!�!�!�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?�x�������������P��������Xm�%�
P�������P�������;��$+����������������;�<�:��M=i�M�M�L�L�7�L��@L��@L��@L�d�L�@L��@L��@L�{�L�A@L�)@L�)@L�)@L�)@Lk�@LMx�L>�@L9�@L7@L5��L(��L�K��K�.�Kы�KŮ@KŮ@K�"@K�r�K�!@K��@K��@K��@K��Kl@K0��K/c@K+n�K+n�K�@K�@K�@K�@KV�K@K��K�Ję�Ję�J��@J�u@J���J��@Jr�Jn�@Jm��Jj�JW-@JS8�JS8�J,�@J'�@J&e�I�4�I�@@I�@@I̿�I��@I�y�I���I���I�V@I��@I�U@I�U@I�w�I�1�Itk@IO�@IBR@I/�@I*�@Ig@H��H�O@H�f@H�f@H��@Hϟ�H�@H��H�@�H���H�z@Hu��Ht�@Hl�@Hj@Hd�@H`�HO�@HNl�HI&�H:�@H5`@H1k�H.�G߮�G߮�G߮�G߮�G߮�G��G��G��G�.@G�.@G�.@G�.@G�.@G��@G��G�f�G�f�G��G��@G�e�GN��Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-423Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-422Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-421Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-420Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-419Petr Pisar <ppisar@redhat.com> - 4:5.26.3-418Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-417Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-416Petr Pisar <ppisar@redhat.com> - 4:5.26.2-415Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-414Petr Pisar <ppisar@redhat.com> - 4:5.26.2-413Petr Pisar <ppisar@redhat.com> - 4:5.26.2-412Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-411Petr Pisar <ppisar@redhat.com> - 4:5.26.2-410Florian Weimer <fweimer@redhat.com> - 4:5.26.1-409Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.1-408Petr Pisar <ppisar@redhat.com> - 4:5.26.1-407Petr Pisar <ppisar@redhat.com> - 4:5.26.1-406Petr Pisar <ppisar@redhat.com> - 4:5.26.1-405Björn Esser <besser82@fedoraproject.org> - 4:5.26.1-404Petr Pisar <ppisar@redhat.com> - 4:5.26.1-403Petr Pisar <ppisar@redhat.com> - 4:5.26.1-402Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-401Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-400Petr Pisar <ppisar@redhat.com> - 4:5.26.0-399Petr Pisar <ppisar@redhat.com> - 4:5.26.0-398Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.0-397Fedora Release Engineering <releng@fedoraproject.org> - 4:5.26.0-396Petr Pisar <ppisar@redhat.com> - 4:5.26.0-395Petr Pisar <ppisar@redhat.com> - 4:5.26.0-394Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-393Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-392Petr Pisar <ppisar@redhat.com> - 4:5.24.1-391Petr Pisar <ppisar@redhat.com> - 4:5.24.1-390Petr Pisar <ppisar@redhat.com> - 4:5.24.1-389Petr Pisar <ppisar@redhat.com> - 4:5.24.1-388Petr Pisar <ppisar@redhat.com> - 4:5.24.1-387Petr Pisar <ppisar@redhat.com> - 4:5.24.1-386Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.1-385Igor Gnatenko <ignatenko@redhat.com> - 4:5.24.0-384Petr Pisar <ppisar@redhat.com> - 4:5.24.0-383Petr Pisar <ppisar@redhat.com> - 4:5.24.0-382Petr Pisar <ppisar@redhat.com> - 4:5.24.0-381Petr Pisar <ppisar@redhat.com> - 4:5.24.0-380Petr Pisar <ppisar@redhat.com> - 4:5.24.0-379Petr Pisar <ppisar@redhat.com> - 4:5.24.0-378Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-377Petr Pisar <ppisar@redhat.com> - 4:5.24.0-376Petr Pisar <ppisar@redhat.com> - 4:5.24.0-375Petr Pisar <ppisar@redhat.com> - 4:5.24.0-374Petr Pisar <ppisar@redhat.com> - 4:5.24.0-373Petr Pisar <ppisar@redhat.com> - 4:5.24.0-372Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-371Petr Pisar <ppisar@redhat.com> - 4:5.24.0-370Petr Pisar <ppisar@redhat.com> - 4:5.24.0-369Petr Pisar <ppisar@redhat.com> - 4:5.24.0-368Petr Pisar <ppisar@redhat.com> - 4:5.24.0-367Petr Pisar <ppisar@redhat.com> - 4:5.24.0-366Petr Pisar <ppisar@redhat.com> - 4:5.24.0-365Petr Pisar <ppisar@redhat.com> - 4:5.24.0-364Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-363Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-362Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.6-361Petr Pisar <ppisar@redhat.com> - 4:5.22.1-360Petr Pisar <ppisar@redhat.com> - 4:5.22.1-359Petr Pisar <ppisar@redhat.com> - 4:5.22.1-358Petr Pisar <ppisar@redhat.com> - 4:5.22.1-357Fedora Release Engineering <releng@fedoraproject.org> - 4:5.22.1-356Petr Pisar <ppisar@redhat.com> - 4:5.22.1-355Jitka Plesnikova <jplesnik@redhat.com> - 5.22.1-354Petr Pisar <ppisar@redhat.com> - 4:5.22.0-353Petr Pisar <pp�x�������������ȑ�������Xn�%�
�o������`�������p�$`����������������pq�O1�?,|d����	�	2���������������	���7�=�D��,\	t
���
��Ut��	<�(�8�99�9:^9=&Q>&Y?&a@&iG&tH&�I&�X&�Y&�\']'D^'�b(�d)�e)�f)�l)�t)�u*,v*\w+�x+�y+�
�,,�,0�,6�,x,�,�6.�.�6
115�1x1|1�g1�h1�Ctrousers0.3.152.el8TCG's Software Stack v1.2TrouSerS is an implementation of the Trusted Computing Group's Software Stack
(TSS) specification. You can use TrouSerS to write applications that make use
of your TPM hardware. TPM hardware can create, store and use RSA keys
securely (without ever being exposed in memory), verify a platform's software
state using cryptographic hashes and more.fC0x64-ci01.almalinux.org�^AlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>System Environment/Librarieshttp://trousers.sourceforge.netlinuxx86_64getent group tss >/dev/null || groupadd -f -g 59 -r tss
if ! getent passwd tss >/dev/null ; then
    if ! getent passwd 59 >/dev/null ; then
      useradd -r -u 59 -g tss -d / -s /sbin/nologin -c "Account used for TPM access" tss
    else
      useradd -r -g tss -d / -s /sbin/nologin -c "Account used for TPM access" tss
    fi
fi
exit 0
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset tcsd.service &>/dev/null || : 
fi
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now tcsd.service &>/dev/null || : 
fi
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart tcsd.service &>/dev/null || : 
fi�����\"u���A�A�����A큤������A�fC/fC0fC0fC0fC/fC0fC0_�L�^�S�fC&fC&fC/eb009b7d1132ac33411e8f838c7e272606c8dd1d8944bc8b82ee28f9114e82fcfbdf7fb4f1584000a9d8325dc3bf855a60cae23f039bb062b7a8ea4edfd3e06e848efbe9340b08caa03efa4dce2bd67f14347139f66ef9e79f3202d21d2031a0fccf2c7a906ae571849fc1bacd98f3e070e4da85b2ec6e937aa45ca1323b55efe10fd3096b3fca327b01803d91959817028371fe8d9e1970256bc56aeb1bdc11f757ef7717ef3bea4827b60c632bebaad57f3f797e4ae16586488544462d7a953a5f497a4a34f03c8da37d1b0e530389d504b1c14b72c85c64d1a9342bce1002../../../../usr/sbin/tcsdrootrootrootrootrootrootrootrootrootrootroottsstssrootrootrootrootrootrootrootrootrootroottsstrousers-0.3.15-2.el8.src.rpm������������������������������������������������config(trousers)trouserstrousers(x86-64)	@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/sh/bin/shconfig(trousers)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)rpmlib(CompressedFileNames)rp�x�������������0��������Xo`%�
���������������vd�$f����������������vdwdud�cure_malloc_init.3ssl.gzCRYPTO_secure_malloc_initialized.3ssl.gzCRYPTO_secure_used.3ssl.gzCRYPTO_secure_zalloc.3ssl.gzCRYPTO_set_ex_data.3ssl.gzCRYPTO_set_mem_debug.3ssl.gzCRYPTO_set_mem_functions.3ssl.gzCRYPTO_strdup.3ssl.gzCRYPTO_strndup.3ssl.gzCRYPTO_zalloc.3ssl.gzCTLOG_STORE_free.3ssl.gzCTLOG_STORE_get0_log_by_id.3ssl.gzCTLOG_STORE_load_default_file.3ssl.gzCTLOG_STORE_load_file.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_free.3ssl.gzCTLOG_get0_log_id.3ssl.gzCTLOG_get0_name.3ssl.gzCTLOG_get0_public_key.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new_from_base64.3ssl.gzCT_POLICY_EVAL_CTX_free.3ssl.gzCT_POLICY_EVAL_CTX_get0_cert.3ssl.gzCT_POLICY_EVAL_CTX_get0_issuer.3ssl.gzCT_POLICY_EVAL_CTX_get0_log_store.3ssl.gzCT_POLICY_EVAL_CTX_get_time.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_set1_cert.3ssl.gzCT_POLICY_EVAL_CTX_set1_issuer.3ssl.gzCT_POLICY_EVAL_CTX_set_shared_CTLOG_STORE.3ssl.gzCT_POLICY_EVAL_CTX_set_time.3ssl.gzDECLARE_ASN1_FUNCTIONS.3ssl.gzDECLARE_LHASH_OF.3ssl.gzDECLARE_PEM_rw.3ssl.gzDEFINE_SPECIAL_STACK_OF.3ssl.gzDEFINE_SPECIAL_STACK_OF_CONST.3ssl.gzDEFINE_STACK_OF.3ssl.gzDEFINE_STACK_OF_CONST.3ssl.gzDES_cbc_cksum.3ssl.gzDES_cfb64_encrypt.3ssl.gzDES_cfb_encrypt.3ssl.gzDES_crypt.3ssl.gzDES_ecb2_encrypt.3ssl.gzDES_ecb3_encrypt.3ssl.gzDES_ecb_encrypt.3ssl.gzDES_ede2_cbc_encrypt.3ssl.gzDES_ede2_cfb64_encrypt.3ssl.gzDES_ede2_ofb64_encrypt.3ssl.gzDES_ede3_cbc_encrypt.3ssl.gzDES_ede3_cfb64_encrypt.3ssl.gzDES_ede3_ofb64_encrypt.3ssl.gzDES_fcrypt.3ssl.gzDES_is_weak_key.3ssl.gzDES_key_sched.3ssl.gzDES_ncbc_encrypt.3ssl.gzDES_ofb64_encrypt.3ssl.gzDES_ofb_encrypt.3ssl.gzDES_pcbc_encrypt.3ssl.gzDES_quad_cksum.3ssl.gzDES_random_key.3ssl.gzDES_set_key.3ssl.gzDES_set_key_checked.3ssl.gzDES_set_key_unchecked.3ssl.gzDES_set_odd_parity.3ssl.gzDES_string_to_2keys.3ssl.gzDES_string_to_key.3ssl.gzDES_xcbc_encrypt.3ssl.gzDH_OpenSSL.3ssl.gzDH_bits.3ssl.gzDH_check.3ssl.gzDH_check_ex.3ssl.gzDH_check_params.3ssl.gzDH_check_params_ex.3ssl.gzDH_check_pub_key_ex.3ssl.gzDH_clear_flags.3ssl.gzDH_compute_key.3ssl.gzDH_compute_key_padded.3ssl.gzDH_free.3ssl.gzDH_generate_key.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters_ex.3ssl.gzDH_get0_engine.3ssl.gzDH_get0_g.3ssl.gzDH_get0_key.3ssl.gzDH_get0_p.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_priv_key.3ssl.gzDH_get0_pub_key.3ssl.gzDH_get0_q.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_2048_224.3ssl.gzDH_get_2048_256.3ssl.gzDH_get_default_method.3ssl.gzDH_get_ex_data.3ssl.gzDH_get_ex_new_index.3ssl.gzDH_get_length.3ssl.gzDH_get_nid.3ssl.gzDH_meth_dup.3ssl.gzDH_meth_free.3ssl.gzDH_meth_get0_app_data.3ssl.gzDH_meth_get0_name.3ssl.gzDH_meth_get_bn_mod_exp.3ssl.gzDH_meth_get_compute_key.3ssl.gzDH_meth_get_finish.3ssl.gzDH_meth_get_flags.3ssl.gzDH_meth_get_generate_key.3ssl.gzDH_meth_get_generate_params.3ssl.gzDH_meth_get_init.3ssl.gzDH_meth_new.3ssl.gzDH_meth_set0_app_data.3ssl.gzDH_meth_set1_name.3ssl.gzDH_meth_set_bn_mod_exp.3ssl.gzDH_meth_set_compute_key.3ssl.gzDH_meth_set_finish.3ssl.gzDH_meth_set_flags.3ssl.gzDH_meth_set_generate_key.3ssl.gzDH_meth_set_generate_params.3ssl.gzDH_meth_set_init.3ssl.gzDH_new.3ssl.gzDH_new_by_nid.3ssl.gzDH_new_method.3ssl.gzDH_security_bits.3ssl.gzDH_set0_key.3ssl.gzDH_set0_pqg.3ssl.gzDH_set_default_method.3ssl.gzDH_set_ex_data.3ssl.gzDH_set_flags.3ssl.gzDH_set_length.3ssl.gzDH_set_method.3ssl.gzDH_size.3ssl.gzDH_test_flags.3ssl.gzDHparams_print.3ssl.gzDHparams_print_fp.3ssl.gzDIRECTORYSTRING_free.3ssl.gzDIRECTORYSTRING_new.3ssl.gzDISPLAYTEXT_free.3ssl.gzDISPLAYTEXT_new.3ssl.gzDIST_POINT_NAME_free.3ssl.gzDIST_POINT_NAME_new.3ssl.gzDIST_POINT_free.3ssl.gzDIST_POINT_new.3ssl.gzDSA_OpenSSL.3ssl.gzDSA_SIG_free.3ssl.gzDSA_SIG_get0.3ssl.gzDSA_SIG_new.3ssl.gzDSA_SIG_set0.3ssl.gzDSA_bits.3ssl.gzDSA_clear_flags.3ssl.gzDSA_do_sign.3ssl.gzDSA_do_verify.3ssl.gzDSA_dup_DH.3ssl.gzDSA_free.3ssl.gzDSA_generate_key.3ssl.gzDSA_generate_parameters.3ssl.gzDSA_generate_parameters_ex.3ssl.gzDSA_get0_engine.3ssl.gzDSA_get0�x��������������p�������Xp�%�
��������p���$Z��������������������urity -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

 !!"#$%&'()********************ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7e9ab2694d74d7806909a3870baeb6eae6ec0329, stripped, too many notes (256)ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=32c1394bd094b3d348d5c499c7e0a469c30d254b, stripped, too many notes (256)POSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=041a454fb24bb87f4a680a9e44e4210f7aff9b30, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8f493b78bb8c2a6c9ec3871bb0f664c3bb01c128, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2e4e511446305fac8274d5928a72d82fd53e3285, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b77967f6069c312b906edcd699b8e115de3a5d1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cf985a1ded20cf35f4d74d8e2ab1e09449881623, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=245354ef87a746eb3951f578a1e74ce4a5ca73bc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0772c98b0f3d47f44fd5e5360553af0301a899e9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]�x��������������_�������XqU%�
��������+�d�$�����������������d�d�d�rstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������												
			
																			 	!	"	#	$	%	&	'	(	)	*	+	,	-	.	/	0	1	2	3	4	5	6	7	8	9	:	;	<	=	>	?	@	A	B	C	D	E	F	G	H	I	J	K	L	M	N	O	P	Q	R	S	T	U	V	W	X	Y	Z	[	\	]	^	_	`	a	b	c	d	e	f	g	h	i	j	k	l	m	n	o	p	q	r	s	t	u	v	w	x	y	z	{	|	}	~		�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�









	
























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j�x��������������O�������XrA%�
���������d�$�����������������d�d�d�?I�@?��?�?��?
U@?
�@>��@>��@>��>��>��@>��@>�v�>�@>��@>�G�>�E�>x[�>u��>e�>]��>Sq�>Sq�>K��>G�@>.��>'�@>%M@>d@>�>{@=��=�(�=�=�=��=O�@=I"�=G�@=G�@=E.@=?�@=5\@=@<��@<��<�@<�@@<��@<�b�<��@<���<9��<9��;�8@;��;��@;���;���;�A�;��@;s�;r{@;\�;Uz@;T(�;L?�;DV�;A��;7'�;-�@;l�;��;�@;k�;@;@:�@:�_@:�j�:�R�:��:��@:��:��@:��@:���:�E@:��@:0�@:@:W@9��@9��@9�y�9�x�9Џ�9�1�9��@9���9���9�v�9r�@9k@9dt�9_.�9[:@9Y�9@�@97��8�@8�@8���8[w@8,@8��Maurizio Barbaro <mbarbaro@redhat.com> - 1:1.1.1k-14Dmitry Belyavskiy <dbelyavs@redhat.com> - 1:1.1.1k-12Clemens Lang <cllang@redhat.com> - 1:1.1.1k-11Clemens Lang <cllang@redhat.com> - 1:1.1.1k-10Dmitry Belyavskiy <dbelyavs@redhat.com> - 1:1.1.1k-9Dmitry Belyavskiy <dbelyavs@redhat.com> - 1:1.1.1k-8Clemens Lang <cllang@redhat.com> - 1:1.1.1k-7Clemens Lang <cllang@redhat.com> - 1:1.1.1k-6Sahana Prasad <sahana@redhat.com> - 1:1.1.1k-5Sahana Prasad <sahana@redhat.com> - 1:1.1.1k-4Sahana Prasad <sahana@redhat.com> - 1:1.1.1k-3Dmitry Belyavskiy <dbelyavs@redhat.com> - 1:1.1.1k-2Sahana Prasad <sahana@redhat.com> 1.1.1k-1Daiki Ueno <dueno@redhat.com> 1.1.1g-16Dmitry Belyavski <dbelyavs@redhat.com> 1.1.1g-15Sahana Prasad <sahana@redhat.com> 1.1.1g-14Sahana Prasad <sahana@redhat.com> 1.1.1g-13Tomáš Mráz <tmraz@redhat.com> 1.1.1g-12Tomáš Mráz <tmraz@redhat.com> 1.1.1g-11Tomáš Mráz <tmraz@redhat.com> 1.1.1g-9Tomáš Mráz <tmraz@redhat.com> 1.1.1g-7Tomáš Mráz <tmraz@redhat.com> 1.1.1g-6Tomáš Mráz <tmraz@redhat.com> 1.1.1g-5Tomáš Mráz <tmraz@redhat.com> 1.1.1g-1Tomáš Mráz <tmraz@redhat.com> 1.1.1c-15Tomáš Mráz <tmraz@redhat.com> 1.1.1c-14Tomáš Mráz <tmraz@redhat.com> 1.1.1c-12Tomáš Mráz <tmraz@redhat.com> 1.1.1c-9Tomáš Mráz <tmraz@redhat.com> 1.1.1c-8Tomáš Mráz <tmraz@redhat.com> 1.1.1c-7Tomáš Mráz <tmraz@redhat.com> 1.1.1c-6Tomáš Mráz <tmraz@redhat.com> 1.1.1c-5Tomáš Mráz <tmraz@redhat.com> 1.1.1c-4Tomáš Mráz <tmraz@redhat.com> 1.1.1c-3Tomáš Mráz <tmraz@redhat.com> 1.1.1c-2Tomáš Mráz <tmraz@redhat.com> 1.1.1c-1Tomáš Mráz <tmraz@redhat.com> 1.1.1b-6Tomáš Mráz <tmraz@redhat.com> 1.1.1b-5Tomáš Mráz <tmraz@redhat.com> 1.1.1b-3Tomáš Mráz <tmraz@redhat.com> 1.1.1b-1Tomáš Mráz <tmraz@redhat.com> 1.1.1-8Tomáš Mráz <tmraz@redhat.com> 1.1.1-7Tomáš Mráz <tmraz@redhat.com> 1.1.1-6Tomáš Mráz <tmraz@redhat.com> 1.1.1-5Tomáš Mráz <tmraz@redhat.com> 1.1.1-4Tomáš Mráz <tmraz@redhat.com> 1.1.1-3Tomáš Mráz <tmraz@redhat.com> 1.1.1-2Tomáš Mráz <tmraz@redhat.com> 1.1.1-1Tomáš Mráz <tmraz@redhat.com> 1.1.1-0.pre9.1Tomáš Mráz <tmraz@redhat.com> 1.1.1-0.pre8.4Tomáš Mráz <tmraz@redhat.com> 1.1.1-0.pre8.3Tomáš Mráz <tmraz@redhat.com> 1.1.1-0.pre8.2Tomáš Mráz <tmraz@redhat.com> 1.1.1-0.pre8Fedora Release Engineering <releng@fedoraproject.org> - 1:1.1.0h-6Tomáš Mráz <tmraz@redhat.com> 1.1.0h-5Tomáš Mráz <tmraz@redhat.com> 1.1.0h-4Tomáš Mráz <tmraz@redhat.com> 1.1.0h-3Tomáš Mráz <tmraz@redhat.com> 1.1.0h-2Tomáš Mráz <tmraz@redhat.com> 1.1.0h-1Tomáš Mráz <tmraz@redhat.com> 1.1.0g-6Fedora Release Engineering <releng@fedoraproject.org> - 1:1.1.0g-5Tomáš Mráz <tmraz@redhat.com> 1.1.0g-4Tomáš Mráz <tmraz@redhat.com> 1.1.0g-3Tomáš Mráz <tmraz@redhat.com> 1.1.0g-2Tomáš Mráz <tmraz@redhat.com> 1.1.0g-1Fedora Release Engineering <releng@fedoraproject.org> - 1:1.1.0f-9Fedora Release Engineering <releng@fedoraproject.org> - 1:1.1.0f-8Tomáš Mráz <tmraz@redhat.com> 1:1.1.0f-7Petr Pisar <ppisar@redhat.com> - 1:1.1.0f-6Tomáš Mráz <tmraz@redhat.com> 1.1.0f-5Tomáš Mráz <tmraz@redhat.com> 1.1.0f-4Tomáš Mráz <tmraz@redhat.com> 1.1.0f-3Tomáš Mráz <tmraz@redhat.com> 1.1.0f-2Tomáš Mráz <tmraz@redhat.com> 1.1.0f-1Tomáš Mráz <tmraz@redhat.com> 1.1.0e-1Fedora Release Engineering <releng@fedoraproject.org> - 1:1.1.0d-3Tomáš Mráz <tmraz@redhat.com> 1.1.0d-2Tomáš Mráz <tmraz@redhat.com> 1.1.0d-1Tomáš Mráz <tmraz@redhat.com> 1.1.0c-5Tomáš Mráz <tmraz@redhat.com> 1.1.0c�x�����`��������>�������X��%�
���������a������V�$�����������������VVV�	

 !"##$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&%&%&&&%!&&%%'%!&%%%%($�x��������������.�������Xt�%�
���������>������<��$,����������������<�=�;��rray)perl(Tie::StdHandle)perl(Tie::StdHash)perl(Tie::StdScalar)perl(Tie::SubstrHash)perl(Time::gmtime)perl(Time::localtime)perl(Time::tm)perl(UNIVERSAL)perl(Unicode::UCD)perl(User::grent)perl(User::pwent)perl(_charnames)perl(arybase)perl(attributes)perl(autouse)perl(base)perl(blib)perl(bytes)perl(bytes_heavy.pl)perl(charnames)perl(deprecate)perl(diagnostics)perl(dumpvar.pl)perl(encoding::warnings)perl(feature)perl(fields)perl(filetest)perl(if)perl(less)perl(lib)perl(locale)perl(mro)perl(ops)perl(overload)perl(overload::numbers)perl(overloading)perl(perl5db.pl)perl(sigtrap)perl(sort)perl(subs)perl(vars)perl(vmsish)perl(warnings::register)perl-interpreterperl-interpreter(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@




@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libdl.so.2()(64bit)libgdbm.so.6()(64bit)libgdbm_compat.so.4()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libm.so.6(GLIBC_2.23)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libutil.so.1()(64bit)perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(B)perl(B::Concise)perl(B::Op_private)perl(B::Terse)perl(Carp)perl(Class::Struct)perl(Config)perl(Cwd)perl(Exporter)perl(ExtUtils::Constant::Base)perl(ExtUtils::Constant::Utils)perl(ExtUtils::Constant::XS)perl(Fcntl)perl(File::Basename)perl(File::Path)perl(File::Spec)perl(File::Spec::Functions)perl(I18N::LangTags)perl(IO::File)perl(IPC::Open3)perl(Opcode)perl(POSIX)perl(Scalar::Util)perl(Symbol)perl(Text::Tabs)perl(Text::Wrap)perl(Tie::Handle)perl(Tie::Hash)perl(Tie::StdHandle)perl(Time::tm)perl(Unicode::Normalize)perl(XSLoader)perl(_charnames)perl(bytes)perl(charnames)perl(constant)perl(feature)perl(if)perl(integer)perl(overload)perl(parent)perl(re)perl(strict)perl(subs)perl(threads)perl(threads::shared)perl(unicore::Name)perl(utf8)perl(vars)perl(warnings)perl(warnings::register)perl-libsperl-libs(x86-64)perl-macrosrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)5.0.05.10.15.24.05.3.05.5.05.6.05.7.05.7.35.8.05.9.15.9.41.011.104:5.26.3-423.el8_103.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3he@c���ama�`�9@_��@_ܙ�_��@\	@[�<@[�]�[CN@[��Z��@ZԐ@Z��@Z}�@Zy��Zs@Zo�Zc/@Z\��ZT��Y��Y��Y��Y���Y|x�Yy�YS�@YG��Y6�@Y0�X�D�X��@X��X��@X��X���X|��Xwo�Xo��XW�X@�X#�X&�W�i�W��@W��W�P�W��W��W~D@W~D@WzO�Wm �Wj}�Wg�Wb��W_�W=��W<Y@W3�W'A@W�@V�@V�x�V��V�=@Vp�Vn�@V&,�V�@V�@Uĝ�U���U��@U��U���U���Ux&�Up=�Un�@UlI@U.R�U/@U/@U�@U
�@U�T�s@T�~�T�-@T��Tܕ�Tи@T�7�T|X@Tl�@Td�@TcK�TP�TH�T&@T�T=@TH�S��S�@S�S׌�S�\�S��S���SF��S>��R�R��@R�a@R�&�R�&�R�@R�v@Rfh�R-�@R
�Q��Q��@Q��Q�@Qک�Q�c�Q��Q��Q�b�Q�@Q�y�Q�?@Q��Q��Q��@Qzl@QeT@Qd�Q^��Q^��QP<@QLG�QJ�@QHS@QC
@QA��Q5�@Q"�Q�Q�Q�@Q�Q�@Q�@Q��Q	@Q	@Q��Qs�P��@P�P�@P�Z�P�Z�P��@P��P~��P`K@P\V�P[@PXb@PS@PPy@PO'�PG>�P7l�P(�@P#�@P#�@P	H@P
�O�@O�O�R�OЗ�O�F@O�F@OȮ�OȮ�O�]@O�t@O���O�~�O��@O�@O� �OC�@O/��O(@O�@O�@N�x�N�N��@N�1�N��@N�=@N�H�N��@N�0�N�S@N�
@N�$@N��@N��@N���N���N��@Ny�Nq�NoE�N\�NG��N;�@N2��N.�@N)f@N%q�N!}@N��Np�N*�N��M�6@M�6@M�6@M��@M���M���M�M�M�M�)�M��M��@M��@M��@M��@MT�M_��MQ0@MA^@M@�M@�M>�@�x��������������������Xui%�
@��)md�$}����������������mdndld�rlcpy.3ssl.gzOPENSSL_strndup.3ssl.gzOPENSSL_thread_stop.3ssl.gzOPENSSL_zalloc.3ssl.gzOSSL_STORE_CTX.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO_free.3ssl.gzOSSL_STORE_INFO_get0_CERT.3ssl.gzOSSL_STORE_INFO_get0_CRL.3ssl.gzOSSL_STORE_INFO_get0_NAME.3ssl.gzOSSL_STORE_INFO_get0_NAME_description.3ssl.gzOSSL_STORE_INFO_get0_PARAMS.3ssl.gzOSSL_STORE_INFO_get0_PKEY.3ssl.gzOSSL_STORE_INFO_get1_CERT.3ssl.gzOSSL_STORE_INFO_get1_CRL.3ssl.gzOSSL_STORE_INFO_get1_NAME.3ssl.gzOSSL_STORE_INFO_get1_NAME_description.3ssl.gzOSSL_STORE_INFO_get1_PARAMS.3ssl.gzOSSL_STORE_INFO_get1_PKEY.3ssl.gzOSSL_STORE_INFO_get_type.3ssl.gzOSSL_STORE_INFO_new_CERT.3ssl.gzOSSL_STORE_INFO_new_CRL.3ssl.gzOSSL_STORE_INFO_new_NAME.3ssl.gzOSSL_STORE_INFO_new_PARAMS.3ssl.gzOSSL_STORE_INFO_new_PKEY.3ssl.gzOSSL_STORE_INFO_set0_NAME_description.3ssl.gzOSSL_STORE_INFO_type_string.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER_CTX.3ssl.gzOSSL_STORE_LOADER_free.3ssl.gzOSSL_STORE_LOADER_get0_engine.3ssl.gzOSSL_STORE_LOADER_get0_scheme.3ssl.gzOSSL_STORE_LOADER_new.3ssl.gzOSSL_STORE_LOADER_set_close.3ssl.gzOSSL_STORE_LOADER_set_ctrl.3ssl.gzOSSL_STORE_LOADER_set_eof.3ssl.gzOSSL_STORE_LOADER_set_error.3ssl.gzOSSL_STORE_LOADER_set_expect.3ssl.gzOSSL_STORE_LOADER_set_find.3ssl.gzOSSL_STORE_LOADER_set_load.3ssl.gzOSSL_STORE_LOADER_set_open.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH_by_alias.3ssl.gzOSSL_STORE_SEARCH_by_issuer_serial.3ssl.gzOSSL_STORE_SEARCH_by_key_fingerprint.3ssl.gzOSSL_STORE_SEARCH_by_name.3ssl.gzOSSL_STORE_SEARCH_free.3ssl.gzOSSL_STORE_SEARCH_get0_bytes.3ssl.gzOSSL_STORE_SEARCH_get0_digest.3ssl.gzOSSL_STORE_SEARCH_get0_name.3ssl.gzOSSL_STORE_SEARCH_get0_serial.3ssl.gzOSSL_STORE_SEARCH_get0_string.3ssl.gzOSSL_STORE_SEARCH_get_type.3ssl.gzOSSL_STORE_close.3ssl.gzOSSL_STORE_close_fn.3ssl.gzOSSL_STORE_ctrl.3ssl.gzOSSL_STORE_ctrl_fn.3ssl.gzOSSL_STORE_eof.3ssl.gzOSSL_STORE_eof_fn.3ssl.gzOSSL_STORE_error.3ssl.gzOSSL_STORE_error_fn.3ssl.gzOSSL_STORE_expect.3ssl.gzOSSL_STORE_expect_fn.3ssl.gzOSSL_STORE_find.3ssl.gzOSSL_STORE_find_fn.3ssl.gzOSSL_STORE_load.3ssl.gzOSSL_STORE_load_fn.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_open_fn.3ssl.gzOSSL_STORE_post_process_info_fn.3ssl.gzOSSL_STORE_register_loader.3ssl.gzOSSL_STORE_supports_search.3ssl.gzOSSL_STORE_unregister_loader.3ssl.gzOTHERNAME_free.3ssl.gzOTHERNAME_new.3ssl.gzOpenSSL_add_all_algorithms.3ssl.gzOpenSSL_add_all_ciphers.3ssl.gzOpenSSL_add_all_digests.3ssl.gzOpenSSL_add_ssl_algorithms.3ssl.gzOpenSSL_version.3ssl.gzOpenSSL_version_num.3ssl.gzPBE2PARAM_free.3ssl.gzPBE2PARAM_new.3ssl.gzPBEPARAM_free.3ssl.gzPBEPARAM_new.3ssl.gzPBKDF2PARAM_free.3ssl.gzPBKDF2PARAM_new.3ssl.gzPEM_FLAG_EAY_COMPATIBLE.3ssl.gzPEM_FLAG_ONLY_B64.3ssl.gzPEM_FLAG_SECURE.3ssl.gzPEM_bytes_read_bio.3ssl.gzPEM_bytes_read_bio_secmem.3ssl.gzPEM_do_header.3ssl.gzPEM_get_EVP_CIPHER_INFO.3ssl.gzPEM_read.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_DHparams.3ssl.gzPEM_read_DSAPrivateKey.3ssl.gzPEM_read_DSA_PUBKEY.3ssl.gzPEM_read_DSAparams.3ssl.gzPEM_read_ECPKParameters.3ssl.gzPEM_read_ECPrivateKey.3ssl.gzPEM_read_EC_PUBKEY.3ssl.gzPEM_read_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_read_PKCS7.3ssl.gzPEM_read_PKCS8.3ssl.gzPEM_read_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_read_PUBKEY.3ssl.gzPEM_read_PrivateKey.3ssl.gzPEM_read_RSAPrivateKey.3ssl.gzPEM_read_RSAPublicKey.3ssl.gzPEM_read_RSA_PUBKEY.3ssl.gzPEM_read_SSL_SESSION.3ssl.gzPEM_read_X509.3ssl.gzPEM_read_X509_AUX.3ssl.gzPEM_read_X509_CRL.3ssl.gzPEM_read_X509_REQ.3ssl.gzPEM_read_bio.3ssl.gzPEM_read_bio_CMS.3ssl.gzPEM_read_bio_DHparams.3ssl.gzPEM_read_bio_DSAPrivateKey.3ssl.gzPEM_read_bio_DSA_PUBKEY.3ssl.gzPEM_read_bio_DSAparams.3ssl.gzPEM_read_bio_ECPKParameters.3ssl.gzPEM_read_bio_EC_PUBKEY.3ssl.gzPEM_read_bio_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_read_bio_PKCS7.3ssl.gzPEM_read_bio_PKCS8.3ssl.gzPEM_read_bio_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_read_bio_PUBKEY.3ssl.gzPEM_read_bio_Parameters.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_RSAPrivateKey.3ssl.gzPEM_read_bio_�x�������������x
�������Xv�$�
���������������eX�$u����������������eXdX4!"*+,3<GNX	
	RRRRR
RRRRRRR
RRRRRRR
RRRRRRR
RRRRRR
RRRRRRRRR
RRRRRRRRR
RRRRRRRR	R
RRRRRRRRRRR
RR
RRRRR
RRRRRRRRR	R
RRRRRRRRR
Rutf-82edde1e605094bb00da865dee9ac9f9009e4f5b433cb5d80993bf50d79354d0f?�����ĉ3!�^���P,��*����%�f��Y
	*����%�ж�-Ę�CG���J�U�d=���6�=f��=<��d��yK�A}t��&A �H�m:���]+��\3�wz�$L���K
b�e��o�{q��o��T�bN�Aʆv�kg.�>'	�)��v*�����VŅ�����g>�ʍ�D���<�6,����%b�Iu��ַG��/���t�ڑ�ܓ~*��[��'atX���)�4m�
/q��?�G�,+v�~����Nw�v�N�y5���K��H�q}؀�����vA�GK���b#���x/u�,��E%/S^��R���V��s�ʹ�dq��Iq�$�ԜbAO�9��*ϢD!'i�	�z+e�zoɨ�k	��Gd�l���g��
/�1�Q�[��p�3WR�����9�]n��{0�J�C)�2+�SO{��n#r򮧉o�_�{#u7{`AT�������p4ހb��}�?<���;we�t	�K�H�\�I-�TP&ʞ�HU��2�d�=�?%�6��
�?K2�?�
�JB\6r��K��-��3!�^���P,��*����%�f��Y
	*����%�g,��䪒���z �#n<����3*�fk>-Wi��K�_:p15"H�.j��#�"̖��L��CoIտ��O#y�.F���I�w
G�j_�y�S�˅��=Y0�����bggg�2Vo҅(��=D�:y��0�gn ,m��\Eዝ�K�:�`�F��i�[�5�x>����m�}���H��-�z=�Y��'ߤ��H ��
���m��(��;ak���b<
Nŧ�?�9�lev�N�#]#iٗ>���k������S���P�#D�+�W�n���<[6���i �a���+��H��H��,���![�=~�a�(Q.���ڲF��.1*��X�p9c `a�����95�+�M>�ن��˾2h�D}TLnvp�;h��t��]ӲU�����?ˌ���A.��М5l�^�ַ�'��(
�aG�3qW\��8!Sϝ�WUL����k{D�B��k��h[�vͱ�y���	?�WS�҇dO��rt
�mEK-��x�_��8eef92081e4d4be704c598dbd535580c80d6d75d42e7074b708ad9d68b2cda4ca10c502df99ae41c876eee18f487352a760179d8f��
͠f��n-coded variant of get_device (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Declare closing variable as boolean (Jonathan Toppins) [1685307]
- [infiniband] IB/core: Add an unbound WQ type to the new CQ API (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Add generic function to fill in flow action object (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Add UVERBS_ATTR_CONST_IN to the specs language (Jonathan Toppins) [1685307]
- [netdrv] ibmvnic: Fix completion structure initialization (Steve Best) [1697103]
- [rpmspec] redhat: limit headers_install_all to arches we care about (Denys Vlasenko) [1692404]
- [lib] ida: Add new API (Jonathan Toppins) [1697588]
- [edac] EDAC: Drop per-memory controller buses (Frank Ramsay) [1686477]
- [edac] EDAC: Don't add devices under /sys/bus/edac (Frank Ramsay) [1686477]
- [x86] x86/platform/UV: Use efi_runtime_lock to serialise BIOS calls (Frank Ramsay) [1677695]- [pci] �x����������������������XO#$�
��������#������$d���������������������17bf768c3635594fd8bdf4748f5bfa1bf5a5dbd480522b2b8d9b862bf38175b7549a48f453449e204f5104954d7e1da643e60d89adee838e133808c57a7f36221b373b70f09f10d95f56925d317af483b643f25be3baf2f8a9ff7fa7c3f51a56fde8edea38611bdb84b501c297b89e3cf2ad962de5fab4adc5ffa8f9f384da7e9dd7cc3c20275fd1228468f792966c91b4e523d8ecfb2ec16c362186277ec0dee7fc286523f952788525308d1c0c3d17646372ff6e991f1adc1acc63bafe2b0f19f8e9d2510ece0f21486ede23159bf542373f8fca30728b51695cb5808ec5b2efb7d83685fe83224f54b695929b492c06575ef710a415313a8d5315e53673a0c5771a2d4b7cbe6c36a609b2a851316ee4332d454e1e51e1f9b9870400e00969e4e303e1aef12ea145becb656e390dd9e48765283b95fee118951bbf3391a9382b571ca2a3987e79224550e99d931539ad143e0bdb95fee118951bbf3391a9382b571ca2a3987e79224550e99d931539ad143e0bdc5f69f6389850a4aa20f2d1825cba55a6e93847f6cfbe85c4a7ab0d9989ab5acc5f69f6389850a4aa20f2d1825cba55a6e93847f6cfbe85c4a7ab0d9989ab5ac2749f8f86926f66b280c1426af04ed6eee81ddbdbba20461e0ec6c11164da2ca2749f8f86926f66b280c1426af04ed6eee81ddbdbba20461e0ec6c11164da2ca45590b5a824a7924f5e198f0914c46ec2c8e463dfd0e015e8d8dcc4749a6549d45590b5a824a7924f5e198f0914c46ec2c8e463dfd0e015e8d8dcc4749a6549d0cc187836b8b6894ee9b19d075da4a9cc2254251fbb43b166543da67bb1919330cc187836b8b6894ee9b19d075da4a9cc2254251fbb43b166543da67bb191933b41c095660f5e9db65feee38514be0fa4904b3f79e7de777ea3e87be67c51d2ee5b788ce486126a0e1c483d54d6c079230d89f90008297f115a06c59e3f6815fa039c24818212edac1065b2837639091451bc1a5f9cb13e59ab649632e45e63b7f6fe1c5f52940cd0b266392d5415d89b1a0b97132957842bfa7f8984a60fe042d7ba11778d54ab944362ee302dca6d47d8525bd243226a7ccbe75f32d8736d5b6566aee9cf45b005a7ea2eef233539b4789cf502a268e87fd019c6627aa8d6eb6566aee9cf45b005a7ea2eef233539b4789cf502a268e87fd019c6627aa8d6ed0fbd342fc8085721a389740bb3ce0dfda07f574222ea106c774ca9e74d9c656d0fbd342fc8085721a389740bb3ce0dfda07f574222ea106c774ca9e74d9c656a233a33ba52bc7c1e4b84f35fb3b16749a1b6cb02e35b30e6402dcb596a20c01e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8554c13b804e4c17c2aadc81d57a2552ef85c8865ef65fef054ec5ea26a001b992f4c13b804e4c17c2aadc81d57a2552ef85c8865ef65fef054ec5ea26a001b992f077d99a201edfe88109496a7c63647a85026a4ea94dcbef52145f67ec81bb094077d99a201edfe88109496a7c63647a85026a4ea94dcbef52145f67ec81bb09451ca1f6311d409195e27c2b4c4703dd749995e8c892cf0873864ce3784b9a64f51ca1f6311d409195e27c2b4c4703dd749995e8c892cf0873864ce3784b9a64f17b7de15e5a76aa6ac78d732fa31f1068f0d6d5f2a38481582de5ea64e77ad9d17b7de15e5a76aa6ac78d732fa31f1068f0d6d5f2a38481582de5ea64e77ad9d112937b1b23ee7bf9c35333e87ae6b3c2ea58a7246a5696e2b90d4f2b1660a8b112937b1b23ee7bf9c35333e87ae6b3c2ea58a7246a5696e2b90d4f2b1660a8b0bae7ec0d511377f00aa7dc8546841f6e0a6b7d11aa060c2dcc2267fcddc4605221af2744a9c01b21b85c571e43c7f7eba08e1ac9703452af1d38e6354c706e385f19eea47f8cfa1e30bb2b75be3be04f54d00b5165db43e9a1d857f9a09c48885f19eea47f8cfa1e30bb2b75be3be04f54d00b5165db43e9a1d857f9a09c4887ae4881d9c366487ae5dd8060a2d82dea8d059fa6047b0c687f533eafc91f40a7ae4881d9c366487ae5dd8060a2d82dea8d059fa6047b0c687f533eafc91f40ad978187b698eaab7a8168186bcb448b4f75ac6d3da7948c54e872e08a0851dc8309d94100baaca5100b8920c1c917ee4ae46ca49e243867ca3a4fc8ff07e5e0d553d510e10f72c1f0fc38dfe8f2b45aef2d943ba39bc7111888911ff0f6a70b88bda41ffc52f26e5488e69df0224f3233058d7f98e0a9314664abb908ad9ca93c84fb0853b8b607aa9a101a140eecd0d053d730946a707159333bb25923935c2c2e9c744cc2f588a9c2a0715e72931c058aa2ad93114f7259a7cd9e1d33017801ea1ba2183b86dbe4bba6fdf7fd9692082fd4fdf7e767480306f8628fe63a22dcc307bd9e092d318e694d40ca1cd999a520d1ca1e24947c1fee5f763739935fbe03d066dbe484350c6b0552696d3c23c1a87a00b23df57b237717a44eb549a36c0afb41571fbade468795eb34d3a81dc97681edaa85f7c3bb9c4224c9c8b24c1b8c7a12a16928f241456c6cc1a65cba9aab446c79ca3027ccce52ffa86125df318d26e445f9950487f8309376adc6e830da161d6e656e12bc91ceac9c7a62a76000631a1532c8bd6480da113fdde7351b88130c38eaa92c7adaac1a267ffb52df1072e6bfcae00bfb3c01a732a9739433a9b075f2aab4c768dd3b87b9c3ef0046e77825b376e61fe556b1cc884133665c0f54a36686d061e10d35eb514015fc5c0d022d147dd2c114b1e234455a975c3bffeffe0c11c74e309a�x�������������h������Xx�%�
�I�������������E��$U����������������E�F�D��ba31969f92ca36e1d471d747d16942bc86730663f8cf01fd1556b5071ee6a2f9675d8d94c8f39d700f92cfcc3a3d7338a7e39931d89ed0c77ee2240b158badc06fd47e6506da2edb72625c3ba62f285e3097864cc9de017a87e4872c3185fb0c4e44a6da33aa79659d7a2d8906aada1a02523251b0180e0a47c93654fe9a2a77bfd4c858fa9f28a232a3e552c3943d9441b0b498077ddde2c225adda4bd975ed4a4d4be1f5d59c29473aeba3209c6c7def62cbf7d031c4fe319e414117043f2a273885bff93bd18e11935d00a66776893b9916b2700a479d94ed796de13f28f4b0ef427e5005f6a6f9780724960def377edf57122db849bacaf288e086826f3c2ad6f7a5f2fba491994c0296b42c16bbafce471fe506a1f5cab3875f656e266281842c8112b6c21d8f88aa930d5cbf45d2cdb28d14514fef7c4b742870776a468e3324740485f9dd230587e515bdc66dc3ed4c787854fe5af410de985a282f2111e34549aab97007f2be030b6c8dc9a7cb24e72aaeec867825d62c6e11fb1695e8271771e53e32bf3af78c8fd6faa38cf1a904399788bea53ac3c72986d68ab8cfd369224b872fad307152ca473ccdca763b20f8c701557c37bdcee0c589b9e21a3014b0452cfd673e65214b854f7696f1f9245e624b0685482cd59bbbdf74761a7b878f4836134147a57cb6eb473ed1e23ae5343dab562f5b3d8175c87964ec74af7f934f30cee287d51085ecf1d2b21c1ea5095b62d18db3278ce9f4d486ca8c9572f4485a9ae8012e161adaa2dcec8ed04d68bc8f205641f09130a97f94f8991cf76cda31ac80fee645beb9580880bfcd7863132c67fb05b6cfae8f85eb3caa09ec455e2997e8b7c2036561b31482f02bdf621f7e7656311666a4f1caa6b329d2ec3a197b3672ad92855794f1e5bba56c0acdcc449ca3b73500862a5750c907d97d652978038dbc7809c4fcd07d8b2a11727c5216b633d50fd36cb5a11c8918d07753f3d0b1648130c36549f6479e7545ecfe612ad172c65b122178c2a7c62e21e3e41f925d8759f2dad91000d6144f17dc2cfb8da3b3ed2e43feed553de02d25a512edc6f0402549868bc2aa56afabe4a2866dcaf34e7818501f169904bc622d184e1f9348aa7bbafc48ddb9d15829a1ab7f6499be29626aacd8fea4196a3008af1f9b4270ede0c92cb681d9d1225ebdc6b9b844ac2b4809a874c1b547c864549ed64604c79dfa35f42644dcae7daa0b442536eef42571d9611c76373620439e3308371674cc576ffb08c085bc639e6e04f2adeafe5e62dcb3f2674893116f9509e8bdffdc655f9ffaabe9f94f364621c828e5cbc6e1059bf550bcc429baa7b22c10192e76ceb5c2e20e65875181178c1af5ebdc964ecfe034e3083c8ccec186ab55a61fda5fe78feb262e7500072b716c8f4ed700f3b5078f1d04594aab9870e41fc7bd85a28680a8690d3337a0003537ac5276eb878bb444debb3c6fe75fc9ef584547666c46da3b9fcf54766388953b67bbc2f01409e1cd90d8489fd41b4dc5a5143ab354ed2494d955d086ab367b0e2b0dd2a8297fd7e741ebb755bf6c274e7f7a16764bf48f85b859eb67c2dc507d13b68c03e7fec925beeb6f768a071672e58886eb52cb943d5d2264c606e7ccda71d0fa24bf7f8570db025b43639c218446dcac3d7c515a5bb3408d4ee1bfe2033b75954bebf2d00033a2fbbb2d25a9919d40127edb267212948cba221d27dd2caa02e980f57a2f4090af5bf2aca3141433da5b9c9dd6b25b7e5f8ebd120f13dc53c6d1863a5371686dd71fa3d91a12426a062c05da80eddd401c5ece6ad67d5ee83a0a57928894de504e14d3a4c9b082c385adaff144017cf4dea808fe849fc47d3e8ff7239c6516dc1417250a204c5b806cdf49c933161ba1b2b186789bf001f5fadb9250c9c272305341e8ce38dcec033905e40971598324c9f3409e54cc2656069d36f0b558702cfcd10d3bb1bbefe63eab177eaa0aa68437ad19b1c2577476b9a6d5b72e111600cf933e1d90188bad2c9561932a066f2ca94e5158b0385f4cd0500f21e691ead5d2d7abbc674d0beb280d2eb8cb63e845180c3e563062866285cd06e154e3e5eddd874a82571be391f3af10895528de5a63a48ee9525fdd46bb9aac6b2037452cf96f320fb63b82641863aaef8c30f59bac4e09087dff57561e2b8665c28614222c91fa4763d937ce9685502038c8637510969dc151cf9c9238b84c8794a5151a08700c3e3e5cb7e1b81b67f874007abaac964d7e32dc9eb79ccd8f1fe5e13d297c34b79ef3a1a00c6878f1a770057284d34ea9edf85b638c3e6efb407fa2e46ac6f44bf3401cba25b7a354a4d700e0e0f6ad6ad870bc290e6a4f3329dd4aa5c0fa3950e6dda8edd21a257539ea6afd209264403723d1a4f3ae54283e0c70428caf32c5ce373006e69fd4c6e46e2038a8de491ae2265a07de9f4f06f50368ab26f916b890aadb42ad84dd00fb7e87e4e14416ae12461d0b4c1f669a5ffde310baeb19fd0308885460637c2c10b23a71aead041bff6841caba32324e8061d8611f873ea44a55994ee64444f407d93a3ba4344c147ff04111bce03f034d7fa73339a6632d472789e6a40fea1d324ecd3c6dbd7dd343f35e20cc1edb6d0cc45389225124c95924d05bfefe02c3835daf84f1507b9244d9d6db70af157c481fd8b7b7859be75d9e2aefa1023f230dff67a0ff4ce487cc04bbec5e6d2ff54a6f13176782a37704734e1e6815b682413573e9d318270cafcef2ecc16f77f3d00864ffca93cc6aa5aa7880c5a1626e7452a99dd74636255749f6�x���������������������Xyh$�
��������P���$O���������������������@d���d�r@d�Z@dw6�dcp@dA)@d,@da�c��@c��c��cMC�c'@b�K@b��@b���b�2@b��@bs�@bY^@a�@aŶ@a�A@a��@a��@a���a��a�b�ar��ama�al@a(�a
$@a�@`��@`��`�9@`�r�`��`��`�O@`� @`��`
�@`��_��_ܙ�_إ@_إ@_�_@_�u@_�:�_�@_=@_;�_'�@_*@_
�@^�@@^�@@^�@^�b�^�b�^��@^א�^��^��^ϧ�^�m@^�>@^��@^�@^��@^K�^C�^C�^9\�^g@]�+�]�]߶�]�e@]ʞ�]��@]��@]��@]M`@]H@]H@]1��]+@]��]�@\�F@\��@\�@\�g�\���\�r@\���\o�@\T4�\<y�\4��\3?@\'a�\��\�@[��@[�_�[�@[�@[��[���[���[^��Z�b@Z�b@Z�@Z}�@Zz�@Z*~�Z%8�Z@ZC@Y��Y��@Y��@Y��@Y���Y�V@Y�@Y}�@Y{'@Yx�@YoI�Yh�@YS�@YM�YBv�Y��Y��Yi@Y�@X��@X�D�X��X�C�X��@Xl�XY@X<@X<@X%��X�@X��W��W�/@W��W��W��W��@W�-@W|�Wq@Wq@WUe�WL+@V�n@V��V�3�V�=@Vj��VM��V@��V$�@U��U�o�Ŭ�U��@U�n�U��@U��@U�b@U�'�U�J@U�a@Uyx@Ux&�Un�@U6;�U&i�T�@T�r@T��T��@TX��TO�@TFJ�TD�@T%U@T!`�T=@Tk@S��@S�G�S��S�@S��S�i@S��@S�P@S}�S|�@S{C�S`�SO�@S;��S4�S2�@S�@S�@Sn�S��R��@R�R߲�R�@R�w@R���R��R��Ro�@RY9�REs@REs@R��Q��@Q��QɆ@Q�K�Q��@Q�'@Q\�QR�@QG�QA��QA��Q#i@Q�@Qh@P��@P�O@P�O@P�q�P��P�*�P�)�Pv��Pf�PH�@P>@P
<�P��O���O�^@O�/@O�h�O�s@O�!�O�D@O��@O�r@Ou�@OKp@OD�OD�O"��O"��O�O�O�O�O(@O(@N�2�Ni��Ng\�N^"@NI
@NI
@N7�N7�N7�N7�N6�@N6�@N6�@N6�@N6�@N1O@N/��N/��N/��N/��N/��N.�@N-Z�N-Z�N-Z�N(�N(�NN@N�@N|@M�{@M���M�x@Mx�@Mx�@MO�L�|�L�*@L��Lb��L�@L�@L�L�K��@K{�@K{�@K@K
y@J��J���J�;�J��@J�@Jp9�Ji�@JQ�@JQ�@JQ�@JQ�@JQ�@J@�J67�J�J�I�@@I؝@I�@IԨ�I�2�I7�@I3�I3�I��IP@H�N@H�A�H�A�H�@�H���HwK@HO�@HG�@Hv@H�@G��@G�G��@G��G��@G{|�G�@Fֱ@F�%@F�%@F��F�S@F�u�F�R@F��F��@F�#@F��@Fw�@Fvs�F�F|@F|@F|@F��F@E�5@E�W�E݅�E�V�E�b@E���E��@E��@D�,@D�,@D�,@D��D�D�D�C@D��D�@D�D�@D��@D��@D��@D��@D��@D��@D��@D��@D��@DГ�DГ�D��DȪ�D��D��@D�L�D��@D��@D�@D�@D
u�D$@D$@D�@D�C�R@C���C�C��@C�C��C��@C{@Ci��C3�@C
��Pingfan Liu <piliu@redhat.com> - 2.0.26-14.2Pingfan Liu <piliu@redhat.com> - 2.0.26-14.1Pingfan Liu <piliu@redhat.com> - 2.0.26-14Pingfan Liu <piliu@redhat.com> - 2.0.26-13Pingfan Liu <piliu@redhat.com> - 2.0.26-12Pingfan Liu <piliu@redhat.com> - 2.0.26-11Pingfan Liu <piliu@redhat.com> - 2.0.26-10Pingfan Liu <piliu@redhat.com> - 2.0.26-9Pingfan Liu <piliu@redhat.com> - 2.0.26-8Pingfan Liu <piliu@redhat.com> - 2.0.26-7Pingfan Liu <piliu@redhat.com> - 2.0.26-6Pingfan Liu <piliu@redhat.com> - 2.0.26-5Pingfan Liu <piliu@redhat.com> - 2.0.26-4Pingfan Liu <piliu@redhat.com> - 2.0.26-3Pingfan Liu <piliu@redhat.com> - 2.0.26-2Pingfan Liu <piliu@redhat.com> - 2.0.25-7Pingfan Liu <piliu@redhat.com> - 2.0.25-6Pingfan Liu <piliu@redhat.com> - 2.0.25-5Pingfan Liu <piliu@redhat.com> - 2.0.25-4Pingfan Liu <piliu@redhat.com> - 2.0.25-3Pingfan Liu <piliu@redhat.com> - 2.0.25-2Pingfan Liu <piliu@redhat.com> - 2.0.24-7Pingfan Liu <piliu@redhat.com> - 2.0.24-6Pingfan Liu <piliu@redhat.com> - 2.0.24-5Pingfan Liu <piliu@redhat.com> - 2.0.24-4Pingfan Liu <piliu@redhat.com> - 2.0.24-3Pingfan Liu <piliu@redhat.com> - 2.0.24-2Pingfan Liu <piliu@redhat.com> - 2.0.24-1Pingfan Liu <piliu@redhat.com> - 2.0.20-69Pingfan Liu <piliu@redhat.com> - 2.0.20-68Pingfan Liu <piliu@redhat.com> - 2.0.20-67Pingfan Liu <piliu@redhat.com> - 2.0.20-66Pingfan Liu <piliu@redhat.com> - 2.0.20-65Pingfan Liu <piliu@redhat.com> - 2.0.20-64Pingfan Liu <piliu@redhat.com> - 2.0.20-63Pingfan Liu <piliu@redhat.com> - 2.0.20-62Pingfan Liu <piliu@redhat.com> - 2.0.20-61Pingfan Liu <piliu@redhat.com> - 2.0.20-60Pingfan Liu <piliu@redhat.com> - 2.0.20-59Pingfan Liu <piliu@redhat.com> - 2.0.20-58Pingfan Liu <piliu@redhat.com> - 2.0.20-57Pingfan Liu <piliu@redhat.com> - 2.0.20-56Pingfan Liu <piliu@redhat.com> - 2.0.20-55Pingfan Liu <piliu@redhat.com> - 2.0.20-54Pingfan Liu <piliu@redhat.com> - 2.0.20-53Pingfan Liu <piliu@redhat.com> - 2.0.20-52Pingfan Liu <piliu@redhat.com> - 2.0.20-51Pingfan Liu <piliu@redhat.com> - 2.0.20-50Pingfan Liu <piliu@redhat.com> - 2.0.20-49Pingfan Liu <piliu@redhat.com> - 2.0.20-48Pingfan Liu <piliu@redhat.com> - 2.0.20-47Pingfan Liu <piliu@redhat.com> - 2.0.20-45Pingfan Liu <piliu@redhat.com> - 2.0.20-44Pi�x�������������X�������XzJ%�
�������� �������d�$�����������������d�d�d�ode (#833866)
- allow duplicate FIPS_mode_set(1)
- enable build on ppc64 subarch (#834652)- fix s_server with new glibc when no global IPv6 address (#839031)
- make it build with new Perl- new upstream version- new upstream version- new upstream version fixing CVE-2012-2110- add Kerberos 5 libraries to pkgconfig for static linking (#807050)- backports from upstream CVS
- fix segfault when /dev/urandom is not available (#809586)- new upstream release- add obsoletes to assist multilib updates (#799636)- epoch bumped to 1 due to revert to 1.0.0g on Fedora 17
- new upstream release from the 1.0.1 branch
- fix s390x build (#798411)
- versioning for the SSLeay symbol (#794950)
- add -DPURIFY to build flags (#797323)
- filter engine provides
- split the libraries to a separate -libs package
- add make to requires on the base package (#783446)- new upstream release from the 1.0.1 branch, ABI compatible
- add documentation for the -no_ign_eof option- new upstream release fixing CVE-2012-0050 - DoS regression in
  DTLS support introduced by the previous release (#782795)- new upstream release fixing multiple CVEs- move the libraries needed for static linking to Libs.private- do not use AVX instructions when osxsave bit not set
- add direct known answer tests for SHA2 algorithms- fix missing initialization of variable in CHIL engine- new upstream release fixing CVE-2011-3207 (#736088)- drop the separate engine for Intel acceleration improvements
  and merge in the AES-NI, SHA1, and RC4 optimizations
- add support for OPENSSL_DISABLE_AES_NI environment variable
  that disables the AES-NI support- correct openssl cms help output (#636266)
- more tolerant starttls detection in XMPP protocol (#608239)- add support for newest Intel acceleration improvements backported
  from upstream by Intel in form of a separate engine- allow the AES-NI engine in the FIPS mode- add API necessary for CAVS testing of the new DSA parameter generation- add support for VIA Padlock on 64bit arch from upstream (#617539)
- do not return bogus values from load_certs (#652286)- clarify apps help texts for available digest algorithms (#693858)- new upstream release fixing CVE-2011-0014 (OCSP stapling vulnerability)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- add -x931 parameter to openssl genrsa command to use the ANSI X9.31
  key generation method
- use FIPS-186-3 method for DSA parameter generation
- add OPENSSL_FIPS_NON_APPROVED_MD5_ALLOW environment variable
  to allow using MD5 when the system is in the maintenance state
  even if the /proc fips flag is on
- make openssl pkcs12 command work by default in the FIPS mode- listen on ipv6 wildcard in s_server so we accept connections
  from both ipv4 and ipv6 (#601612)
- fix openssl speed command so it can be used in the FIPS mode
  with FIPS allowed ciphers- new upstream version fixing CVE-2010-4180- replace the revert for the s390x bignum asm routines with
  fix from upstream- revert upstream change in s390x bignum asm routines- new upstream version fixing CVE-2010-3864 (#649304)- make SHLIB_VERSION reflect the library suffix- openssl man page fix (#609484)- new upstream patch release, fixes CVE-2010-0742 (#598738)
  and CVE-2010-1633 (#598732)- pkgconfig files now contain the correct libdir (#593723)- make CA dir readable - the private keys are in private subdir (#584810)- a few fixes from upstream CVS
- move libcrypto to /lib (#559953)- set UTC timezone on pod2man run (#578842)
- make X509_NAME_hash_old work in FIPS mode- update to final 1.0.0 upstream release- make TLS work in the FIPS mode- gracefully handle zero length in assembler implementations of
  OPENSSL_cleanse (#564029)
- do not fail in s_server if client hostname not resolvable (#561260)- new upstream release- fix CVE-2009-4355 - leak in applications incorrectly calling
  CRYPTO_free_all_ex_data() before application exit (#546707)
- upstream fix for future TLS protocol version handling- add support for Intel AES-NI- upstream fix compression handling on �x�������������������X{�#�
���������{��$k����������������{�z�|��78)
- [doc] Add info of relation update_cache with fill_sack (RhBug:1658694)
- Rename man page from dnf.automatic to dnf-automatic to match command name
- Fix alias list command (RhBug:1666325)
- Fix behavior  of ``--bz`` option when specifying more values
- Add protection of yum package (RhBug:1639363)
- Fix ``list --showduplicates`` (RhBug:1655605)
- Retain order of headers in search results (RhBug:1613860)
- Solve traceback with the "dnf install @module" (RhBug:1688823)
- Fix multilib obsoletes (RhBug:1672947)
- Do not remove group package if other packages depend on it
- Remove duplicates from "dnf list" and "dnf info" outputs
- Fix the installation of completion_helper.py
- Fix formatting of message about free space required
- Fix installation failiure when duplicit RPMs are specified (RhBug:1687286)
- Fix issues with terminal hangs when attempting bash completion (RhBug:1702854)
- Allow plugins to terminate dnf (RhBug:1701807)
- [provides] Enhanced detecting of file provides (RhBug:1702621)
- [provides] Sort the output packages alphabetically- Backport patch to unify --help with man for module-spec (RhBug:1678689)- Backport patch to not allow direct module switch- Backport patch to add support for modular updateinfoxml data- Backport patch: Fix minor problem with suggestion printed to terminal- Backport patches for: RHEL should use --best option by default for dnf / libdnf (RhBug:1670776)
- Add --nobest dnf option to revert the new default behavior from commandline- Print information about skipped packages after the transaction
- Sort reported skipped packages, force ignore_weak
- Allow to enable modules that break default modules (RhBug:1648839)- Updated difference YUM vs. DNF for yum-updateonboot
- Added new command ``dnf alias [options] [list|add|delete] [<name>...]`` to allow the user to
  define and manage a list of aliases
- Enhanced documentation
- Unifying return codes for remove operations
- [transaction] Make transaction content available for commands
- Add hotfix packages to install pool (RhBug:1654738)
- Report group operation in transaction table
- [sack] Change algorithm to calculate rpmdb_version
- Add basic integration with digest (RhBug:1614351)- Added dnf.repo.Repo.get_http_headers
- Added dnf.repo.Repo.set_http_headers
- Added dnf.repo.Repo.add_metadata_type_to_download
- Added dnf.repo.Repo.get_metadata_path
- Added dnf.repo.Repo.get_metadata_content
- Added --changelogs option for check-update command
- [module] Add information about active modules
- Hide messages created only for logging
- Enhanced --setopt option
- [module] Fix dnf remove @<module>
- [transaction] Make transaction content available for plugins- Backport patches for setting cachedir with --setopt- Update to 4.0.4
- Add dnssec extension
- Set termforce to AUTO to automatically detect if stdout is terminal
- Repoquery command accepts --changelogs option (RhBug:1483458)
- Calculate sack version from all installed packages (RhBug:1624291)
- [module] Allow to enable module dependencies (RhBug:1622566)- [module] Improved module commands list, info
- [module] Reports error from module solver
- Fix: Error detected when calling 'RepoCB.fastestMirror' (RhBug:1628056)
- Preserve packages from other installed mod profiles (RhBug:1629841)
- [spec] Postpone conflict with yum to Fedora 30+ (RhBug:1600444)
- [cli] Install command recommends alternative packages (RhBug:1625586)
- [cli] Fix case insensitive hint (1628514)
- Fix installed profiles for module info (RhBug:1629689)
- Fix module provides not having consistent output (RhBug:1623866)
- Enhance label for transaction table (RhBug:1609919)
- Implement C_, the gettext function with a context (RhBug:1305340)
- Actually disambiguate some messages using C_ (RhBug:1305340)
- Restore 'strict' choice for group installs (#1461539)
- [repoquery] More strict queryformat parsing (RhBug:1631458)
- Redirect repo progress to std error (RhBug:1626011)
- Unify behavior of remove and module remove (RhBug:1629848)
- Change behavior of disabled module for module install�x�������������H��������X|Y%�
X�h�}d�$m����������������}d~d|d��x����������������������X}V%�
�m	������d�$�����������������d�dd�
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������









	























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd�x�������������(��������X~�%�
0c��������V�$����������������VVV�ry long lines!&+/359=BIPU\adipz}���������������������� '-36:;?BIQRV]bdimqtw{����������������������
"#&-157;@CJOU]bgjrvz}��������������������������������x��������������x�������X�$�
ؤ��������������[�$K����������������[Z\�.1-3Karel Zak <kzak@redhat.com> - 2.32.1-2Karel Zak <kzak@redhat.com> - 2.32.1-1Charalampos Stratakis <cstratak@redhat.com> - 2.32-4Karel Zak <kzak@redhat.com> - 2.32-3Karel Zak <kzak@redhat.com> - 2.32-2Karel Zak <kzak@redhat.com> - 2.32-1Karel Zak <kzak@redhat.com> - 2.32-0.2Karel Zak <kzak@redhat.com> - 2.32-0.1Fedora Release Engineering <releng@fedoraproject.org> - 2.31-5Björn Esser <besser82@fedoraproject.org> - 2.31-4Lumír Balhar <lbalhar@redhat.com> - 2.31-3Karel Zak <kzak@redhat.com> - 2.31-2Karel Zak <kzak@redhat.com> - 2.31-1Karel Zak <kzak@redhat.com> - 2.31-0.4Karel Zak <kzak@redhat.com> - 2.31-0.3Karel Zak <kzak@redhat.com> - 2.31-0.2Karel Zak <kzak@redhat.com> - 2.31-0.1Karel Zak <kzak@redhat.com> - 2.30.2-1Karel Zak <kzak@redhat.com> - 2.30.1-5Karel Zak <kzak@redhat.com> - 2.30.1-4Karel Zak <kzak@redhat.com> - 2.30.1-3Fedora Release Engineering <releng@fedoraproject.org> - 2.30.1-2Karel Zak <kzak@redhat.com> - 2.30.1-1Karel Zak <kzak@redhat.com> - 2.30-1Karel Zak <kzak@redhat.com> - 2.30-0.1Karel Zak <kzak@redhat.com> - 2.29.2-1Fedora Release Engineering <releng@fedoraproject.org> - 2.29.1-2Karel Zak <kzak@redhat.com> - 2.29.1-1Miro Hrončok <mhroncok@redhat.com> - 2.29-2Karel Zak <kzak@redhat.com> - 2.29-1Karel Zak <kzak@redhat.com> - 2.29-0.2Karel Zak <kzak@redhat.com> - 2.29-0.1Karel Zak <kzak@redhat.com> - 2.28.2-1Karel Zak <kzak@redhat.com> - 2.28.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.28-4Karel Zak <kzak@redhat.com> - 2.28-3Karel Zak <kzak@redhat.com> - 2.28-2Karel Zak <kzak@redhat.com> - 2.28-1Karel Zak <kzak@redhat.com> - 2.28-0.3Karel Zak <kzak@redhat.com> - 2.28-0.2Karel Zak <kzak@redhat.com> - 2.28-0.1Fedora Release Engineering <releng@fedoraproject.org> - 2.27.1-5Karel Zak <kzak@redhat.com> - 2.27.1-4Karel Zak <kzak@redhat.com> - 2.27.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.27.1-2Karel Zak <kzak@redhat.com> - 2.27.1Karel Zak <kzak@redhat.com> - 2.27Karel Zak <kzak@redhat.com> - 2.27-0.4Karel Zak <kzak@redhat.com> - 2.27-0.3Karel Zak <kzak@redhat.com> - 2.27-0.2Karel Zak <kzak@redhat.com> - 2.27-0.1Karel Zak <kzak@redhat.com> - 2.26.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.26.2-2Karel Zak <kzak@redhat.com> - 2.26.2-1Till Maas <opensource@till.name> - 2.26-2Karel Zak <kzak@redhat.com> 2.26-1Karel Zak <kzak@redhat.com> 2.26-0.4Karel Zak <kzak@redhat.com> 2.26-0.3Karel Zak <kzak@redhat.com> 2.26-0.2Karel Zak <kzak@redhat.com> 2.26-0.1Karel Zak <kzak@redhat.com> 2.25.2-2Karel Zak <kzak@redhat.com> 2.25.2-1Karel Zak <kzak@redhat.com> 2.25.1-1Karel Zak <kzak@redhat.com> 2.25.1-0.1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.25-4Tom Callaway <spot@fedoraproject.org> 2.25-3Karel Zak <kzak@redhat.com> 2.25-2Karel Zak <kzak@redhat.com> 2.25-1Karel Zak <kzak@redhat.com> 2.25-0.3Peter Jones <pjones@redhat.com> - 2.25-0.2Karel Zak <kzak@redhat.com> 2.25-0.1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.24.2-6Kalev Lember <kalevlember@gmail.com> - 2.24.2-5Karel Zak <kzak@redhat.com> 2.24.2-4Karel Zak <kzak@redhat.com> 2.24.2-3Karel Zak <kzak@redhat.com> 2.24.2-2Karel Zak <kzak@redhat.com> 2.24.2-1Karel Zak <kzak@redhat.com> 2.24.1-2Karel Zak <kzak@redhat.com> 2.24.1-1Karel Zak <kzak@redhat.com> 2.24-2Karel Zak <kzak@redhat.com> 2.24-1Karel Zak <kzak@redhat.com> 2.24-0.1Karel Zak <kzak@redhat.com> 2.23.2-4Karel Zak <kzak@redhat.com> 2.23.2-3Karel Zak <kzak@redhat.com> 2.23.2-2Karel Zak <kzak@redhat.com> 2.23.2-1Karel Zak <kzak@redhat.com> 2.23.1-3Karel Zak <kzak@redhat.com> 2.23.1-2Karel Zak <kzak@redhat.com> 2.23.1-1Karel Zak <kzak@redhat.com> 2.23-1Karel Zak <kzak@redhat.com> 2.23-0.7Karel Zak <kzak@redhat.com> 2.23-0.6Karel Zak <kzak@redhat.com> 2.23-0.5Karel Zak <kzak@redhat.com> 2.23-0.4Karel Zak <kzak@redhat.com> 2.23-0.3Karel Zak <kzak@redhat.com> 2.23-0.2Karel Zak <kzak@redhat.com> 2.23-0.1Karel Zak <kzak@redhat.com> 2.22.2-6Karel Zak <kzak@redhat.com> 2.22.�x�������������h�������X�%�
���������Y�������d�$R�����������������d�d�d�62c4ca96cb9a6ef1f16b89e9370d7e139b4867e6cac78022ade98fe5a6707d5ee3b4a30f5bb66058e84a47f9a1509b79e35a1aeb765396ed2b46ae926b14d2d6b1e0e0b6915a15c323f2011b02e692cf1a6b6afaa342a3725502ba00496f613b0b0eb95fea44898e059e90b337d7c3fd175f7da6b41689877040b321e59560adb8d5a96c740ad9e10580d31693fe68321bf0e379698a7af55b8ad790bff0d9163327170ea1e6f5db47bc54c30c70b780b3940220c4d24763f99b4d5f324e86b29b35e1e2bf52ba3b09316760d5a097c1914b3522c5e11203c522f9901f321661fa65f3e3363b3fef9f6aafd0554ec3564b19fb00b14fac1963012a7d1c5103c3dff61e01921de0774351a38f2a96ec9c1986b76571ad8d85a36b22c0ba00343d4de3215180d01608da717dfa18e6103bfbc910c1ba06169673b45da70e9eea229b06635418de92f0447061321d734cebf7265f8a0d8b8f643127cffcd73b6ca9052756890f76d8850366def006f3f9a65e48800459885e132616d6c0ee70d6973c013cd052e741a39c3b73420871d67bacbbf555a7a1d5dc66b0d355d9ca050163db6a34de4e9017cb69848552b21d314b8eda85c83f5d6c95d8491708ec66f3ac98b4c7dde80e95b0e68af991270465ca10c092318dfc4302765361185fa6d7acbd7e6ca232d45e9ba16cffae9715273e904698ddfd9bf967a87ff1dfa5cbe7e83b6a934fb15e2af8b6bff241817acb3f77a28f76b701317a8e850581f1c4738489186317b4f53924e185057e29a965bd635affde7df2fb80b0f490f9e808f302969ddfbd68ccac54b95d7d20f2ce568c604df9e55378d1d51b9cc8c992caf94e563ed86323ae48a637aeb71911a01d1d19fcc787a033ed8620a91662d33bfaea73c4aeb701184f57dfb67d97f95742487e1e57d5c6ae718c060dd9eb2ce48f3ae02891c9753289bef0377b41441e50165e0956a7fe3095e213e19dde5e371feef2abd9d13962faa78c25dfac21d5ae4e97b0a1fb4891780fbc58bc4a4da7f7bce6a3e34e25330a61b051ea96db7783e33139ea1704e70008e7abfb83ad2723e16b578590f4f07dc34dcdd88ca47cc8c49752516aceebf5a5ba1ec8955af3a6533419349080b21823453c84a7310b66cd9b8adbfeca88e1435d6a36b22c395fe23b72e34d4b51666c8d42c23e5c236ea6ea19b7fa83fd15061052cb1a8e5695bd9cdad49a6055d9e5323ade3c7f9623894ce55ed76d013d78d3579ad9674b8eecdcfbe48846c2bceaf400fff22770e937630341e14ba491b6ad68e3f19cc0cf29c08f5d28ec3af8619ec932a5125f180221d405b61cc21c2bc8a4333ef29c69d3235027d7785edd96418d69a8f25d042c311be344e2958628cc31489d5493c0355d260087285a33fcef3d99d1a3c0a0bacce99aa9593e14b2fd2f54038d9afd13b340c8c4ddc62df04baae7ead2b6a01011c5995cafdfc463a9236e0b7eff672d03d505f992d32520124bc015a574ac967f2d37f5c75f67939f46ccedf74199d1373d2e6cd8a1bbbb592770d9626e7113195cfd35550322c5da2c7791ddd6031a39a43e0521db2b07a527e44fcd4956e473d8ae7e50209789fbc177f2a0644dccafd0996e2a0d35c7d64c106fc135375a96d7271bf9f9c712e3dd75baa64a49e80aae3f246b7eb9a8b2babf9e78fd1d174b76a64fcaec569ac6df11c4c4a83002b10e3d6aad5ce2c70a99abcb61eb91e8226e5d4cd572a1891501d322b5b4d8959eeb857a30912bcbb2121313f2bc775048b55069059b840d67e9bd4c6f0d1071d232d2974f1d228d46683691e4986b287bf623a3abae7fafa8f1a9489bd1c5ab08453275016ae17bf3abafa3a54dbd955e012bd9bf42786becba09b770b4e0ccbd33da880db89cbf8d4a886a628a266a2c29e270da1f14bd4877555a97336aac40c91bc15fbedd9df5ca5c49ce32e3a0f5d7a84e46d31065dbb8b73d6c13a931d3aa7e219174db73d4fa80121d8a4ac8e9d418789ea4a164cf341ff0b14ad1d2b104e5e280ba80f27742d7fa7e94896b894a02769ce6ead9b80ea595864c929a8108a49d13b18e3fa2410ba538f5153012465d1c43f18d6b3d5d4fdaa72ef8582a723551f5af15bf26fdd858b630cd7bd60eae4fc2580c06086ed31aafdc03117267cc8684af6861861e1ac720a37587789e14dac8b325bdc425d2ebf0aa13fe34ba2a7e38194a026ddbc81b28e3bdaded9ec1ffda7c283c174aff157ffc3f7dae00b7a57d41e86a1a137a6cb6d3d1c288b99463792ce5bae1346a0267831a39ebb8076c7f2376279f221da1aeb947acf8687db02cf05d57bc5d2c50ddbdb87d754505bd495115cd84e51c4d07ab6a74be5c468d4302b74e199479697df752f9c9aa07f6d3d598391d11a413a970bfe3d503a0adb9d9e5a7b4e551a827c9bc1378782c3cbf374164ecf9382da8849057780c488d0f4e6b04c559c777b3073f392ff2e70baee04563e8664c99f3d5a39ebcda81f716114bdd1c99e109866c77a1dfcd63abbff4ce02472b84b2672572b769d409aad99abe8a912e326add7cb27c812d2fabb834820e7c930e9751ded440�x��������������W�������X�%�
��������P��d�$W�����������������d�d�d�g��g�|g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g�|g��g��g�|g��g��g��g��g��g�}g��g��g��g��g��g��g�}g��g��g��g�}g��g��g��g��g��g��g��g��g�|g��g��g�|g��g��g��g�|g�|g�}g�}g��g�}g�}g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g�}g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g�}g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g��g��g�~g�~g�~g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g��g�~g��g��g��g��g�~g�~g�~g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g�~g��g��g��g��g��g��g��g�~g�~g��g��g�~g��g�~g��g��g��g��g��g�~g�~g�~g�~g��g��g��g��g��g�~g��g��g��g��g��g��g�g��g��g��g�g��g��g�g��g��g��g��g��g��g��g��g��g��g�g�g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g�g��g��g��g��g��g��g��g��g��g�g��g��g�g��g�g��g��g��g��g��g��g��g��g�g�g�g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g�g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�x�������������G�������X�'$�
�������� *���$h�����������������������jskarvad@redhat.com> - 2.20.0-0.2.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.20.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.19.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.19.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.16.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.16.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-5Ondřej Lysoněk <olysonek@redhat.com> - 2.13.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-15Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-14Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-13Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-12Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-11Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-10Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-9Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-8Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-7Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-5Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-4Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-10.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-9.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-1.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-5Fedora Release Engineering <releng@fedoraproject.org> - 2.8.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-1Fedora Release Engineering <releng@fedoraproject.org> - 2.7.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.6.0-3Fedora Release Engineering <releng@fedoraproject.org> - 2.6.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.6.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.1-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-5Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.3.0-3Jaroslav Škarvada <jskar�x�����Ћ������P6�������X�{$�
��z��������$b��������������������kdumpkdump.confpost.dpre.dmakedumpfile.conf.samplekdumpkdumpctl.build-id0a6eb0eb547817de6ae22f8d104990ad0436aaec0fd48a14e8929e2d42c098120deebc7d3cb5d4fbaedd825531f744c7fcb3e0d31695b4940a61d815c2ddea637dc46e756cc88db78504e6fc8e51153299earlykdumpearly-kdump.shmodule-setup.sh99kdumpbasekdump-capture.servicekdump-emergency.servicekdump-emergency.targetkdump-error-handler.servicekdump-error-handler.shkdump.shmodule-setup.shmonitor_dd_progresskdumpkdump-lib-initramfs.shkdump-lib.shkdump-logger.sh60-kdump.installkdump-dep-generator.shkdump.servicekdump-udev-throttlerrules.d98-kexec.ruleseppic_makedumpfile.sokexecmakedumpfilemkdumprdmkfadumprdvmcore-dmesgkexec-toolsNewsTODOearly-kdump-howto.txtfadump-howto.txtkdump-in-cluster-environment.txtkexec-kdump-howto.txtlive-image-kdump-howto.txtsupported-kdump-targets.txtkdumpkexec-toolsCOPYINGmakedumpfileeppic_scriptsREADMEap_messages_3_10_to_4_8.cdir_names_3_10_to_3_13.cdir_names_3_14_to_4_8.ckeyring_3_10_to_4_3.ckeyring_4_4_to_4_8.cproc_names_3_10_to_4_8.ctcp_sk_buf_3_10_to_4_8.cudp_sk_buf_3_10_to_4_8.cunix_sk_buff_3_10_to_4_8.cvhost_net_buffers_3_10_to_3_18.cvhost_net_buffers_3_19_to_4_8.cvhost_scsi_buffers_3_10_to_4_8.ckdump.conf.5.gzmakedumpfile.conf.5.gzkdumpctl.8.gzkexec.8.gzmakedumpfile.8.gzmkdumprd.8.gzvmcore-dmesg.8.gzcrashkdump/etc//etc/kdump//etc/sysconfig//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/0a//usr/lib/.build-id/0f//usr/lib/.build-id/ae//usr/lib/.build-id/c2//usr/lib/dracut/modules.d//usr/lib/dracut/modules.d/99earlykdump//usr/lib/dracut/modules.d/99kdumpbase//usr/lib/kdump//usr/lib/kernel/install.d//usr/lib/systemd/system-generators//usr/lib/systemd/system//usr/lib/udev//usr/lib/udev/rules.d//usr/lib64//usr/sbin//usr/share/doc//usr/share/doc/kexec-tools//usr/share//usr/share/licenses//usr/share/licenses/kexec-tools//usr/share/makedumpfile//usr/share/makedumpfile/eppic_scripts//usr/share/man/man5//usr/share/man/man8//var//var/lib/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu		





directoryASCII textBourne-Again shell script, ASCII text executablePOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=aedd825531f744c7fcb3e0d31695b4940a61d815, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0fd48a14e8929e2d42c098120deebc7d3cb5d4fb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0a6eb0eb547817de6ae22f8d104990ad0436aaec, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c2ddea637dc46e756cc88db78504e6fc8e511532, strippedC source, ASCII texttroff or preproces�x��������������%�������X�C%�
���������������d�$�����������������d�d�d�r Pisar <ppisar@redhat.com> - 1:1.0.1e-10Tomas Mraz <tmraz@redhat.com> 1.0.1e-9Tomas Mraz <tmraz@redhat.com> 1.0.1e-8Tomas Mraz <tmraz@redhat.com> 1.0.1e-7Tomas Mraz <tmraz@redhat.com> 1.0.1e-6Peter Robinson <pbrobinson@fedoraproject.org> 1.0.1e-5Tomas Mraz <tmraz@redhat.com> 1.0.1e-4Tomas Mraz <tmraz@redhat.com> 1.0.1e-3Tomas Mraz <tmraz@redhat.com> 1.0.1e-2Tomas Mraz <tmraz@redhat.com> 1.0.1e-1Tomas Mraz <tmraz@redhat.com> 1.0.1c-12Tomas Mraz <tmraz@redhat.com> 1.0.1c-11Tomas Mraz <tmraz@redhat.com> 1.0.1c-10Tomas Mraz <tmraz@redhat.com> 1.0.1c-9Tomas Mraz <tmraz@redhat.com> 1.0.1c-8Tomas Mraz <tmraz@redhat.com> 1.0.1c-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:1.0.1c-6Tomas Mraz <tmraz@redhat.com> 1.0.1c-5Tomas Mraz <tmraz@redhat.com> 1.0.1c-4Tomas Mraz <tmraz@redhat.com> 1.0.1c-3Tomas Mraz <tmraz@redhat.com> 1.0.1c-2Tomas Mraz <tmraz@redhat.com> 1.0.1c-1Tomas Mraz <tmraz@redhat.com> 1.0.1b-1Tomas Mraz <tmraz@redhat.com> 1.0.1a-1Tomas Mraz <tmraz@redhat.com> 1.0.1-3Tomas Mraz <tmraz@redhat.com> 1.0.1-2Tomas Mraz <tmraz@redhat.com> 1.0.1-1Tomas Mraz <tmraz@redhat.com> 1.0.1-0.3.beta3Tomas Mraz <tmraz@redhat.com> 1.0.1-0.2.beta3Tomas Mraz <tmraz@redhat.com> 1.0.1-0.1.beta2Tomas Mraz <tmraz@redhat.com> 1.0.0g-1Tomas Mraz <tmraz@redhat.com> 1.0.0f-1Tomas Mraz <tmraz@redhat.com> 1.0.0e-4Tomas Mraz <tmraz@redhat.com> 1.0.0e-3Tomas Mraz <tmraz@redhat.com> 1.0.0e-2Tomas Mraz <tmraz@redhat.com> 1.0.0e-1Tomas Mraz <tmraz@redhat.com> 1.0.0d-8Tomas Mraz <tmraz@redhat.com> 1.0.0d-7Tomas Mraz <tmraz@redhat.com> 1.0.0d-6Tomas Mraz <tmraz@redhat.com> 1.0.0d-5Tomas Mraz <tmraz@redhat.com> 1.0.0d-4Tomas Mraz <tmraz@redhat.com> 1.0.0d-3Tomas Mraz <tmraz@redhat.com> 1.0.0d-2Tomas Mraz <tmraz@redhat.com> 1.0.0d-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.0.0c-4Tomas Mraz <tmraz@redhat.com> 1.0.0c-3Tomas Mraz <tmraz@redhat.com> 1.0.0c-2Tomas Mraz <tmraz@redhat.com> 1.0.0c-1Tomas Mraz <tmraz@redhat.com> 1.0.0b-3Tomas Mraz <tmraz@redhat.com> 1.0.0b-2Tomas Mraz <tmraz@redhat.com> 1.0.0b-1Tomas Mraz <tmraz@redhat.com> 1.0.0a-3Tomas Mraz <tmraz@redhat.com> 1.0.0a-2Tomas Mraz <tmraz@redhat.com> 1.0.0a-1Tomas Mraz <tmraz@redhat.com> 1.0.0-5Tomas Mraz <tmraz@redhat.com> 1.0.0-4Tomas Mraz <tmraz@redhat.com> 1.0.0-3Tomas Mraz <tmraz@redhat.com> 1.0.0-2Tomas Mraz <tmraz@redhat.com> 1.0.0-1Tomas Mraz <tmraz@redhat.com> 1.0.0-0.22.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.21.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.20.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.19.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.18.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.17.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.16.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.15.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.14.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.13.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.12.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.11.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.10.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.9.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.8.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.7.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.6.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.5.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.4.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.3.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.2.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.1.beta3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.9.8k-7Bill Nottingham <notting@redhat.com>Tomas Mraz <tmraz@redhat.com> 0.9.8k-6Tomas Mraz <tmraz@redhat.com> 0.9.8k-5Tomas Mraz <tmraz@redhat.com> 0.9.8k-4Tomas Mraz <tmraz@redhat.com> 0.9.8k-3Tomas Mraz <tmraz@redhat.com> 0.9.8k-2Tomas Mraz <tmraz@redhat.com> 0.9.8k-1Tomas Mraz <tmraz@redhat.com> 0.9.8j-10Tomas Mraz <tmraz@redhat.com> 0.9.8j-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.9.8j-8Tomas Mraz <tmraz@redhat.com> 0.9.8j-7Tomas Mraz <tmraz@redhat.com> 0.9.8j-6Tomas Mraz <tmraz@redhat.com> 0.9.8j-5Tomas Mraz <tmraz@redhat.com> �x�������������@�������X�n%�
�(������x�hd�����$x����������������hdidgd�e.3ssl.gzSSL_CTX_set_session_id_context.3ssl.gzSSL_CTX_set_session_ticket_cb.3ssl.gzSSL_CTX_set_split_send_fragment.3ssl.gzSSL_CTX_set_ssl_version.3ssl.gzSSL_CTX_set_stateless_cookie_generate_cb.3ssl.gzSSL_CTX_set_stateless_cookie_verify_cb.3ssl.gzSSL_CTX_set_timeout.3ssl.gzSSL_CTX_set_tlsext_max_fragment_length.3ssl.gzSSL_CTX_set_tlsext_servername_arg.3ssl.gzSSL_CTX_set_tlsext_servername_callback.3ssl.gzSSL_CTX_set_tlsext_status_arg.3ssl.gzSSL_CTX_set_tlsext_status_cb.3ssl.gzSSL_CTX_set_tlsext_status_type.3ssl.gzSSL_CTX_set_tlsext_ticket_key_cb.3ssl.gzSSL_CTX_set_tlsext_use_srtp.3ssl.gzSSL_CTX_set_tmp_dh.3ssl.gzSSL_CTX_set_tmp_dh_callback.3ssl.gzSSL_CTX_set_verify.3ssl.gzSSL_CTX_set_verify_depth.3ssl.gzSSL_CTX_up_ref.3ssl.gzSSL_CTX_use_PrivateKey.3ssl.gzSSL_CTX_use_PrivateKey_ASN1.3ssl.gzSSL_CTX_use_PrivateKey_file.3ssl.gzSSL_CTX_use_RSAPrivateKey.3ssl.gzSSL_CTX_use_RSAPrivateKey_ASN1.3ssl.gzSSL_CTX_use_RSAPrivateKey_file.3ssl.gzSSL_CTX_use_cert_and_key.3ssl.gzSSL_CTX_use_certificate.3ssl.gzSSL_CTX_use_certificate_ASN1.3ssl.gzSSL_CTX_use_certificate_chain_file.3ssl.gzSSL_CTX_use_certificate_file.3ssl.gzSSL_CTX_use_psk_identity_hint.3ssl.gzSSL_CTX_use_serverinfo.3ssl.gzSSL_CTX_use_serverinfo_ex.3ssl.gzSSL_CTX_use_serverinfo_file.3ssl.gzSSL_SESSION_dup.3ssl.gzSSL_SESSION_free.3ssl.gzSSL_SESSION_get0_alpn_selected.3ssl.gzSSL_SESSION_get0_cipher.3ssl.gzSSL_SESSION_get0_hostname.3ssl.gzSSL_SESSION_get0_id_context.3ssl.gzSSL_SESSION_get0_peer.3ssl.gzSSL_SESSION_get0_ticket.3ssl.gzSSL_SESSION_get0_ticket_appdata.3ssl.gzSSL_SESSION_get_compress_id.3ssl.gzSSL_SESSION_get_ex_data.3ssl.gzSSL_SESSION_get_id.3ssl.gzSSL_SESSION_get_master_key.3ssl.gzSSL_SESSION_get_max_early_data.3ssl.gzSSL_SESSION_get_max_fragment_length.3ssl.gzSSL_SESSION_get_protocol_version.3ssl.gzSSL_SESSION_get_ticket_lifetime_hint.3ssl.gzSSL_SESSION_get_time.3ssl.gzSSL_SESSION_get_timeout.3ssl.gzSSL_SESSION_has_ticket.3ssl.gzSSL_SESSION_is_resumable.3ssl.gzSSL_SESSION_new.3ssl.gzSSL_SESSION_print.3ssl.gzSSL_SESSION_print_fp.3ssl.gzSSL_SESSION_print_keylog.3ssl.gzSSL_SESSION_set1_alpn_selected.3ssl.gzSSL_SESSION_set1_hostname.3ssl.gzSSL_SESSION_set1_id.3ssl.gzSSL_SESSION_set1_id_context.3ssl.gzSSL_SESSION_set1_master_key.3ssl.gzSSL_SESSION_set1_ticket_appdata.3ssl.gzSSL_SESSION_set_cipher.3ssl.gzSSL_SESSION_set_ex_data.3ssl.gzSSL_SESSION_set_max_early_data.3ssl.gzSSL_SESSION_set_protocol_version.3ssl.gzSSL_SESSION_set_time.3ssl.gzSSL_SESSION_set_timeout.3ssl.gzSSL_SESSION_up_ref.3ssl.gzSSL_accept.3ssl.gzSSL_add0_chain_cert.3ssl.gzSSL_add1_chain_cert.3ssl.gzSSL_add1_host.3ssl.gzSSL_add1_to_CA_list.3ssl.gzSSL_add_client_CA.3ssl.gzSSL_add_dir_cert_subjects_to_stack.3ssl.gzSSL_add_file_cert_subjects_to_stack.3ssl.gzSSL_alert_desc_string.3ssl.gzSSL_alert_desc_string_long.3ssl.gzSSL_alert_type_string.3ssl.gzSSL_alert_type_string_long.3ssl.gzSSL_alloc_buffers.3ssl.gzSSL_allow_early_data_cb_fn.3ssl.gzSSL_build_cert_chain.3ssl.gzSSL_bytes_to_cipher_list.3ssl.gzSSL_callback_ctrl.3ssl.gzSSL_check_chain.3ssl.gzSSL_check_private_key.3ssl.gzSSL_clear.3ssl.gzSSL_clear_chain_certs.3ssl.gzSSL_clear_mode.3ssl.gzSSL_clear_options.3ssl.gzSSL_client_hello_cb_fn.3ssl.gzSSL_client_hello_get0_ciphers.3ssl.gzSSL_client_hello_get0_compression_methods.3ssl.gzSSL_client_hello_get0_ext.3ssl.gzSSL_client_hello_get0_legacy_version.3ssl.gzSSL_client_hello_get0_random.3ssl.gzSSL_client_hello_get0_session_id.3ssl.gzSSL_client_hello_get1_extensions_present.3ssl.gzSSL_client_hello_isv2.3ssl.gzSSL_client_version.3ssl.gzSSL_config.3ssl.gzSSL_connect.3ssl.gzSSL_ct_is_enabled.3ssl.gzSSL_ctrl.3ssl.gzSSL_dane_clear_flags.3ssl.gzSSL_dane_enable.3ssl.gzSSL_dane_set_flags.3ssl.gzSSL_dane_tlsa_add.3ssl.gzSSL_disable_ct.3ssl.gzSSL_do_handshake.3ssl.gzSSL_dup.3ssl.gzSSL_enable_ct.3ssl.gzSSL_export_keying_material.3ssl.gzSSL_export_keying_material_early.3ssl.gzSSL_extension_supported.3ssl.gzSSL_free.3ssl.gzSSL_free_buffers.3ssl.gzSSL_get0_CA_list.3ssl.gzSSL_get�x�����xZ��������������X��%�
�Z������x#������}!�$m����������������}!|!~!�perl-devel (bug #1129443)
- Remove perl-ExtUtils-Manifest dependency on perl-devel (bug #1129443)- Do not filter FCGI dependency, CGI is non-core now- Remove bundled perl-IPC-SysV (bug #1308527)- Fix CVE-2016-2381 (ambiguous environment variables handling) (bug #1313702)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Remove bundled Math-BigInt (bug #1277203)- 5.22.1 bump (see <http://search.cpan.org/dist/perl-5.22.1/pod/perldelta.pod>
  for release notes)- Rebuild to utilize perl(:VERSION) dependency symbol- Do not own IO::Socket::IP manual page by perl-IO- Sub-package Attribute-Handlers
- Sub-package Devel-Peek
- Sub-package Devel-SelfStubber
- Sub-package SelfLoader
- Sub-package IO
- Sub-package Errno
- Correct perl-Digest-SHA dependencies
- Correct perl-Pod-Perldoc dependencies
- Move utf8 and dependencies to perl-libs
- Correct perl-devel and perl-CPAN dependencies
- Sub-package IPC-SysV
- Sub-package Test
- Sub-package utilities (splain) into perl-utils
- Provide perl version in perl(:VERSION) dependency symbol- Sub-package Memoize
- Sub-package Net-Ping
- Sub-package Pod-Html- Disable hardening due to some run-time failures (bug #1238804)- Sub-package bignum
- Sub-package Math-BigRat
- Sub-package Math-BigInt-FastCalc
- Sub-package Math-Complex
- Remove bundled perl-Config-Perl-V (bug #1238203)
- Remove bundled perl-MIME-Base64 (bug #1238222)
- Remove bundled perl-PerlIO-via-QuotedPrint (bug #1238229)
- Remove bundled perl-Pod-Escapes (bug #1238237)
- Remove bundled perl-Term-Cap (bug #1238248)
- Remove bundled perl-Text-Balanced (bug #1238269)
- Remove bundled perl-libnet (bug #1238689)
- Remove bundled perl-perlfaq (bug #1238703)
- Remove bundled perl-Unicode-Normalize (bug #1238730)
- Remove bundled perl-Unicode-Collate (bug #1238760)- Store distribution's linker and compiler flags to more Config's options
  in order to apply them when linking executable programs (bug #1238804)
- Sub-package Config-Perl-V (bug #1238203)
- Sub-package MIME-Base64 (bug #1238222)
- Sub-package PerlIO-via-QuotedPrint (bug #1238229)
- Update Pod-Escapes metadata (bug #1238237)
- Sub-package Term-Cap (bug #1238248)
- Sub-package Text-Balanced (bug #1238269)
- Sub-package libnet (bug #1238689)
- Sub-package perlfaq (bug #1238703)
- Sub-package Unicode-Normalize (bug #1238730)
- Sub-package Unicode-Collate (bug #1238760)
- Sub-package Math-BigInt
- Do not provide Net/libnet.cfg (bug #1238689)
- Revert downstream change in Net::Config default configuration
- Move libnetcfg tool from perl-devel into perl-libnetcfg sub-package- Subpackage "open" module in order to keep deprecated "encoding" module
  optional (bug #1228378)
- Control building dual-lived sub-packages by perl_bootstrap macro
- Make PadlistNAMES() lvalue again (bug #1231165)
- Make magic vtable writable as a work-around for Coro (bug #1231165)
- Explain file break-down into RPM packages in perl package description- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.20.*)- Move ok and Test::Use::ok to perl-Test-Simple- Move bin/encguess to perl-Encode- 5.22.0 bump (see <http://search.cpan.org/dist/perl-5.22.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages and erase the removed modules from the core
- Clean patches, not needed with new version
- Update patches to work with new version- Sub-package perl-CGI-Fast and perl-Module-Build-Deprecated
- Add missing dual-life modules to perl-core- Bump to make koji happy- Correct license tags of the main package, CGI, Compress-Raw-Zlib,
  Digest-MD5, Test-Simple and Time-Piece
- Package a Pod-Html license clarification email- Sub-package Text-Tabs+Wrap (bug #910798)- Add systemtap probes for new dtrace markers- Move perl(:MODULE_COMPAT_*) symbol and include directories to perl-libs
  package (bug #1174951)- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Provide 5.20.2 MODULE_COMPAT
- Clean list of provided files
- Update�x�������������P�����X��%�
p������p������m!�$}����������������m!l!n!�96fbd050e039b619778522e7e2935f848a63827a46eaa813dd5942eeb5e9feb6d8f5dd19e81335e95ee3a67e4426a3d8723d3aedebd072fff1c452c9387323c967f3fd297a013ebba9924ea103783fe02cc5772e0ff9b956a28b29a553fff10596082cb8fbb7d1ac9f6a3c062f249ae342dcc4534871b337866e8ad7e590b6744e0f63bdc24d9d6f68125237b07d5fb73f25504ed99a01984e76cf0fcb60295a723cc78ff50046bcdc7a6f930d332605875abfd97f2443dc774087747b82c4d5e3aa8613da5ad6a5bfed1cf795c40725c7d3994376bca13c8b6133bb1d02cfba3b6f05e04755359bac67a9b69a2f446050e6532dbf46e66a6f495d40f6ceace85305004abe28f3780a208b1ed63b5abe34d9431f0a5b1bf45c0d88da79a577088e02f6f5cfe2ed7a487f59f42740153c67c01aec4e1dc3f6c697619b23975c2e7e1f70b38b4eef8f57a419f390401cc27d52fc3cb9b3ba932bdc85413dae62f15a994123a40af569153bc8f91a9faa73e7d92a305923e331663fe2a1b52af6330518afbc1314ca0e02e89d254f2476d3a97a8e2c7ca03fae182272c1e3e985b8209eb89e0828b6092ed86f2cacaa9daffb5cca38ac2dd8d474e2750e69491b775fb8ecd30ce0a96c09691823a398e9a80e55fc9e5d37aaac2ffb13bf4d01f09c675a62aa929025f4110809843166b23c086ca532e8682e4fd97d102ec9f395bff3fbdaf10af56cce78cd1a879f91c47e8e9ce4812d02495583a4b26558d839c85a83c73d01b3434f38b6977cbb15581c958e001e2e06f7350744c736cbea359f5cbb7ef8f26173c20f8da196156382cc70790f09c4913c378ae132d1268b931b67a87cbbaf52de42a356f6b9a254fb729d35047560455d3acd3eb64f979f593493a7118a26abd1ba24566b7369a0f9355fd1afb94323545fe926b6faf5cd8e0a69933c9f13b7a14bfb2e04fd7e528dce7336d82322b63dfc1c728dd95eca18e5734338481011bf06de4b53f76adf13c829e5bc06b66f7712cf634995aaad6a2fcc9681d595464158afff84e426acd87cdd122980e5678d409185b31f7771abf48f674630321ce662576637f1a01f182c3de883e6864f24408b3b8d2cf6c193a1c95a18a449cbb127d711a7ba36fb99cc7b9220cd6ebb1ce0b56955de9f767567e6fa18f9fe3ab7fc4bb6310f22bd0d6d694548a8edfa55532dc16dbc068cf2516b205b41989a9f4931d260e6fe81a89536e9239682453df308dd11dfac163ecb067c369cb7c9f9e36d46f69c7011246752b731c6c98229cd2916a1b73dd80222bfdebc9a3994d243264a77415cb6e467be2a0a316e41f391af600339b95c4462895514465c118ae4942dcf3625deafd1fff1c031c133aab9b976427bab0ca7458e5bfa07cd0703cdb36f95432e93c0d3e7a15c6e8d13ce5eae59bc69412262c54c84edaa35f0ca67a75870fd1b924edb6a9f1c855aef117880ce9e0d91951d04c14808f25570e35a8d8c4b11cc130a3355663ac64021b88e88b890b436167ecc8c293341bb9818412ae71c9ba187dd8ab020c666e0af83a8d4b4c6c16383d4161c1227502d0362c2755ab5d41f8ea0a5f60ec910d31ea23e2a62429dd5789bb6e546b9c607e0ed4758ebe8a3690e6ef376ad01c39a162621f387c309b2d602a50ba9103befaba1a417359e201162b235b3776874a174457c61068d14def0ae76aadbe8eeac3fede9007ba064091e383ed2d6d77ddef88354bf5adfcceddf56775f947359f75883d0c3eb9fb5dd74d121434a44e54bbd0b950506f07503da95c0596a799c06b015c17428a4b34a26d713b8717dbe359d24d75d5da4261f03f29abccf84929a27a15998546f631f2073e6feb5c9e5c89fafd0cc9693cf9b785eba62c7183d6ec969d8c49a2cf74d1582ff59dfd2c65a64b258f29c6b8f2286590851408ea4a3c487474e3f9a1a3d59b4c9c332e881f65b2e80440d89ded2def88d3cb65d8064546d34a5d2d91fe4569ef19caab8318a4091f95a7583f606e6a1d6d69f1aa0f24a08476d9712c30312001bf534ebc95182f04844e4af8465779e29462421e26cae2fc7f3fde2dea489265f0835a31338173e92f923e86bb79e4da952194c8fd26cee77c99cad7b9a090c53c03dd05ee9b7b1aab083ed256932a4d72861edc0c733aa10b4f0a841b7b7ddb0c8b07cbdfb362d25d4ea2231f242a609b6f087b96d78b6aa635faabaa2feb3959fe1f5dbf24d1d7685ef579b40451dc009e5bc4094458eaf533bcd677d0f2a7ea6cfc804c415bdf6705e9170f3db5b3bf5cb14e081f12a2ff3f7a9152d140d28b0341c0b29b3fc773a0a446bf4935f85e237bc97fc7fd32bb88e4e4bcdcd8f666ae2e4e5027c2b48d88bb5b93cf20649a760d1290eb6299e3f5c40c3b5efcf37a835849e49c3d4c279bcef074580ebdb8e1473ef0df1d35d24e0ac444cfb15c71a9ae86b95e9b0ab2cf71368b9b39cde5a31404917da5506cf02fb112379980a487d95456c9833c1f0c85d484b88bc281e263e6d9ff43ebb784ecd9967adb94273429547c1320e24b98e2394dccd1264e3a72ca002971c56f41e1bdb27fae88c9ff26e6912a1a6d6693a524e97d9f10f2d4dd81021189e52de24dc3e10db32581bf1befbb19afc61baa1a08ac822082029b8f3c5e144a489f6e7da6db4ab61e1e5de9d850c22868f2c504a859b80906f8eec14d75b22fa697dcef30ae913597baee9da4afcf0975548093f94c9edb7efe38100f38adc297e5b97912215fa3be904680687d0af9cecd02c48336a025f573edfb1aa2fa2dd2a38dd06df3ee4�x������Y�������������X,�$�
����������������WX�$G����������������WXVXXX�option handling from Dan Walsh.
        * Add deleteall support for ports and fcontexts in semanage from Dan Walsh.- Fix semodule parameter checking- Update to upstream
        * Add genhomedircon script to invoke semodule -Bn from Dan Walsh.
- Add deleteall for ports and fcontext- Update to upstream
        * Update semodule man page for -D from Dan Walsh.
        * Add boolean, locallist, deleteall, and store support to semanage from Dan Walsh.- Add genhomedircon script to rebuild file_context for shadow-utils- Update translations- Additional checkboxes for application policy- Allow policy writer to select user types to transition to there users- Fix bug in building policy with polgengui
- Creating ports correctly- Update to upstream
        * Improve semodule reporting of system errors from Stephen Smalley.- Show local changes with semanage- Fixed spelling mistakes in booleans defs
- Update po- Update to upstream
  * Fix setfiles selabel option flag setting for 64-bit from Stephen Smalley.- Fix wording in policy generation tool- Fix calls to _admin interfaces- Upgrade version of sepolgen from NSA
        * Expand the sepolgen parser to parse all current refpolicy modules from Karl MacMillan.
        * Suppress generation of rules for non-denials from Karl MacMillan (take 3).- Remove bogus import libxml2- Lots of fixes for polgengui- Change Requires /bin/rpm to rpm- Bump libsemanage version for disable dontaudit
- New gui features for creating admin users- Fix generated code for admin policy- Lots of fixes for role templates- Add more role_templates- Update genpolgui to add creation of user domains- Fix location of sepolgen-ifgen- Add selinux-polgengui to desktop- Cleanup spec- Update semodule man page
        * Fix genhomedircon searching for USER from Todd Miller
        * Install run_init with mode 0755 from Dan Walsh.
        * Fix chcat from Dan Walsh.
        * Fix fixfiles pattern expansion and error reporting from Dan Walsh.
        * Optimize genhomedircon to compile regexes once from Dan Walsh.
        * Fix semanage gettext call from Dan Walsh.- Update semodule man page- Update to match NSA
        * Disable dontaudits via semodule -D- Speed up genhomedircon by an order of magnitude by compiling regex
- Allow semanage fcontext -a -t <<none>> /path to work- Fixfiles update required to match new regex- Update booleans translations- rebuild for toolchain bug- Add requires libselinux-python- Fix fixfiles to report incorrect rpm
- Patch provided by Tony Nelson- Clean up spec file- Require newer libselinux version- Fix checking for conflicting directory specification in genhomedircon- Fix spelling mistakes in GUI- Fix else path in chcat- Update to match NSA
        * Rebase setfiles to use new labeling interface.- Add filter to all system-config-selinux lists- Update to match NSA
        * Fixed setsebool (falling through to error path on success).- Update to match NSA
        * Merged genhomedircon fixes from Dan Walsh.
        * Merged setfiles -c usage fix from Dan Walsh.
        * Merged restorecon fix from Yuichi Nakamura.
        * Dropped -lsepol where no longer needed.- Fix translations code,  Add more filters to gui- Fix setfiles -c to make it work- Fix french translation to not crash system-config-selinux- Fix genhomedircon to work in stage2 builds of anaconda- Update to match NSA- Fixes for polgentool templates file- Updated version of policycoreutils
        * Merged support for modifying the prefix via semanage from Dan Walsh.
- Fixed genhomedircon to find homedirs correctly.- Updated version of policycoreutils
        * Merged po file updates from Dan Walsh.
- Fix semanage to be able to modify prefix in user record- Fix title on system-config-selinux- Updated version of policycoreutils
        * Build fix for setsebool.- Updated version of policycoreutils
        * Merged setsebool patch to only use libsemanage for persistent boolean changes from Stephen Smalley.
        * Merged genhomedircon patch to use the __default_�x�������������@�������X��%�
K�����>��$.����������������>�?�=��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-5.26.3-423.el8_10.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x���������������������X��%�
���������M��$]����������������M�N�L��93aa5ef38dd09061c905617f2224e2a9a76b9390613ccd94c05bdc36fe3db99045367d4d4aafde70e4ccfd0b4b87a44baa6bd8e0469a084dd94c7d02b91894c4751c7d4bbe34b959c9542c5999b98e0063ce6907debe2def269d5d671d27f270dd50bf2079b605745189b8ca179628797916707f3cabc5a7f916edb9f9fe3fb5ab0fb157c7e7ce363cb1b3870a56e143f1c5cadf55ab35a697eeb75eaa70ee5357b004eea1075c2472e8a17be5f6511c869ded63ce7d43d253b9fbfe65301fb3b66f014d75e8baf87d6b881c96e20be097045ec732c90a900defb195c46e27caf395a01ef11db2cdf87622e40e88adfa543e0fd8734653e0f961a9d1cbe967c42dc9f8e3521d2b86ac60ef3a89ca0109d91d2a32970f5b6e3608dcbe9f7989d022d6db56ec70aa4e8141fa0a3e894a3a523d3de13e92514357936e365d020e9cf48b080e221573bc3f8d961409489cf26f398bef6bed2636d979fc93996656ea6c167ae7061140f3c7202a556cd54e8fdcc39f873398911bcc612461a65883228b860e27848cb7fe2f34dbf8661583203df573a2bb638885128b6cced51ff3c4b0408f947029442943a46b4c28a2ac37d1d2222314056c1335fb35d44f8ebed3a495ca01d3a6341d2df736c02389ef5b48ad21844d01ed73921b8abb013ae9309192bdf66d2aa1c03e2d27aa1b6a0cf766d2f4db2958686865e84f5ba4c7607a248572dad03436d7081aeb0cf08a3ae26246b860bc2ed3412981baac7f97aa85859b62e37ed8958b414ed8cf056314a887e79d967b8868952068ea2bef7cdca731d7ec33320e837b94e114e225619156cdaea05ed03ea0d4a2b14f15e03dffa64c09c0d36c877ffea7f5021e0b61b2e8c7d3b7c14db78239a3b27098c84588713de66694c170e44fec8cefbc10d1b656cbb08a8cec7ae4a98ed3e347a002d1e4040050237b2fb60d09994f668f119673fb89986ec62e561937ecf28d28ffef9df185832be9935c7b6ddebcc2abbad02139d4df99370b5b6536e7b20b8d6bc7f4ea6e7b5e48848238f3334e831f5eafc13778fe5af6d695561b00614512d6f2d9fed6f14b326f18bfe21ab9a59715c441fe9fbd1c2c8603214c1bc490720573bbabde592df5e491f11eb14e479b06c5105b79a79a1e3d13759e3efd177c9dd3eb67f60aece36e5091c3090dc4447047bd6569fef7fde871ab92e526ec91c1448196e657ddfa50d41c50cdb33e96198d1545757a764b8902fea9348789d62ec0ee6489bcf02bd252c7f834c3059fb593096cc7553b0755c94741aa604817db3584dbed93fa9c6c808f61fd53e004077ab8f686cc402dfcba035dc33704cb20fea27e78186a62e2f6a727e38b325b095d199c519397d8385b07c0bb7dd92ee15331bd5e581dd56dff3e2fb71e68321532a75ce24118e6f471da3c64ec421477116420a6aad6e228f16b26aca2dc76d0ee621d475a4c24d12269ded0316ce73ab138b47192c724dacae4a4aab628a342913bbecaa6fd83f086626c3b1c0b5bf274b66b14ab41086ab729a55e0d5263f3926eab44ec800354c0e271cbdc8ca7ae17f02169d76a164e59a7c1c9d1a5d680260603f7cc1a1e7528138a6228bda9cae32f3635a19c005c18284eecdba488e91d05c397925225e22ea90428f2858c867792bf589a025e0cc9e627a94cb39db643c8331bb9add131e36c8b484e4516faebc92c233bbc1b712e0084a97357d39b506eda8b01d6ff69d29bd115a83aa6df9cfb3498a9bd36a01931e726839a75e7f28349fd438c59ee7bc2929dc49e579aa628008dc94d4a07379e1c2ba143cd975cddd5b74b4007c8ff68fee5e3f3e40485f6f346d5bf3e627c8cdbb03516727def4d0116b2b811fd5622b40b97ad7ee2ed7681fb70806bf5039f9801e5299dc47165709e539dfee0e836fdeae456fe6f3165028a27d743ff744982f2172fc818e9ff12f94df9c1ae05b53990dceb51635ac3f4624c1c160fdc4723baf4070745bd5ec60a89de30b759ab04d8d012429a32a29b04a8b8381c5f1ed1caed718c76cd8d09e4c32f20cb3df5c3d0c6fc041f251606a288630f6a0432f39ffaa8b357df027cd75cbdb55e34b2ab3a57f518f9b12441159897c3e6bb185871c8a731c5e215bfc9f212d3afbb0dc39c4286fcc18d23afaa7c144c3ca09aabd864bd0628fe42112eb0df8b6ed9313b1f7f738cd360e827afb83883cf805a3017c1366cb8ee71c96b61cc56937153f628bcb7c3eeab19031d68ca11482e2d8815d0139426713acb8a24d9ffc68599934e7d13fa3bc4786fd6bb1604c8962ed6b97e7550456b8164579234c4e84224f24857961c20cac6689824dc08b3ffbf128b04bade8a6a373119d4c48e7860c6e03bddae68fc0654ec594f9e6ca28bf6cf02127178394a98f95109632e42bc5bd7783bbd6d7a52c8d3436f63335d953a559d5bbc70194d7fa2b764c68c361168c8e777b55484dbdabc19ca72c979bd8026c53ae2fb61261e0235702b743691f735a6ad4de208907a177d60a4988ceeabc71e199bbe7ba2ee4491342f6939b50d728a80650ecdc4025e8e18a864273e776b7eeadda82df51ce18d7ad3a92a4e4043065832519ebc687a30bc8a977fada6397b10dd06d9ff7f30b5d5ed4097d58bf288af30f7a5cf78bda2409beb60616e52f1429c857e8778b4a7ae4b30070399f44d699a0c979d738a8d70c1a512758dd93f60a8a9d142f70190d8e4e9b3bb63997c16908c958cc20d2e523ca1c23c2ba0e03d4942edccefb8c0c67b2e86323339d9e4bc3328990bc6f8f09ea9�x������������� ��������X�*$�
��������p����$k�����������������������tional support for managed_irq
  Resolves: rhbz#1797025- profiles: renamed sst profile to intel-sst
  related: rhbz#1743879- Add accelerator-performance profile
- Resolves: rhbz#1795604- tuned-profiles-nfv-host: added ncat requirement
  resolves: rhbz#1779117- profiles: define variables before use
  resolves: rhbz#1788102- new release
  - rebased tuned to latest upstream
    related: rhbz#1738250
  - sap-hana: updated tuning
    resolves: rhbz#1779821
  - latency-performance: updated tuning
    resolves: rhbz#1779759- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1738250
  - cpu: fixed checking if EPB is supported
    resolves: rhbz#1690929
  - scheduler: fixed IRQ SMP affinity verification to respect ignore_missing
    resolves: rhbz#1729936
  - realtime: enabled ktimer_lockless_check
    resolves: rhbz#1734096
  - plugins: support cpuinfo_regex and uname_regex matching
    resolves: rhbz#1748965
  - sysctl: made reapply_sysctl ignore configs from /usr
    resolves: rhbz#1759597
  - added support for multiple include directives
    resolves: rhbz#1760390
  - realtime: added nowatchdog kernel command line option
    resolves: rhbz#1767614- used C-states in latency specification
  related: rhbz#1737628- plugin_cpu: latency can be now specified as C-state
  resolves: rhbz#1737628- new release
  - rebased tuned to latest upstream
    related: rhbz#1685585- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1685585
  - sap-netweaver: changed values of kernel.shmall and kernel.shmmax to RHEL-8 defaults
    resolves: rhbz#1708418
  - sap-netweaver: changed value of kernel.sem to RHEL-8 default
    resolves: rhbz#1701394
  - sap-hana-vmware: dropped profile
    resolves: rhbz#1715541
  - s2kb function: fixed to be compatible with python3
    resolves: rhbz#1684122
  - do fallback to the powersave governor (balanced and powersave profiles)
    resolves: rhbz#1679205
  - added support for negation of CPU list
    resolves: rhbz#1676588
  - switched from sysctl tool to own implementation
    resolves: rhbz#1666678
  - realtime-virtual-host: added tsc-deadline=on to qemu cmdline
    resolves: rhbz#1554458
  - fixed handling of devices that have been removed and re-attached
    resolves: rhbz#1677730- Fixed disk plugin to correctly match devices with python3
  Resolves: rhbz#1676513- Updated mssql tuning
  Resolves: rhbz#1660178- Fix excessive CPU usage in the scheduler plugin
- Resolves: rhbz#1659140- Added workaround for s390x zipl not supporting multiple initrds
  Related: rhbz#1576435- Added support for BLS
  Resolves: rhbz#1576435- Reworked setup_kvm_mod_low_latency to count with kernel changes
  Resolves: rhbz#1653819- realtime-virtual-guest/host: start/stop rt-entsk daemon on
  initialization/shutdown
  resolves: rhbz#1619822- Disable ksm once, re-enable it on full rollback
  Resolves: rhbz#1652076- Make python3-dmidecode a weak dependency as it's x86_64 only
- Resolves: rhbz#1565598- Fix rules for profile recommendation
- Resolves: rhbz#1565598- use online CPUs for cpusets calculations instead of present CPUs
  resolves: rhbz#1613832- Fix a traceback in tuned-gui- tuned-adm: Fix a traceback when run without action specified- used python intepreter path from the rpm macro- new release
  - rebased tuned to latest upstream
    related: rhbz#1546598
  - IRQ affinity handled by scheduler plugin
    resolves: rhbz#1590937- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1546598
  - script: show stderr output in the log
  - realtime-virtual-host: script.sh: add error checking
  - man: improved tuned-profiles-cpu-partitioning.7
  - bootloader: check if grub2_cfg_file_name is None in _remove_grub2_tuning()
  - plugin_scheduler: whitelist/blacklist processed also for thread names
  - bootloader: patch all GRUB2 config files
  - profiles: added mssql profile
  - tuned-adm: print log excerpt when changing profile
  - cpu-partitioning: use no_balance_cores instead of no_rebalance_cores
  - sysctl: support assignment modifiers as�x����������������������X�t%�
x0:5Y�$%����������������5Y6Y4Y�urrent_time.3ssl.gzX509_cmp_time.3ssl.gzX509_delete_ext.3ssl.gzX509_digest.3ssl.gzX509_dup.3ssl.gzX509_free.3ssl.gzX509_get0_authority_issuer.3ssl.gzX509_get0_authority_key_id.3ssl.gzX509_get0_authority_serial.3ssl.gzX509_get0_extensions.3ssl.gzX509_get0_notAfter.3ssl.gzX509_get0_notBefore.3ssl.gzX509_get0_pubkey.3ssl.gzX509_get0_serialNumber.3ssl.gzX509_get0_signature.3ssl.gzX509_get0_subject_key_id.3ssl.gzX509_get0_tbs_sigalg.3ssl.gzX509_get0_uids.3ssl.gzX509_get_X509_PUBKEY.3ssl.gzX509_get_ex_data.3ssl.gzX509_get_ex_new_index.3ssl.gzX509_get_ext.3ssl.gzX509_get_ext_by_NID.3ssl.gzX509_get_ext_by_OBJ.3ssl.gzX509_get_ext_by_critical.3ssl.gzX509_get_ext_count.3ssl.gzX509_get_ext_d2i.3ssl.gzX509_get_extended_key_usage.3ssl.gzX509_get_extension_flags.3ssl.gzX509_get_issuer_name.3ssl.gzX509_get_key_usage.3ssl.gzX509_get_pathlen.3ssl.gzX509_get_proxy_pathlen.3ssl.gzX509_get_pubkey.3ssl.gzX509_get_serialNumber.3ssl.gzX509_get_signature_info.3ssl.gzX509_get_signature_nid.3ssl.gzX509_get_subject_name.3ssl.gzX509_get_version.3ssl.gzX509_getm_notAfter.3ssl.gzX509_getm_notBefore.3ssl.gzX509_issuer_and_serial_cmp.3ssl.gzX509_issuer_name_cmp.3ssl.gzX509_load_cert_crl_file.3ssl.gzX509_load_cert_file.3ssl.gzX509_load_crl_file.3ssl.gzX509_new.3ssl.gzX509_pubkey_digest.3ssl.gzX509_set1_notAfter.3ssl.gzX509_set1_notBefore.3ssl.gzX509_set_ex_data.3ssl.gzX509_set_issuer_name.3ssl.gzX509_set_proxy_flag.3ssl.gzX509_set_proxy_pathlen.3ssl.gzX509_set_pubkey.3ssl.gzX509_set_serialNumber.3ssl.gzX509_set_subject_name.3ssl.gzX509_set_version.3ssl.gzX509_sign.3ssl.gzX509_sign_ctx.3ssl.gzX509_subject_name_cmp.3ssl.gzX509_time_adj.3ssl.gzX509_time_adj_ex.3ssl.gzX509_up_ref.3ssl.gzX509_verify.3ssl.gzX509_verify_cert.3ssl.gzX509_verify_cert_error_string.3ssl.gzX509v3_add_ext.3ssl.gzX509v3_delete_ext.3ssl.gzX509v3_get_ext.3ssl.gzX509v3_get_ext_by_NID.3ssl.gzX509v3_get_ext_by_OBJ.3ssl.gzX509v3_get_ext_by_critical.3ssl.gzX509v3_get_ext_count.3ssl.gzcustom_ext_add_cb.3ssl.gzcustom_ext_free_cb.3ssl.gzcustom_ext_parse_cb.3ssl.gzd2i_ACCESS_DESCRIPTION.3ssl.gzd2i_ADMISSIONS.3ssl.gzd2i_ADMISSION_SYNTAX.3ssl.gzd2i_ASIdOrRange.3ssl.gzd2i_ASIdentifierChoice.3ssl.gzd2i_ASIdentifiers.3ssl.gzd2i_ASN1_BIT_STRING.3ssl.gzd2i_ASN1_BMPSTRING.3ssl.gzd2i_ASN1_ENUMERATED.3ssl.gzd2i_ASN1_GENERALIZEDTIME.3ssl.gzd2i_ASN1_GENERALSTRING.3ssl.gzd2i_ASN1_IA5STRING.3ssl.gzd2i_ASN1_INTEGER.3ssl.gzd2i_ASN1_NULL.3ssl.gzd2i_ASN1_OBJECT.3ssl.gzd2i_ASN1_OCTET_STRING.3ssl.gzd2i_ASN1_PRINTABLE.3ssl.gzd2i_ASN1_PRINTABLESTRING.3ssl.gzd2i_ASN1_SEQUENCE_ANY.3ssl.gzd2i_ASN1_SET_ANY.3ssl.gzd2i_ASN1_T61STRING.3ssl.gzd2i_ASN1_TIME.3ssl.gzd2i_ASN1_TYPE.3ssl.gzd2i_ASN1_UINTEGER.3ssl.gzd2i_ASN1_UNIVERSALSTRING.3ssl.gzd2i_ASN1_UTCTIME.3ssl.gzd2i_ASN1_UTF8STRING.3ssl.gzd2i_ASN1_VISIBLESTRING.3ssl.gzd2i_ASRange.3ssl.gzd2i_AUTHORITY_INFO_ACCESS.3ssl.gzd2i_AUTHORITY_KEYID.3ssl.gzd2i_AutoPrivateKey.3ssl.gzd2i_BASIC_CONSTRAINTS.3ssl.gzd2i_CERTIFICATEPOLICIES.3ssl.gzd2i_CMS_ContentInfo.3ssl.gzd2i_CMS_ReceiptRequest.3ssl.gzd2i_CMS_bio.3ssl.gzd2i_CRL_DIST_POINTS.3ssl.gzd2i_DHparams.3ssl.gzd2i_DHxparams.3ssl.gzd2i_DIRECTORYSTRING.3ssl.gzd2i_DISPLAYTEXT.3ssl.gzd2i_DIST_POINT.3ssl.gzd2i_DIST_POINT_NAME.3ssl.gzd2i_DSAPrivateKey.3ssl.gzd2i_DSAPrivateKey_bio.3ssl.gzd2i_DSAPrivateKey_fp.3ssl.gzd2i_DSAPublicKey.3ssl.gzd2i_DSA_PUBKEY.3ssl.gzd2i_DSA_PUBKEY_bio.3ssl.gzd2i_DSA_PUBKEY_fp.3ssl.gzd2i_DSA_SIG.3ssl.gzd2i_DSAparams.3ssl.gzd2i_ECDSA_SIG.3ssl.gzd2i_ECPKParameters.3ssl.gzd2i_ECParameters.3ssl.gzd2i_ECPrivateKey.3ssl.gzd2i_ECPrivateKey_bio.3ssl.gzd2i_ECPrivateKey_fp.3ssl.gzd2i_EC_PUBKEY.3ssl.gzd2i_EC_PUBKEY_bio.3ssl.gzd2i_EC_PUBKEY_fp.3ssl.gzd2i_EDIPARTYNAME.3ssl.gzd2i_ESS_CERT_ID.3ssl.gzd2i_ESS_ISSUER_SERIAL.3ssl.gzd2i_ESS_SIGNING_CERT.3ssl.gzd2i_EXTENDED_KEY_USAGE.3ssl.gzd2i_GENERAL_NAME.3ssl.gzd2i_GENERAL_NAMES.3ssl.gzd2i_IPAddressChoice.3ssl.gzd2i_IPAddressFamily.3ssl.gzd2i_IPAddressOrRange.3ssl.gzd2i_IPAddressRange.3ssl.gzd2i_ISSUING_DIST_�x�����([��������X$�%�
 �XN��������$\��������������������n), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (len jazyky zalo\305\276en\303\251 na XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (bara XML-baserade spr\303\245k)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (\320\273\320\270\321\210\320\265 \320\274\320\276\320\262\320\270, \320\267\320\260\321\201\320\275\320\276\320\262\320\260\320\275\321\226 \320\275\320\260 XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (ch\341\273\211 ng\303\264n ng\341\273\257 d\341\273\261a tr\303\252n XML)'troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)-?N]l|�������#6EFVR	R
RRRRR"R	R
RRRRR"RR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"RRRR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"RR
RRRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRRR	R
RRRRRRRRRRRRRR"RRRRRRRR
RRRRRRRRRRRRR
RR"RRR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R	R
RRRRR"RR
RRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRRRR"RR
RRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRR"Rutf-820c1fa4cbd577d1f6ec0a1c418df67159a766299b915a3ec45bef038fb5afa�x��������������������X�K%�
���������������d�$�����������������d�d�d�session resumption
- various null checks and other small fixes from upstream
- upstream changes for the renegotiation info according to the latest draft- fix non-fips mingw build (patch by Kalev Lember)
- add IPV6 fix for DTLS- add better error reporting for the unsafe renegotiation- fix build on s390x- disable enforcement of the renegotiation extension on the client (#537962)
- add fixes from the current upstream snapshot- keep the beta status in version number at 3 so we do not have to rebuild
  openssh and possibly other dependencies with too strict version check- update to new upstream version, no soname bump needed
- fix CVE-2009-3555 - note that the fix is bypassed if SSL_OP_ALL is used
  so the compatibility with unfixed clients is not broken. The
  protocol extension is also not final.- fix use of freed memory if SSL_CTX_free() is called before
  SSL_free() (#521342)- fix typo in DTLS1 code (#527015)
- fix leak in error handling of d2i_SSL_SESSION()- fix RSA and DSA FIPS selftests
- reenable fixed x86_64 camellia assembler code (#521127)- temporarily disable x86_64 camellia assembler code (#521127)- fix openssl dgst -dss1 (#520152)- drop the compat symlink hacks- constify SSL_CIPHER_description()- fix WWW:Curl:Easy reference in tsget- enable MD-2- update to new major upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- do not build special 'optimized' versions for i686, as that's the base
  arch in Fedora now- abort if selftests failed and random number generator is polled
- mention EVP_aes and EVP_sha2xx routines in the manpages
- add README.FIPS
- make CA dir absolute path (#445344)
- change default length for RSA key generation to 2048 (#484101)- fix CVE-2009-1377 CVE-2009-1378 CVE-2009-1379
  (DTLS DoS problems) (#501253, #501254, #501572)- support compatibility DTLS mode for CISCO AnyConnect (#464629)- correct the SHLIB_VERSION define- add support for multiple CRLs with same subject
- load only dynamic engine support in FIPS mode- update to new upstream release (minor bug fixes, security
  fixes and machine code optimizations only)- move libraries to /usr/lib (#239375)- add a static subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- must also verify checksum of libssl.so in the FIPS mode
- obtain the seed for FIPS rng directly from the kernel device
- drop the temporary symlinks- drop the temporary triggerpostun and symlinking in post
- fix the pkgconfig files and drop the unnecessary buildrequires
  on pkgconfig as it is a rpmbuild dependency (#481419)- add temporary triggerpostun to reinstate the symlinks- no pairwise key tests in non-fips mode (#479817)- even more robust test for the temporary symlinks- try to ensure the temporary symlinks exist- new upstream version with necessary soname bump (#455753)
- temporarily provide symlink to old soname to make it possible to rebuild
  the dependent packages in rawhide
- add eap-fast support (#428181)
- add possibility to disable zlib by setting
- add fips mode support for testing purposes
- do not null dereference on some invalid smime files
- add buildrequires pkgconfig (#479493)- do not add tls extensions to server hello for SSLv3 either- move root CA bundle to ca-certificates package- fix CVE-2008-0891 - server name extension crash (#448492)
- fix CVE-2008-1672 - server key exchange message omit crash (#448495)- super-H arch support
- drop workaround for bug 199604 as it should be fixed in gcc-4.3- sparc handling- update to new root CA bundle from mozilla.org (r1.45)- Autorebuild for GCC 4.3- merge review fixes (#226220)
- adjust the SHLIB_VERSION_NUMBER to reflect library name (#429846)- set default paths when no explicit paths are set (#418771)
- do not add tls extensions to client hello for SSLv3 (#422081)- enable some new crypto algorithms and features
- add some more important bug fixes from openssl CVS- update to latest upstream release, SONAME bumped to 7- update to new CA bundle from mozilla.org- fix CVE-2007-5135 - off�x�������������`p�������X�z$�
�����������������$a��������������������operly do ssh and scp
- updating mkdumprd to use new kcp syntax- Bumping revision number- ppc64 no-more-platform fix- ppc64 fixups:
  - actually build ppc64 binaries (bug 203407)
  - correct usage output
  - avoid segfault in command-line parsing
- install kexec man page
- use regulation Fedora BuildRoot- fixed typo in mkdumprd for bz 202983
- fixed typo in mkdumprd for bz 203053
- clarified docs in kdump.conf with examples per bz 203015- updated init script to implement status function/scrub err messages- Misc spec cleanups and macro-ifications- Add %dir /var/crash, so default kdump setup works- fix another silly makefile error for makedumpfile- exclude makedumpfile from build on non-x86[_64] arches- exclude makedumpfile from build on non-x86[_64] arches- updating makedumpfile makefile to use pkg-config on glib-2.0- updating makedumpfile makefile to use pkg-config- Removing unneeded deps after Makefile fixup for makedumpfile- fixing up FC6/RHEL5 BuildRequires line to build in brew- enabling makedumpfile in build- added makedumpfile source to package- added et-dyn patch to allow loading of relocatable kernels- fixing up missing patch to kdump.init- add kexec frontend (bz 197695)- rebuild- Buildrequire zlib-devel- Bumping rev number- Add patch to allow ppc64 to ignore args-linux option- fix scriptlet - call chkconfig --add, change the default in the
  script itself (#183633)- Don't add kdump service by default, let the user manually add it to
  avoid everyone seeing a warning.- Fix kdump.init to call kexec from its new location- proper requires for scriptlets- Move kexec and kdump binaries to /sbin- Fix argument order when stopping kexec- kdump7.patch
   o Remove elf32 core headers support for x86_64
   o Fix x86 prepare elf core header routine
   o Fix ppc64 kexec -p failure for gcc 4.10
   o Fix few warnings for gcc 4.10
   o Add the missing --initrd option for ppc64
   o Fix ppc64 persistent root device bug
- Remove --elf32-core-headers from default configuration, users
  may re-add it via KEXEC_ARGS.
- Remove obsolete KEXEC_HEADERS- Remove wrong quotes around --command-line in kdump.init- Fix the service stop case.  It was previously unloading the wrong kernel.
- Implement the "restart" function.
- Add the "irqpoll" option as a default kdump kernel commandline parameter.
- Create a default kernel command line in the sysconfig file upon rpm install.- rebuilt for new gcc4.1 snapshot and glibc changes- Add patch to enable the kdump binary for x86_64- New kdump patch to support s390 arch + various fixes
- Include kdump in x86_64 builds- New kdump patch to support x86_64 userspace- rebuilt for new gcj- Report missing kdump kernel image as warning- Build for x86_64 as well.  Kdump support doesn't work there, but users
  should be able to use kexec.- Add a kdump sysconfig file and init script
- Spec file additions for pre/post install/uninstall- Initial prototype for RH/FC5/bin/sh/bin/sh/bin/shdiskdumputilskexec-tools-eppicnetdump/bin/sh/bin/sh/bin/sh	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP2.0.26-14.el8_10.22.0.26-14.el8_10.22.0.26-14.el8_10.2	




�x�����(�������h_�������X��%�
������o������8��$(����������������8�9�7��nell <iarnell@gmail.com> 4:5.14.1-173Paul Howarth <paul@city-fan.org> - 4:5.14.1-172Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-171Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-170Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-169Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-167Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-165Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-163Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-162Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-160Petr Pisar <ppisar@redhat.com> - 4:5.12.3-159Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-158Robin Lee <cheeselee@fedoraproject.org> - 4:5.12.3-157Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-156Iain Arnell <iarnell@gmail.com> 4:5.12.3-154Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.12.3-153Petr Pisar <ppisar@redhat.com> - 4:5.12.3-152Tom Callaway <spot@fedoraproject.org> - 4:5.12.3-151Petr Pisar <ppisar@redhat.com> - 4:5.12.3-150Lukas Berk <lberk@redhat.com> - 4:5.12.3-149Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-148Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-146Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-145Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-144Petr Pisar <ppisar@redhat.com> - 4:5.12.2-143Petr Pisar <ppisar@redhat.com> - 4:5.12.2-142Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-141Petr Pisar <ppisar@redhat.com> - 4:5.12.2-140Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-139Petr Pisar <ppisar@redhat.com> - 4:5.12.2-138Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-137Petr Pisar <ppisar@redhat.com> - 4:5.12.2-136Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-135Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-134Petr Pisar <ppisar@redhat.com> - 4:5.12.2-133Petr Sabata <psabata@redhat.com> - 5:5.12.2-132Petr Sabata <psabata@redhat.com> - 4:5.12.2-1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-131Petr Pisar <ppisar@redhat.com> - 4:5.12.1-130Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-129Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-128Dan Horák <dan[at]danny.cz> - 4:5.12.1-127Petr Pisar <ppisar@redhat.com> - 4:5.12.1-126Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-125Ralf Corsépius <corsepiu@fedoraproject.org> -  4:5.12.1-124Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-123Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-122Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-121Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-120-testMarcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119.1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-118Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-117Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-116Paul Howarth <paul@city-fan.org> - 4:5.10.1-115Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-114Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-112Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-111Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-110Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-109Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-107Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-106Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-105Stepan Kasal <skasal@redhat.com> - 4:5.10.1-104Stepan Kasal <skasal@redhat.com> - 4:5.10.1-103Stepan Kasal <skasal@redhat.com> - 4:5.10.1-102Stepan Kasal <skasal@redhat.com> - 4:5.10.1-101Stepan Kasal <skasal@redhat.com> - 4:5.10.1-100Stepan Kasal <skasal@redhat.com> - 4:5.10.0-87Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-86Stepan Kasal <skasal@redhat.com> - 4:5.10.0-85Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-84Stepan Kasal <skasal@redhat.com> - 4:5.10.0-83Chris Weyl <cweyl@�x�������������PO�������X��%�
3	)X�$9����������������)X*X(X��x�����DX>�������X�%�
�����XF������V�$����������������VVV�RRRRRYRRRRRYRRRRRRRRRYRRRRR	RRRYRRRRRRYRRRRRRYRRRRRRYRRRRR	R
RRRYRRRRRR	R
RRRYRRRRRRYRRRR
RRRRRRYRRRRRRRYRRRRRRRYRRRRRRRRYRRRRRRRYRRRRRRRRYRRRRRRYRRRRRRYRRRRRRRYRRRRRRYRRRRRRYP�R%RIP�R>RIRPP�PRRIRPPRRIPR%R'R,R-R/RIPRR#RCRHRIRORPPPR#R'RIPRP
R#R'RIRQPR%R'RIROPRIPPeR#RIRPPR#RIRPPR#RIRPPRIRPPRIRPPR#RIRPPRR#R6PRRIPR'PR#R'R)R*RIROPR#R)R8RBRIROPR#R)R*RIROPR#RBRIROP R#R(R)RIROP"RR'RIRPP#RR'RIRPP$RR%R'R.RIRPP&RR&R'R,R.RIRPRQP(RR#R$R'R+RBRFRIRORPRQP)RR#R'RGRIROP*RR1RIP+RR#R&R'R,R.P-RR'P0R'R4RFRIRQP1RR'RIROP2RR0RIROP3RRIROP5RR'R2RIP6R#R'R6RBRIP8PP9P:P;P<P=P>P?R#RFRIRPP@RR$R'RIROPARR$R'RIROPBRR$R'RIROPCRR$R'RIROPKPPR'RIPRRR3RR#RIRNPSRR'RIPTRR#R6PUR'PWRR'RIPXPYPZP[RIP\RR'P]R%R'RIRKRLRPP^R5RIRLRPP_RPlR#RIROPaRPbPcR#R+R4RIPdRR#R;RQPfP`PnR#RQPhR:RIPiRPjR#R%R:RIROPkPoR#RQPmR9RIROPpR#REPqRR'R<RIROPrRR'R<RIROPsR$RIPtPuR#R'R.R=RARCRDRERIRPPvRR$R'RIROPwRR#R$R%R'RIRORPPxR@RHRIRMRPP{RP|RRIROP}R&R.ROP~P�R?R@RHRIRMRPP�RIRPP�RR#R%R7RIP�RRIRPP�P�RRRIROP�P�P�RIRPP�R%RIRPP�RQP�P�RRPP�R#P�RIP�RP�RRIRQP�P�RPutf-84ef457d7661dd1104d92a6384e6a6474ac9e96e116d5c0e615a9bcbdf2e2077a?���d���3!�^���P,��*����%�h�>x
	*����%����ϋ1��?�s�2k��|�K����V�NkuL�/U.�
�j�:�q[�jN�~be(������{���3�!���iЮ�k��6EX~K��*Dn�ll�h��P��m�Q��1��^2��g�Z@�����[�N�7|�͢��;i��_����&���*�λR�����V*��k2i��3�M
�r8�b������t�R2H�0��㖿`�䯎�������O��Y桺(=ɘ�)���ͣ]6���4
+���x!�/����o�8]w���k�J+T|;�Ҥ|
d��+\�ҋ��n�>Y�h7+TAkN����n!~Ē��
q�ܓ:5y�(&3��5�#�<���:��)4嶪��HN+��U�q�� �=���W�=�t���X���x�HB"og�����76$dbؾ7��M���K0��0��>��o���� �n�ұ���_t�{9�:��Q�/�zg׬g	#�ܻ�:��ۥ5T_t�Qբ2A��4�M�Z_
�E����a犾�3!�^���P,��*����%�h�>w
	*����%�u��Mb2T��y'��F0!�#�O�
�+Ԋʎ?��c3H��Q>#	Ȥ�}�����U'ŌӍ�;\��x�����҄υ/�e�&>nk�]�n�����B�ٞЊ�D�Ϧ�+>�#D�l��C�|��?t����^i�y����p���W����MNľ���r7<�	�3G�$-��c�S-�W!�k�֩�p��Κ��� ���6��i�K�t��c�#8����k�L�,9r�/���۵P�G�<<fy�ޑ@�k��ؚL�V>�K]�i�g?��jMPda�3):k5� *_���@{χl�4Aw(Cf�H�#�Ӛ�ݓ]�V~`ciV�2�G��Q
�W���#����1��4�An��@�1C@S#�s�뙔 �1vs%X'��Mrn+-p�U#h�iM���^D6��[��$,K�3�ExX&�<A������[��K�Ә�A<��r:(�|�Ȩ�>Ru=ݽ�O�%Y��7i����U2d7ae74c2fd0e572b8ab1ec6c7b2a02970aff62568b094f471f02b4b3f947222c6633964cb29535e2e7456517875195764c6a49bh�K��x�������������@.�������X�!$�
������������������$b��������������������c8b319d537e4926fc430f745cc23aa8cf1f7eeb93e1d39cbe36a083625065f96c04963ff9fa41634cb2d1073cddeb801ea69d1cb3bbadb61f8f0e5519794e9f745de4351edef34a952f6de998620963bbf5a3c0dc374ee055c047adb937320da21cd7550fe05981e2b5a70e88d1fd9ed209254f8f8d777e61253820b5e5d21089b12eb05fab22c6f36fa9e193b29948af0df43ceaf1ac493ab46db49407eca26889e55be695a30c6b1e9efbec8a7d30944bda7f2d9806f0978916769c49785231062469487be7ee1859ab2d6482bd941e3a2aa7f1f854800e11a55a6aa15cc9b6debabf7979b9131d6b72d2495f06e64b719e1c1c6a7c987205530da6dec092a5bfe708e3a846f2b78fab140c37a6c9d7c1e22aeb8f45cab80bc46dcfc8e4854e4efb77c300ae397cf9bcf4b2c99913fec598899a3a08cfc6c0028e652464a136aebf8f282fee18867d7af8d69691a4ea37a6627b60bd17631cc79052c22c044d74081a743a044aeb85929339f846c9df9334679fe2813b8ef1ba8cccb76991a66632f24631f31d12d6f5c87012006bd38976bbac7d22af81a1849c69f47791a1bca313f59e09f0a8b2a03e65da668cc2bc651e192f2938bb1c122f045e3ed35116daa671b87bca791285e1c391ca65144b00c828e063bc3d41adf0a997b20de9461fb9f69e97a227a667df613e1b720dbf9e6210ba774175a8ed1b1a4bcada9cb4cc81628d7a5ea610173bd95220d30c7526ddaf7fe6db963ebf72747b3d8788129eaaad85927c1ab2edf93e7d225915348878f1bed45e52e2f60604dd11e795fae53632d5a9bd52960fdc1012984792e9f5c3e20b0768aeee240a856450fe5456ee29e9252b81bd1e24ed3bc43915f0c41be5d7a2d05ef651d814b963dadfa8dff5f9210834c057e883dea3797339bba452c34e0a8da4ef706fdb95ca4783e5320e0f5e1d383d9652235883345da3888057d097f1589d97f98a6d73747a74a4225376e5ed193b57e8b438247035bd78cf89aaca7eff9af4d551f8ef87867bf1277058cab8c07fe78ba4bf3f1c38742964b338415fc2c342eccbeea849237649844995c77ac707600f8a6029a8ee6f71d8dea1d7f42cd127eccbeea849237649844995c77ac707600f8a6029a8ee6f71d8dea1d7f42cd127e42c305807fbf827e77c781de4c8f9d7e2eded13f70611eb97b995d2719c2901e42c305807fbf827e77c781de4c8f9d7e2eded13f70611eb97b995d2719c2901eb6e6fb1485237b68f3b25a993e89afc9c6ddd5a550c4898189b7842e5585f16a4935173968859c686938ae411bbb9156c48aae760bbdf64c4893241193bb25bd2d74038e05aebe980ffab0ec73bc91057d0176f986301574ce4d3229e2b2ceb5d5ef392d69da16b0c72bd700786cb0ab13b032d046ceb14f2bb93b683b3177f6a32051432a8c942cfab0593086989ef7579521f5a9e3374c4661c753167a5ba53f26d022266fa9367f3e24f53cfd755b4da9e3a46874c9c4dffe0ac30808ccb0d1114d3ca05eaaf071f14ea7f7171513989ee3d422a6f53974bb1c45100a104548a8801a9a22421f20ad21b8cc632606886209684fc74f9a8a2271e268b8ed156fb59f9600425774128dd0dda3e23a1dfec2281327bf22acc578b92e6a661e456fb59f9600425774128dd0dda3e23a1dfec2281327bf22acc578b92e6a661e4544535f43021874340863361cde4e665d24ac07c6240e732f4fd947048673437a44535f43021874340863361cde4e665d24ac07c6240e732f4fd947048673437add6504c25a5aee2eb6c88f10e94694358eeb4236d80ab7d6a3109459bb51613fdd6504c25a5aee2eb6c88f10e94694358eeb4236d80ab7d6a3109459bb51613f52bc48cdeda71da8660c65db0a34c298455bb827d16d760e2f4c5d208748995052bc48cdeda71da8660c65db0a34c298455bb827d16d760e2f4c5d2087489950420a0c3b2c73cc7bdd31ed48b7d8417f3105aef6f712ec40621fbd49051703f2420a0c3b2c73cc7bdd31ed48b7d8417f3105aef6f712ec40621fbd49051703f24c9e98a42b581136b136de203c7d5e2e715464e61f917999b5159270fb8fa9034c9e98a42b581136b136de203c7d5e2e715464e61f917999b5159270fb8fa90384208880ad8e12107ba0ad8b79ab3cbe0c14fd9c7dd4cd035745a2e7d008572084208880ad8e12107ba0ad8b79ab3cbe0c14fd9c7dd4cd035745a2e7d0085720f151633692db5f5c11bec0bb7ee01eb8069589a4866bf2baec387cf75c8c4b0ff151633692db5f5c11bec0bb7ee01eb8069589a4866bf2baec387cf75c8c4b0f590a48b197645534fa3fc7abc216222b2166bf6ae0ad691a363f7c894a2008ad590a48b197645534fa3fc7abc216222b2166bf6ae0ad691a363f7c894a2008ad25908facdaaccfee13532d42e74643b6e1d4deba182667c169e9c130ffe4161fc8ad697d6efa9bbb0e35f2b03b08de3feab4b17b70a56ae81e7f7e6891152cd8d8b7709ead1f6f75a904488a10dc22ad86d10481f5b336bb9ae89e7cd7972716694c6d623a94509f62cb2ec204010e5b54aebcb223feb7f854dcbec8b0599db2694c6d623a94509f62cb2ec204010e5b54aebcb223feb7f854dcbec8b0599db288b6b737e839e0d9eb790a8033ee9abb1fa3609a541b74fd0d60ec073b503ea288b6b737e839e0d9eb790a8033ee9abb1fa3609a541b74fd0d60ec073b503ea24e475bc65662416e54071f4b36dd72d5f720e68fc5ff194014eb86d95201d6ca4e475bc65662416e54071f4b36dd72d5f720e68fc5ff1940�x���������������������X�%�
���������*�d�$P�����������������d�d�d�3aa99513563c3ed8e88582175b27757b896e0e768461332d9fc4547683eaad3af2c5060922abc41bcd141ff973e2f00e49020407d94f74c5e23aa80cd3ae972f93d700e9f97f9c08cad381c8a169e1c4d5ce4185eac595fa2fed0d293e561077ddc972f833c0ec9089ca67c590e057beb1f4ea065c71feba4a6554dfce74770ae18fa11093820b557acf07f42ecad850a66463c2b0d187fe1d12a7f665ed6297d65b2b102a1533d64dcfb486b2bbeefe8aeb31665b59beeeaed0b422729b0bab9e21e64a3e121594d960b085f30e45f18e49729b7645d868e9b56d234983ce5f5535027282844710ebc1d5644301ee78698a4cc0f0698ac2dfc350c3801e2601e508b88559f4ead59eaea55aa001c436e9413a9fe074551d7344db003301da77f4e3493843c3386a757b1d82316d6a1f2da35a7bc52008c5fce38c5c56a52e7a40893ae64d258ed36f8e03051172c8ff4fb82b06c832f292c49e80fdcd37dddf16aeae5826a3da8f2dc17eed9ca2a0df0257ccd9edf80f907594428d3beac09d5a551593486cc292990ee4442d509b7ba6945ba327f569074749b732e05535278808c3a67f50c89415e2f90996b02ebf4d084037bf9a8ab35aa0e2fc62d48ed92c5550142b33ca2740eb85067acae771aa32aa121e6563075ece970fc9434ece1ad2401ccc1a112fd50ff29b84ae7c2c5590599570fa0e87450be784223c8145137e29f9ae0da86cefe845fddc47dfe4cd7b5a3dc7cad4c6cf1a22ade1ad1615e50aabbb42178ff576e8769dc54bde14e5883d67e8cfac5b1a9aca7f536913932d3925f67c7267e8e080d9b2eae80b2b6195a559c662c365f218832c242dcedb6cb560f5179d051af3de97510219aae13be50589e0308981e79e290b30dcc84bf58adba59bf87a72f5060b2a3399c6baa45498ee644fd7c97671c9a4f711c15034cc76bc36a9146601ebdc003c9ebb30f21f0720d24d260d24e4baa3019f804483b2743da07cb22d0de3092bb2b9fe743a3435bb7038b7c39d14035715d40e1be6468082d6a846dee41857921527ded3805c85d14f5738db78c954b193997508f1203f75931f0d88c4a46bace2a096a0108fef6282978ae245c17aef8194c3e6a8e8877b165d6aa0ae07178d857d1e2079f624a2f12e57f9e945ee1fd69aedff9dc49308ab4da828be33ab98f6bb6b550aa9a4543420daa06df91b7b825835800fb0075b2a31ee550f7272ce60edb2b027e9b534b7330aaa9ca54b6b976d5e1bdc96cda669a2ba2b8839208dfe2f46eb01c3c1421c70b5403a920b23cffa641aaa2e298a5438afaf1536879328c3d1889c407774d34422579184a6aef451990a6ec44aa4a0c52d6cdacacf8b5f4e0a9c6f28d0c98343235171b2126e31a06096270da5327f520f1d1307bf1e18bccd4ec76d5142aa99c9e47fb8b9b8352235738edc8b6275afde0dd44fe419bc6441d95a8479c9e64a75c1bb6a74c0a9381ecf4ba34ef0597aa8c9d2f1f7658952befcddcae6ba5938e7e22050e7be126cd7c480e13df7aff9adddf99e1ab51e95c059b6152ebdc52548f5085411684d49847429d657f6d13c45d0ebd6c6a06a17ec369d4c15c9c944bca6b8628b29180ef3549a2f37599450414a40cb04a647b93db0415871aad5554bad9d54fba5e19524506d2bf6510326683de6b3df98656454878a8a4726dc01a142f268c77f7e568423b314135671f4fd68c4e9d1bc938e3cf62b9ac9732e2bd5efc161a0d9ec73c726969fb92f9b2ee6bad2bdc4f540355a6a951d5dc80cd6c2580ea431b08645d4e94ee84a08c4ff50c62d8f00493e4a7fff70605289ecce79541b8e00d0e4ca6162e9c5d3832af0af64289eb924185e36ee16b529ccb59abfb5d03ef387e031c531beeb78f3315e760e7c1fea72c8e3c0489e0248d0289690f49acd2c8324726cb5869e0335b3cde82d0240a0d264fc252582530c5fe88198b04482470c6f22725a997e459e757053d70c3d993ce25eb190d420aa81d254034fdec4091a25817a0078907f652a0450d33d441bc218d8f9cc8719bf10bd01b709e79a28d21221d69c5997999f5f1529068bb0b65f5528e96fad597f9d69d3c15beccf726a3ab6f1b668249d79a367a2e120bca83cc20183b379a8b820167c82de47676953294c570ed0fed5e9a5e9ebe0024d9890e79d4d33556df21ae2165c25e2c7378ac8ebbb91e6d5e568dc34821648098aae0f9d2285d16742ae6933657eaeb845ce2f05b2a1e1b5bead134600c180e56034fbbe8fd2a1283675d7ae60891c508c8ada9183384c63c09ded6ecdd961033e746463bd35cc2060ee2530d95d74d8ab3293bff7f0826e31b11a5036bebe9b34e1148da0e48b1f9c4106d273cc8d6041199a96dfb0644cdc08935930ed37ec312832128ce18cdf147ffd5ee5f4d999d708f61386cb04f3e787d9dda5cfc89710d3da942a4a3af0bb1996d01b94a8f7a081b34ebd28dc6c9ecf39731f55dde290db5a24d387919cbe�x�������������0
�������X��%�
�S�+������!�$o����������������!~!�!�s (bug #978233)
- Fix crash with \&$glob_copy (bug #989486)
- Fix coreamp.t's rand test (bug #970567)
- Reap child in case where exception has been thrown (bug #988805)
- Fix using regexes with multiple code blocks (bug #982131)- 5.18.1 bump (see <http://search.cpan.org/dist/perl-5.18.1/pod/perldelta.pod>
  for release notes)
- Disable macro %{rebuild_from_scratch}
- Fix regex seqfault 5.18 regression (bug #989921)
- Fixed interpolating downgraded variables into upgraded (bug #970913)
- SvTRUE returns correct value (bug #967463)
- Fixed doc command in perl debugger (bug #967461)
- Fixed unaligned access in slab allocator (bug #964950)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.16.*)- Perl 5.18 rebuild- Define SONAME for libperl.so and move the libary into standard path
- Link XS modules to libperl.so on Linux (bug #960048)- Do not load system Term::ReadLine::Gnu while running tests
- Disable ornaments on perl5db AutoTrace tests- Update to Perl 5.18.0
- Clean patches, not needed with new version- Edit local patch level before compilation- Do not distribute File::Spec::VMS (bug #973713)
- Remove bundled CPANPLUS-Dist-Build (bug #973041)- Update SystemTap scripts to recognize new phase__change marker and new probe
  arguments (bug #971094)
- Update h2ph(1) documentation (bug #948538)
- Update pod2html(1) documentation (bug #948538)
- Do not double-own archlib directory (bug #894195)- Move CPANPLUS-Dist-Build files from perl-CPANPLUS
- Move CPAN-Meta-Requirements files from CPAN-Meta
- Add perl-Scalar-List-Utils to perl-core dependencies- Require $Config{libs} providers (bug #905482)- Correct typo in perl-Storable file list (bug #966865)
- Remove bundled Storable (bug #966865)- Sub-package Storable (bug #966865)- Use lib64 directories on aarch64 architecture (bug #961900)- Make regular expression engine safe in a signal handler (bug #849703)
- Remove bundled ExtUtils-ParseXS, and Time-HiRes- Sub-package Time-HiRes (bug #957048)
- Remove bundled Getopt-Long, Locale-Maketext, and Sys-Syslog- Fix leaking tied hashes (bug #859910)
- Fix dead lock in PerlIO after fork from thread (bug #947444)
- Add proper conflicts to perl-Getopt-Long, perl-Locale-Maketext, and
  perl-Sys-Syslog- Sub-package Sys-Syslog (bug #950057)- Sub-package Getopt-Long (bug #948855)
- Sub-package Locale-Maketext (bug #948974)- Remove bundled constant, DB_File, Digest-MD5, Env, Exporter, File-Path,
  File-Temp, Module-Load, Log-Message-Simple, Pod-Simple, Test-Harness,
  Text-ParseWords- Filter provides from *.pl files (bug #924938)- Conflict perl-autodie with older perl (bug #911226)
- Sub-package Env (bug #924619)
- Sub-package Exporter (bug #924645)
- Sub-package File-Path (bug #924782)
- Sub-package File-Temp (bug #924822)- Sub-package constant (bug #924169)
- Sub-package DB_File (bug #924351)- Correct perl-Digest-MD5 dependencies
- Remove bundled Archive-Extract, File-Fetch, HTTP-Tiny,
  Module-Load-Conditional, Time-Local- Correct dependencies of perl-HTTP-Tiny
- Sub-package Time-Local (bug #922054)- 5.16.3 bump (see <http://search.cpan.org/dist/perl-5.16.3/pod/perldelta.pod>
  for release notes)
- Remove bundled autodie, B-Lint, CPANPLUS, Encode, File-CheckTree, IPC-Cmd,
  Params-Check, Text-Soundex, Thread-Queue- Fix CVE-2013-1667 (DoS in rehashing code) (bug #918008)- Sub-package autodie (bug #911226)
- Add NAME headings to CPAN modules (bug #908113)- Fix perl-Encode-devel dependency declaration- Sub-package Thread-Queue (bug #911062)- Sub-package File-CheckTree (bug #909144)
- Sub-package Text-ParseWords
- Sub-package Encode (bug #859149)- Remove bundled Log-Message
- Remove bundled Term-UI- Correct perl-podlators dependencies
- Obsolete perl-ExtUtils-Typemaps by perl-ExtUtils-ParseXS (bug #891952)- Sub-package Pod-Checker and Pod-Usage (bugs #907546, #907550)- Remove bundled PathTools- Sub-package B-Lint (bug #906015)- Sub-package Text-Soundex (bug #905889)
- Fix conflict declaration at perl-Pod-LaTeX (bug #904085)
- Rem�x�������8�����X��$�
оh������_�$O����������������_^`�.de>Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-2Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-1Preston Brown <pbrown@redhat.com> 2.11a-4Bernhard Rosenkraenzer <bero@redhat.com> 2.11a-3Erik Troan <ewt@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Tim Powers <timp@redhat.com>Preston Brown <pbrown@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Oliver Paukstadt <oliver.paukstadt@millenux.com>Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Prospector <bugzilla@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Peter Jones, <pjones@redhat.com>Christian 'Dr. Disk' Hechelmann <drdisk@tc-gruppe.de>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Michael Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>David S. Miller <davem@dm.cobaltmicro.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Mike Wangsmo <wanger@redhat.com>Cristian Gafton <gafton@redhat.com>Michael Fulbright <msf@redhat.com>Michael Fulbright <msf@redhat.com>Erik Troan <ewt@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com�x������������� �����X��%�
��������0)��������$]�������������������0f?������`{
	Q�d~�����i��)z�������;�����Ҝ�V�"��c_�Y]Bp�g��D����tpk��ǐm\���7w�4�5����3�^�[c�*¸��W���/�5����n-��+�ʣh1y�'*5/d�[G>;V��{2�բ��\�&"��/D�����Z�FR��x0�e����H���O緤"�V�X�Z ��L_����%*����l(㲎��"�*l��G�P��sJj��Wn��
F-�_[HGQ9f�헥MZ;�3��]������Y�SWL�tu6�™n! ]�1!�lp��{C���	��{�e�嵜c�j���h���^�ʏ�HM�*.�Se0��:<_W�[46�`Y�����QE7�#�xx�
:�s	�LE����q-+���T��`{
	Q�d~���
���LHd(�Y<`�Tw<�"nt��W%�(El���E[���ϡ�ߌ���rCr�2D|N���/ ��c�WՈ>c�D��/6��m����Y[ɔN9���;3�2X�&%N-G���R����$E�U�Ez���b@�ugԥxF����>�JeL㣻�>��\�ɺp���K�9ԌɊ$i5$mm���D���Fp�:�i��;B�$^���q�w}!I����A��z���
�X��G��v��}��'�
P3�e��A}$�M��!���A>!�iSB�3��E(�TU`��i2����U(�:	�
�VL&t+4�Oxc��U�Ҧ׵���Q�+�ޓ�"�%Ap^B͠s4zV�1fb4a736cbeb59012264b2884f58a899584ef7a8cde82605a5e26d4e81731757a0bad7a5902e3f67f24b8959aedbceb51706b663fX�-O�DfX�1831fdfe06e465cc4ea73201Frs&8b1e4ddd5cc02e30eddf17538c8e318a618ef7t.om0&90ebb39221789e412dc6577f42fc82ba9b0bde.4.Hn&894d521ea6dc5478ade1d889927351d2ddb135il 2n&8fdbc9439215c52a3bedd3d90d7f7e67df8176 <p"h&95f4f1581b8e843f13eddd4d277d0250a3fa09@re� &8a00530d277bcf7f7f20943982e5db0d6cf329m> �P95nir�c94hat�1.91Phi�p90ch@�^ 8f.13�Br8epkn�"t8d - �d&8c87b0e6d05a4a790f11724c80cb2079621e12oje�.8c2P� &8d2193ffaaa9cf72d71e6e8d8d40aea6ea37a7ch �e&8a14b63ef0bc7ca6c417993b0eb52aad4cc687@re�.&8b88b25e0aca6d52af984ac3dd508b0773af1�5&8a0636fa948d15b33276b1d18fb1ce65e70eab7f6ps&89df6be658a01b5c9788d3b588a508bb34fa9289cn!u|�� 8aZ� &8a00530d277bcf7f7f20943982e5db0d6cf329m> Hn&894d521ea6dc5478ade1d889927351d2ddb135il ^V&8904089270e6483234c8ae5eef2324c111971f Va(Luz�D���i89hat

88W8897.bin

88W8864.bint	z8859-9_to_uni.transgz�88859-9.a0-ff.univ�^8859-9.a0-ff.16.gz]�08859-9.a0-ff.14.gz600�
8859-9.a0-ff.08.gz1028859-8_to_uni.trans�_8859-8.a0-ff.uni.�
8859-8.a0-ff.16.gz
�38859-8.a0-ff.14.gz000�8859-8.a0-ff.08.gz~z8859-7_to_uni.transn���8859-7.a0-ff.uni.�28859-7.a0-ff.16.gz202�o8859-7.a0-ff.14.gz4d5�18859-7.a0-ff.08.gze8859-6_to_uni.trans�8859-6.a0-ff.uni0�b8859-6.a0-ff.16.gzC08�
8859-6.a0-ff.14.gz
�38859-6.a0-ff.08.gzple.8859-5_to_uni.transBA�8859-5.a0-ff.uni-�s8859-5.a0-ff.16.gz
�8859-5.a0-ff.14.gz�78859-5.a0-ff.08.gz`
8859-4_to_uni.transin�g8859-4.a0-ff.uniA�8859-4.a0-ff.16.gz��8859-4.a0-ff.14.gz��8859-4.a0-ff.08.gzuga8859-3_to_uni.trans��s8859-3.a0-ff.uniB�8859-3.a0-ff.16.gz��r8859-3.a0-ff.14.gz�8859-3.a0-ff.08.gz�.8859-2_to_uni.trans60�18859-2.a0-ff.uni�S8859-2.a0-ff.16.gz�B8859-2.a0-ff.14.gz��8859-2.a0-ff.08.gz��8859-1_to_uni.trans=8859-15_to_uni.transb�a8859-15.a0-ff.uni�8859-14_to_uni.trans
�98859-14.a0-ff.uni�38859-13_to_uni.trans{�z8859-13.a0-ff.uni�x�������������������X��$�
ȥ8dw�$g����������������wvx� interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ad8354d972938319b884fb36888e569bdff03022, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b36a99048e84c2a955bee735169f59b039a1ea25, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7f0cde2e3b1b80255577f22b50a1497df5649d61, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=71b3bc571fe6d7405202c249e49eff69131719c8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7448517ff53d40df18051ba50ad313e51881cf77, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=56708bfcdd0b212c0d8dfbe17ba4d3ca76407d96, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5eb883c9111918963553b0b1ffd855d7ee9782d9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b231d4062f3875f63ddca0b7b43a8216da8da464, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a3f861a1075c1fe1796b0646f5dcb34c69334c3a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3445fc8dbdb11ac88ebc3f1a74eadc0d0b255628, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fdc24e50487346c643a9b516c4e14791e54eab94, strippedAlgol 68 source, ASCII textUTF-8 Unicode textBourne-Again shell script, ASCII text executableTenex C shell script, ASCII text executabletroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)	"'/=I[do�������������-9LZfx���������������	!*0ELRZgpz������������"8BLQepx������������� *;RWk�x�����о������X5w%�
Hj�������2Y�$"����������������2Y3Y1Y�2o_SCT_LIST.3ssl.gzi2t_ASN1_OBJECT.3ssl.gzlh_TYPE_delete.3ssl.gzlh_TYPE_doall.3ssl.gzlh_TYPE_doall_arg.3ssl.gzlh_TYPE_error.3ssl.gzlh_TYPE_free.3ssl.gzlh_TYPE_insert.3ssl.gzlh_TYPE_new.3ssl.gzlh_TYPE_retrieve.3ssl.gzo2i_SCT.3ssl.gzo2i_SCT_LIST.3ssl.gzpem_password_cb.3ssl.gzsk_TYPE_deep_copy.3ssl.gzsk_TYPE_delete.3ssl.gzsk_TYPE_delete_ptr.3ssl.gzsk_TYPE_dup.3ssl.gzsk_TYPE_find.3ssl.gzsk_TYPE_find_ex.3ssl.gzsk_TYPE_free.3ssl.gzsk_TYPE_insert.3ssl.gzsk_TYPE_is_sorted.3ssl.gzsk_TYPE_new.3ssl.gzsk_TYPE_new_null.3ssl.gzsk_TYPE_new_reserve.3ssl.gzsk_TYPE_num.3ssl.gzsk_TYPE_pop.3ssl.gzsk_TYPE_pop_free.3ssl.gzsk_TYPE_push.3ssl.gzsk_TYPE_reserve.3ssl.gzsk_TYPE_set.3ssl.gzsk_TYPE_set_cmp_func.3ssl.gzsk_TYPE_shift.3ssl.gzsk_TYPE_sort.3ssl.gzsk_TYPE_unshift.3ssl.gzsk_TYPE_value.3ssl.gzsk_TYPE_zero.3ssl.gzssl_ct_validation_cb.3ssl.gz/usr/include//usr/include/openssl//usr/lib64//usr/lib64/pkgconfig//usr/share/doc//usr/share/doc/openssl-devel//usr/share/man/man3/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������������X�	&�
p��������������$;�������������������VR�?M�d��	��	�	F�<�@�\�`�j�t���	�����
�`x	�
�X	�

$
� ��8` � 2 (�)�*L+w,�-�8�f9Hf:)�f>A�?A�@A�BA�DA�GA�HBLIB�XB�YB�ZC[C\C]C�^D�bF&dGveG{fG~lG�tG�uHvHx
wK�xL8yL�(�MH�ML�MR�M�M�M�6O�O�6
R(RQ�R�R�R�gR�hR�Ccronie1.5.210.el8Cron daemon for executing programs at set timesCronie contains the standard UNIX daemon crond that runs specified programs at
scheduled times and related tools. It is a fork of the original vixie-cron and
has security and configuration enhancements like the ability to use pam and
SELinux.f4�x64-builder02.almalinux.org�AlmaLinuxAlmaLinuxMIT and BSD and ISC and GPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Basehttps://github.com/cronie-crond/cronielinuxx86_64# run after an installation

if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset crond.service &>/dev/null || : 
fi# run before a package is removed

if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now crond.service &>/dev/null || : 
fi# run after a package is removed

if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart crond.service &>/dev/null || : 
fi�Bnd�8��'��TPV��
Wv�$A큤�����������A�A�A�A���A큤����A큤����������A�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�Z�8�Z�:�X~>f4�X~>f4�f4�f4�f4�f4�f4�ad03f0fdb025e5b5a1c7f83cce837bb3ef8acfc8276efec6a17d39ec5a34756ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855b853e02adab40733e24f3b9757d9fb0078b734039ebdfdc085b322056529de1bf6e6c5ff94824545c9fee7e87857e49d4c4e966c6b5d8395190be08f7f2d2002a94151df6b78916177e5c3c3e7ad0c344f21aa5be2507c06229ae5152ff48a8d301b5bcfca6a3cfde00a4e2a2708892d01ab7639f087a8eca26a37d01d98b2b52233c23447eedafd1c66fc95a0c33467990d2b01fec89506593d9b4e092ab87614c800ab882d42af411df13631b059bbad9bc5f45b8fa23e63dbe129665bc46d422123b08e5afc5ef90bbbdfeff89223d60eef4e289a00f803a0e6f1907b26698802e2185f7200a078de5cf50a2f4149aad934a15c9071beb9fec331dd29aa869ff0e7602ba2ae0ddb16f10f417a4cde490598c25ce1cfb9e8d0dfb447fddb3d45898c8f5cbcdb95f215f48a99f2fbc311060c047541d1f954304d5d5cec8e2040628512ce3dfb19b729b4a4d4c4f68abc3f0b23f55f9ae0f87fc79774fc43227459fbfd3425ce7c97573909c6bca3967dd02165e2e69deebac21bada0c1a2fb57dbcb509e623211e4b77d76859b61a908734864d7173f09262b3cf6c3f6cfbce781e41fd8e89c8f0f37c4031722968b1346a2b3606f1b9be7ab7e1fa14f4c62c93e612e5d0ae66e118ef5698fd24b9a6f203c65c6cd48fa57bef42372f390f8../../../../usr/sbin/crond../../../../usr/bin/cronnext../../../../usr/bin/crontab��x������������������X��%�
@��@������0��$ ����������������0�1�/��ug #826872)- Sub-package perl-podlators (bug #856516)- Do not access freed memory when cloning thread (bug #825749)
- Match non-breakable space with /[\h]/ in ASCII mode (bug #844919)
- Clear $@ before `do' I/O error (bug #834226)
- Do not truncate syscall() return value to 32 bits (bug #838551)- Move App::Cpan from perl-Test-Harness to perl-CPAN (bug #854577)- Remove perl-devel dependency from perl-Test-Harness and perl-Test-Simple- define perl_compat by macro for rebuilds
- sub-packages depend on compat rather than on nvr- apply conditionals for dual life patches- 5.16.1 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)
- Fixed reopening by scalar handle (bug #834221)
- Fixed tr/// multiple transliteration (bug #831679)
- Fixed heap-overflow in gv_stashpv (bug #826516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Move the rest of ExtUtils-ParseXS into its sub-package, so that the main
  perl package doesn't need to pull in perl-devel (bug #839953)- Fix broken atof (bug #835452)- perl-Pod-Perldoc must require groff-base because Pod::Perldoc::ToMan executes
  roff- Test::Build requires Data::Dumper
- Sub-package perl-Pod-Parser- Remove MODULE_COMPAT_5.14.* Provides- Perl 5.16 rebuild- perl_bootstrap macro is distributed in perl-srpm-macros now- Own zipdetails and IO::Compress::FAQ by perl-IO-Compress- Fix find2perl to translate ? glob properly (bug #825701)- Shorten perl-Module-Build version to 2 digits to follow upstream- upload the stable 5.16.0- clean patches, not needed with new version
- regen by podcheck list of failed pods. cn, jp, ko pods failed. I can't decide
  whether it's a real problem or false positives.- Enable usesitecustomize- Rebuild perl against Berkeley database version 5 (bug #768846)- perl-Data-Dumper requires Scalar::Util (bug #811239)- Sub-package Data::Dumper (bug #811239)- Sub-package Filter (bug #790349)- Fix searching for Unicode::Collate::Locale data (bug #756118)
- Run safe signal handlers before returning from sigsuspend() and pause()
  (bug #771228)
- Correct perl-Scalar-List-Utils files list
- Stop !$^V from leaking (bug #787613)- Rebuild again now that perl dependency generator is fixed (#772632, #772699)- perl-ExtUtils-MakeMaker sub-package requires ExtUtils::Install- Rebuild for gcc 4.7- Fix interrupted reading. Thanks to Šimon Lukašík for reporting this issue
  and thanks to Marcela Mašláňová for finding fix. (bug #767931)- Fix leak with non-matching named captures (bug #767597)- Sub-package ExtUtils::Install
- Sub-package ExtUtils::Manifest
- Do not provide private perl(ExtUtils::MakeMaker::_version)- Add $RPM_LD_FLAGS to lddlflags.- Sub-package Socket- Sub-package Pod::Perldoc- Increase epoch of perl-Module-CoreList to overcome version regression in
  upstream (bug #754641)- perl(DBIx::Simple) is not needed in spec requirement in CPANPLUS. It's generated
  automatically.- Provide perl(DB) by perl- Do not warn about missing site directories (bug #732799)- cleaned spec (thanks to Grigory Batalov)
-  Module-Metadata sub-package contained perl_privlib instead of privlib
-  %files parent section was repeated twice- Filter false perl(DynaLoader) provide from perl-ExtUtils-MakeMaker
  (bug #736714)
- Change Perl_repeatcpy() prototype to allow repeat count above 2^31
  (bug #720610)
- Do not own site directories located in /usr/local (bug #732799)- Fix CVE-2011-3597 (code injection in Digest) (bug #743010)
- Sub-package Digest and thus Digest::MD5 module (bug #743247)- add provide for perl(:MODULE_COMPAT_5.14.2)- 5.14.2 bump (see
  https://metacpan.org/module/FLORA/perl-5.14.2/pod/perldelta.pod for release
  notes).
- Fixes panics when processing regular expression with \b class and /aa
  modifier (bug #731062)
- Fixes CVE-2011-2728 (File::Glob bsd_glob() crash with certain glob flags)
  (bug #742987)- Enable GDBM support again to build against new gdbm 1.9.1- Disable NDBM support temporarily too as it's provided by gdbm package- Disable GDBM suppor�x�������������x�����X�H%�
��������������d�$�����������������d�d�d�0c- use a random seed if the supplied one did not generate valid
  parameters in dsa_builtin_paramgen2()- do not break contract on return value when using dsa_builtin_paramgen2()- fix afalg failure on big endian- update to upstream version 1.1.0b- Add flags for riscv64.- minor upstream release 1.0.2j fixing regression from previous release- Fix enginesdir in libcrypto.c (#1375361)- minor upstream release 1.0.2i fixing security issues
- move man pages for perl based scripts to perl subpackage (#1377617)- fix regression in Cisco AnyConnect VPN support (#1354588)- require libcrypto in libssl.pc (#1301301)- minor upstream release 1.0.2h fixing security issues- disable SSLv2 support altogether (without ABI break)- enable RC5- reenable SSL2 in the build to avoid ABI break (it does not
  make the openssl vulnerable to DROWN attack)- minor upstream release 1.0.2g fixing security issues- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- minor upstream release 1.0.2f fixing security issues
- add support for MIPS secondary architecture- document some options of openssl speed command- enable sctp support in DTLS- remove unimplemented EC method from header (#1289599)- the fast nistp implementation works only on little endian architectures- minor upstream release 1.0.2e fixing moderate severity security issues
- enable fast assembler implementation for NIST P-256 and P-521
  elliptic curves (#1164210)
- filter out unwanted link options from the .pc files (#1257836)
- do not set serial to 0 in Makefile.certificate (#1135719)- fix sigill on some AMD CPUs (#1278194)- re-enable secp256k1 (bz1021898)- minor upstream release 1.0.2d fixing a high severity security issue- fix the aarch64 build- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- minor upstream release 1.0.2c fixing multiple security issues- Add aarch64 sslarch details- fix some 64 bit build targets- add alternative certificate chain discovery support from upstream- rebase to 1.0.2 branch- drop the AES-GCM restriction of 2^32 operations because the IV is
  always 96 bits (32 bit fixed field + 64 bit invocation field)- fix CVE-2015-0209 - potential use after free in d2i_ECPrivateKey()
- fix CVE-2015-0286 - improper handling of ASN.1 boolean comparison
- fix CVE-2015-0287 - ASN.1 structure reuse decoding memory corruption
- fix CVE-2015-0289 - NULL dereference decoding invalid PKCS#7 data
- fix CVE-2015-0293 - triggerable assert in SSLv2 server- fix bug in the CRYPTO_128_unwrap()- fix bug in the RFC 5649 support (#1185878)- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- test in the non-FIPS RSA keygen for minimal distance of p and q
  similarly to the FIPS RSA keygen- new upstream release fixing multiple security issues- disable SSLv3 by default again (mail servers and possibly
  LDAP servers should probably allow it explicitly for legacy
  clients)- update the FIPS RSA keygen to be FIPS 186-4 compliant- new upstream release fixing multiple security issues- copy negotiated digests when switching certs by SNI (#1150032)- add support for RFC 5649- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- drop RSA X9.31 from RSA FIPS selftests
- add Power 8 optimalizations- new upstream release fixing multiple moderate security issues
- for now disable only SSLv2 by default- fix license handling- disable SSLv2 and SSLv3 protocols by default (can be enabled
  via appropriate SSL_CTX_clear_options() call)- use system profile for default cipher list- make FIPS mode keygen bit length restriction enforced only when
  OPENSSL_ENFORCE_MODULUS_BITS is set
- fix CVE-2014-0224 fix that broke EAP-FAST session resumption support- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- new upstream release 1.0.1h- Drop obsolete and irrelevant docs
- Move devel docs to appropriate package- new upstream release 1.0.1g
- do not include ECC ciphersuites in SSLv2 client hello (#1090952)
- fai�x������������������X�&�
������������$�����������������J�?�d����	�	?�(�,�D�H�S�^�f�	��������

	

,
T
^

�
�

4P
x��O(u8|9�:	$BwG�
H�
I�
X�Y�Z[\
]@
^�	b
�d�e�f�l�t�
u$
vLw�
x
y@�l�p�v�����o�
G���
�g�h�Clibgudev2324.el8GObject-based wrapper library for libudevThis library makes it much simpler to use libudev from programs
already using GObject. It also makes it possible to easily use libudev
from other programming languages, such as Javascript, because of
GObject introspection support.]�86build.cloudlinux.com=CloudLinuxCloudLinuxLGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://wiki.gnome.org/Projects/libgudevlinuxx86_64+h�@�g�A�A�������A큤A큤]�86]�86]�86]�84]�86]�86]�86Y��]�86UU��b6e26e8d150f17a0885d5a5be26bad004e21a104eca8bbf14233b4199a1e730378686337a16949a2758bea1e9fd63891359791b3db17dc54f2bbb15f33e009c24e5a0a7315a15a2aba35a30a64612f1bf6fbe6c9e9bed326d971ae81ca9743a0dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe551../../../../usr/lib64/libgudev-1.0.so.0.2.0libgudev-1.0.so.0.2.0�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibgudev-232-4.el8.src.rpm��������������������������������libgudevlibgudev(x86-64)libgudev-1.0.so.0()(64bit)libgudev1@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libpthread.so.0()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2[O+�Z�S�Zz�@Zu�@Y�K�Y�@Yx�@X��@V�=@U�a@Uj��Bastien Nocera <bnocera@redhat.com> - 232-4Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 232-3Fedora Release Engineering <releng@fedoraproject.org> - 232-3Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 232-2Kalev Lember <klember@redhat.com> - 232-1Fedora Release Engineering <releng@fedoraproject.org> - 230-6Fedora Release Engineering <releng@fedoraproject.org> - 230-5Fedora Release Engineering <releng@fedoraproject.org> - 230-4Fedora Release Engineering <releng@fedoraproject.org> - 230-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 230-2Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 230-1+ libgudev-232-4
- Remove umockdev dependency- Pull in patch from upstream to fix build- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Update to 232
- Enable self tests- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedorapro�x�������������hx����X�`#�
��������Ht�V�$&�����������������V�VF
a_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Removed undefined-non-weak-symbol warnings- Initial packaging/sbin/ldconfig/sbin/ldconfig	�0-10.585svn.el80-10.585svn.el8.build-idd8b8baede904fb7d14f2c10f2800c7ed88f1a016libstemmer.so.0libstemmer.so.0.0.0libstemmerBSD.txtNotice.txtREADME/usr/lib//usr/lib/.build-id//usr/lib/.build-id/d8//usr/lib64//usr/share/doc//usr/share/doc/libstemmer/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d8b8baede904fb7d14f2c10f2800c7ed88f1a016, stripped, too many notes (256)ASCII text, with very long linesASCII textPRRRRutf-82fcbc7a646ac0221f3e7710e69558a61a8c967f41f746c17755765e868bee42c?��� ���`�
	Q�d~�����kp�#�Q��8���t�U�tCN褯�w�z�c�L��
�=<�����-���R�(C�(�T��-�Ԏ�L$���mNm1����W�Dg]0e�4B��=�~��)Fu�bI?jt0�Zv�x���G<�T.�ma�\"�5��=�����U/x�>�K��n+ܳ=�߇�DV��ډ��f�'>(��:~�r.�@���Qq���d�t��&�}^E.�����]��<&M�rL��0��J^�41x�g
+�]W�"�����u6U��n�?C����<T����M�����'�{�L�	i9�;!��'3v��OxY��1<R&�R��]��j i#��(R�f��<��$Z+{#��L֫>��W/9J����y�t�}��`�
	Q�d~���������H,J]6���fT_��F�]{I��(N<�'6?�(�Ü���������T��X�2�c�H���g��sT�9�t'V�{��S��\SB/�	/qL��t�:9]��2b<IJ������򉃮fG�5�&�?0L�j�{�-�
�[dQ8�u(9�=�hT��s��=�������k�����3I�IW�o�KX
����p�$j;y�_���ږ�ؠᏡ�'=UA�G����"���vk��X�B m�j|/V��Jy�Q�[��P"��l�J;���~3\zbls���uq���8��.E31�0A���o���g+=�0�~x�yÖ�j�	��
M9w{�������y�$�Ų�N�c186067d91a03066ab45ddd565cd7a77e993f3a12279e29826b3d14f9579e88badf3d5c0bd74272e9f1f543776d296b7c8633356fX�X��fX�Usun_vndr	gsun2�tsun12x22.psfu.gz	fsun1
�_
sun-pl.map.gz
�dsun-pl-altgraph.map.gz 1K	e
�sun��isum.1.gz-�Plsumb/�esulogin.8.gzs�+3suloginon��9tsuk4��	ssuite.py/��	nsuite.cpython-36.pyc/��	/suite.cpython-36.opt-2.pycib6��	/suite.cpython-36.opt-1.pyc/lio
8
sudoreplaynuio.n
sudoers.so2 (oEoGoIoKoMoNoPoSoUoWoYo\o^o`obodoeogoiolonoporotovoxozo|o~o�o�o�o�s
sudoers.mong o�-sudoers.ldap.5.gzog	sudoers.do�asudoers.5.gzpoo<9sudoersato	 sudoeditro-asudo_noexec.soepeoDoFoHoJoLoOoQoRoToVoXoZo[o]o_oaocofohojokomoooqosouowoyo{o}oo�o�o�sudo.moamo�osudo.conf.5.gzels ooo$o;l	sudo.confo�-sudo-ldap.conf.5.gzinocsudo-ldap.confst orsudo-it a�x�����0�������pg����X��%�
�������pv���5��$%����������������5�6�4��t131211.t test random failures
- Fix t/op/hash.t test random failures
- Parse caret variables with subscripts as normal variables inside ${...}
  escaping (RT#131664)
- Do not display too many bytes when reporting malformed UTF-8 character
- Fix select called with a repeated magical variable (RT#131645)
- Fix error message for "our sub foo::bar" (RT#131679)
- Fix executing arybase::_tie_it() in Safe compartement (RT#131588)
- Fix handling attribute specification on our variables (RT#131597)
- Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907)
- Fix compiler warnings in code generated by ExtUtils::Constant
  (CPAN RT#63832, CPAN RT#101487)
- Fix GCC version detection for -D_FORTIFY_SOURCE override (RT#131809)- Enable separate debuginfo back- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- perl package installs all core modules, interpreter moved to
  perl-interpreter package, perl-core package is obsolete
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>
  (bug #1464903)- Make File::Glob more resistant against degenerative matching (RT#131211)
- Fix a crash when calling a subroutine from a stash (RT#131085)
- Fix an improper cast of a negative integer to an unsigned 8-bit type (RT#131190)
- Fix cloning :via handles on thread creation (RT#131221)
- Fix glob UTF-8 flag on a glob reassignment (RT#131263)
- Fix a buffer overflow in my_atof2() (RT#131526)
- Fix handling backslashes in PATH environment variable when executing
  "perl -S" (RT#129183)
- Fix a conditional jump on uninitilized memory in re_intuit_start() (RT#131575)
- Fix spurious "Assuming NOT a POSIX class" warning (RT#131522)
- Provide perl-interpreter RPM dependency symbol
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>- Stop providing old perl(MODULE_COMPAT_5.24.*)- 5.26.0 bump (see <http://search.cpan.org/dist/perl-5.26.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages
- Update or remove patches
- Enable hardening (bug #1238804)
- Use 64 bit ints on 32 bit platforms (bug #1268828)- Introduce build-conditions for groff, systemtap, syslog tests, and tcsh- Fix a null-pointer dereference on malformed code (RT#130815)
- Fix an use-after-free in substr() that modifies a magic variable (RT#129340)
- Fix a memory leak leak in Perl_reg_named_buff_fetch() (RT#130822)
- Fix an invalid memory read when parsing a loop variable (RT#130814)
- Fix a heap-use-after-free in four-arguments substr call (RT#130624)- Adapt Compress::Raw::Zlib to zlib-1.2.11 (bug #1420326)
- Fix a heap buffer overflow when evaluating regexps with embedded code blocks
  from more than one source (RT#129881)
- Fix a memory leak in list assignment from or to magic values (RT#130766)- Adapt tests to zlib-1.2.11 (bug #1420326)
- Fix a crash when compiling a regexp with impossible quantifiers (RT#130561)
- Fix a buffer overrun with format and "use bytes" (RT#130703)
- Fix a buffer overflow when studying some regexps repeatedly
  (RT#129281, RT#129061)- Fix UTF-8 string handling in & operator (RT#129287)
- Fix recreation of *:: (RT#129869)
- Fix a memory leak in B::RHE->HASH method (RT#130504)
- Fix parsing goto statements in multicalled subroutine (RT#113938)
- Fix a heap overlow in parsing $# (RT#129274)- Fix a buffer overflow in split in scalar context (RT#130262)
- Fix a heap overflow with pack "W" (RT129149)
- Fix a use-after-free when processing scalar variables in forms (RT#129125)
- Fix a heap overflow if invalid octal or hexadecimal number is used in
  transliteration expression (RT#129342)
- Fix out-of-bound read in case of unmatched regexp backreference (RT#129377)- 5.24.1 bump (see <http://search.cpan.org/dist/perl-5.24.1/pod/perldelta.pod>
  for release notes)- Rebuild for readline 7.x- Remove bundled Math-BigInt-FastCalc (bug #1408463)
- Remove bundled Math-BigRat (bug #1408467)
- Remove bundled bignum (bug #1409585)- Fix a crash in optimized evaluation of "or ((0) x 0))" (RT#130247)
- Fix a memory leak in IO::Poll (RT#129788)�x������	�V����X�m%�
��0������id�$y����������������idjdhd�ion.3ssl.gzSSL_CTX_get_mode.3ssl.gzSSL_CTX_get_num_tickets.3ssl.gzSSL_CTX_get_options.3ssl.gzSSL_CTX_get_quiet_shutdown.3ssl.gzSSL_CTX_get_read_ahead.3ssl.gzSSL_CTX_get_record_padding_callback_arg.3ssl.gzSSL_CTX_get_recv_max_early_data.3ssl.gzSSL_CTX_get_security_callback.3ssl.gzSSL_CTX_get_security_level.3ssl.gzSSL_CTX_get_session_cache_mode.3ssl.gzSSL_CTX_get_timeout.3ssl.gzSSL_CTX_get_tlsext_status_arg.3ssl.gzSSL_CTX_get_tlsext_status_cb.3ssl.gzSSL_CTX_get_tlsext_status_type.3ssl.gzSSL_CTX_get_verify_callback.3ssl.gzSSL_CTX_get_verify_depth.3ssl.gzSSL_CTX_get_verify_mode.3ssl.gzSSL_CTX_has_client_custom_ext.3ssl.gzSSL_CTX_keylog_cb_func.3ssl.gzSSL_CTX_load_verify_locations.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_remove_session.3ssl.gzSSL_CTX_select_current_cert.3ssl.gzSSL_CTX_sess_accept.3ssl.gzSSL_CTX_sess_accept_good.3ssl.gzSSL_CTX_sess_accept_renegotiate.3ssl.gzSSL_CTX_sess_cache_full.3ssl.gzSSL_CTX_sess_cb_hits.3ssl.gzSSL_CTX_sess_connect.3ssl.gzSSL_CTX_sess_connect_good.3ssl.gzSSL_CTX_sess_connect_renegotiate.3ssl.gzSSL_CTX_sess_get_cache_size.3ssl.gzSSL_CTX_sess_get_get_cb.3ssl.gzSSL_CTX_sess_get_new_cb.3ssl.gzSSL_CTX_sess_get_remove_cb.3ssl.gzSSL_CTX_sess_hits.3ssl.gzSSL_CTX_sess_misses.3ssl.gzSSL_CTX_sess_number.3ssl.gzSSL_CTX_sess_set_cache_size.3ssl.gzSSL_CTX_sess_set_get_cb.3ssl.gzSSL_CTX_sess_set_new_cb.3ssl.gzSSL_CTX_sess_set_remove_cb.3ssl.gzSSL_CTX_sess_timeouts.3ssl.gzSSL_CTX_sessions.3ssl.gzSSL_CTX_set0_CA_list.3ssl.gzSSL_CTX_set0_chain.3ssl.gzSSL_CTX_set0_chain_cert_store.3ssl.gzSSL_CTX_set0_security_ex_data.3ssl.gzSSL_CTX_set0_verify_cert_store.3ssl.gzSSL_CTX_set1_cert_store.3ssl.gzSSL_CTX_set1_chain.3ssl.gzSSL_CTX_set1_chain_cert_store.3ssl.gzSSL_CTX_set1_client_sigalgs.3ssl.gzSSL_CTX_set1_client_sigalgs_list.3ssl.gzSSL_CTX_set1_curves.3ssl.gzSSL_CTX_set1_curves_list.3ssl.gzSSL_CTX_set1_groups.3ssl.gzSSL_CTX_set1_groups_list.3ssl.gzSSL_CTX_set1_param.3ssl.gzSSL_CTX_set1_sigalgs.3ssl.gzSSL_CTX_set1_sigalgs_list.3ssl.gzSSL_CTX_set1_verify_cert_store.3ssl.gzSSL_CTX_set_allow_early_data_cb.3ssl.gzSSL_CTX_set_alpn_protos.3ssl.gzSSL_CTX_set_alpn_select_cb.3ssl.gzSSL_CTX_set_block_padding.3ssl.gzSSL_CTX_set_cert_cb.3ssl.gzSSL_CTX_set_cert_store.3ssl.gzSSL_CTX_set_cert_verify_callback.3ssl.gzSSL_CTX_set_cipher_list.3ssl.gzSSL_CTX_set_ciphersuites.3ssl.gzSSL_CTX_set_client_CA_list.3ssl.gzSSL_CTX_set_client_cert_cb.3ssl.gzSSL_CTX_set_client_hello_cb.3ssl.gzSSL_CTX_set_cookie_generate_cb.3ssl.gzSSL_CTX_set_cookie_verify_cb.3ssl.gzSSL_CTX_set_ct_validation_callback.3ssl.gzSSL_CTX_set_ctlog_list_file.3ssl.gzSSL_CTX_set_current_cert.3ssl.gzSSL_CTX_set_default_ctlog_list_file.3ssl.gzSSL_CTX_set_default_passwd_cb.3ssl.gzSSL_CTX_set_default_passwd_cb_userdata.3ssl.gzSSL_CTX_set_default_read_buffer_len.3ssl.gzSSL_CTX_set_default_verify_dir.3ssl.gzSSL_CTX_set_default_verify_file.3ssl.gzSSL_CTX_set_default_verify_paths.3ssl.gzSSL_CTX_set_ex_data.3ssl.gzSSL_CTX_set_generate_session_id.3ssl.gzSSL_CTX_set_info_callback.3ssl.gzSSL_CTX_set_keylog_callback.3ssl.gzSSL_CTX_set_max_cert_list.3ssl.gzSSL_CTX_set_max_early_data.3ssl.gzSSL_CTX_set_max_pipelines.3ssl.gzSSL_CTX_set_max_proto_version.3ssl.gzSSL_CTX_set_max_send_fragment.3ssl.gzSSL_CTX_set_min_proto_version.3ssl.gzSSL_CTX_set_mode.3ssl.gzSSL_CTX_set_msg_callback.3ssl.gzSSL_CTX_set_msg_callback_arg.3ssl.gzSSL_CTX_set_next_proto_select_cb.3ssl.gzSSL_CTX_set_next_protos_advertised_cb.3ssl.gzSSL_CTX_set_num_tickets.3ssl.gzSSL_CTX_set_options.3ssl.gzSSL_CTX_set_post_handshake_auth.3ssl.gzSSL_CTX_set_psk_client_callback.3ssl.gzSSL_CTX_set_psk_find_session_callback.3ssl.gzSSL_CTX_set_psk_server_callback.3ssl.gzSSL_CTX_set_psk_use_session_callback.3ssl.gzSSL_CTX_set_quiet_shutdown.3ssl.gzSSL_CTX_set_read_ahead.3ssl.gzSSL_CTX_set_record_padding_callback.3ssl.gzSSL_CTX_set_record_padding_callback_arg.3ssl.gzSSL_CTX_set_recv_max_early_data.3ssl.gzSSL_CTX_set_security_callback.3ssl.gzSSL_CTX_set_security_level.3ssl.gzSSL_CTX_set_session_cache_mod�x������`F����XJ�$�
���������e���`�$p����������������`_a�>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq
- fix RHEL-18451 - logger: initialize socket credentials control union
- fix RHEL-16070 - util-linux: issues in libblkid
- fix RHEL-6274 - lslogins incorrect account expiration field- increment release number- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq- fix #2117355 - Add additional documentation for fstab
- fix #2184728 - libuuid - downport cache related patch
- fix #2188894 - The swapon man page of -p(priority) option shows incorrect.
- fix #2227097 - wall(1) fail when trying to use seat0- fix #2180413 - Backport hint about systemd daemon-reload- improve #2160321 - [last] ut->ut_user is not null terminated- fix #2121699 - fstrim -av fails to trim root filesystem on Red Hat Coreos 
- fix #2142496 - update upstream tests
- fix #2149394 - umount outputs inaccurate error message when umount() fails with EACCES
- fix #2159544 - lslogins "Password is locked" status changed in util-linux-2.32.1-38
- fix #2160321 - [last] ut->ut_user is not null terminated- fix #2141969 - Add --cont-clock feature for libuuid and uuidd- improve tmpfiles.d use in spec file (related to #2059241)- update atari partition tests (related to #2060030)- fix #2060030 - Please backport patches for atari partition detection to RHEL 8
- fix #2069187 - Internal testsuite for lscpu failed on aarch64
- fix #2093166 - lslogins reports incorrect "Password is locked" status
- fix #2059241 - rpm -V / --verify reports bad user/group/mtime for /run/uuidd
- fix #2044592 - Move /var/log/lastlog ownership to systemd- fix #2058176 - losetup Retry LOOP_SET_STATUS64 on EAGAIN- rebuild after revert- change bug number (#2016229 to #2041498)- improve #2026511 fix - blkid fails to complete when targeting non-block devices
- fix #1950187 - Ambient capabilities failed to applied to non-root user- update lib-sys-add-sysfs_chrdev_devno_to_devname.patch (#2026511)- fix #1988955 - script command continues without stopping.
- fix #2041498 - incorrect partition size calculation for BLKPG_* ioctls
- fix #2011602 - logger from util-linux incorrectly handles long messages
- fix #1916151 - [RFE] spread fstrim.timer across time
- fix #1894192 - Update or backport setpriv --pdeathsig
- fix #2026511 - blkid fails to complete when targeting  non-block devices- fix #1906157 - after su from root to a normal user mesg is unable to show current status
- fix #1917852 - findmnt: add option to list all fs-independent flags
- fix #1922299 - throws error using /sbin/nologin: invalid option -- 'c'
- fix #1940607 - lsblk sometimes returns block devices in wrong order with --pairs
- fix #1919529 - [RFE] RHEL-8: Support option flags with mount(8) --bind
- fix #1946921 - RHEL8: mount --rbind -o rprivate doesn't do recursive bind mount- update lscpu-show-physical-socket-on-aarch64-without-ACPI-P.patch (#1882740)- update regression tests (related to #1900498)- fix #1884194 - RHEL-8: chrt command does not support the -R option
- fix #1855759 - mount.8: clarify (no)suid behavior on file capabilities
- fix #1861670 - lsblk can not show serial information for virtio disk
- fix #1883783 - lscpu: avoid segfault on PowerPC systems with valid hardware configurations
- fix #1900498 - libfdisk/libmount: backport two patches for upstream systemd
- fix #1883056 - lscpu support for Fujitsu A64FX
- fix #1882740 - lscpu: use SMBIOS Type 4 strings for CPU vendor and model on ARM- fix #1848919 - Update losetup man page to fix "--direct-io" defaults- fix #1826251 - remove MD metadata 0.90 based tests from util-linux CI
- fix #1812576 - RFE: Bitlocker detection for RHEL 8.3
- fix #1817726 - add libblkid BLOCK_SIZE
- fix #1803753 - RHEL-8: col struct char_str c_column field should be of unsigned type and/or larger than 16 bit
- fix #1812118 - mount -a always tries to mount smb3 share subdir despite being already mounted
- fix #1824727 - util-linux: Include python3-libmount package in th�x�����8k�������5����X;�$�
������������s�$c����������������srt�y linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cbb1127ad5c32d0ebd416db5b6050bafed1bbef3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=81f48c27d66282a04dfe1be7fcabda2847a38dac, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b0acc07b4e7553291368912761ccd0cf8deb4d1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fa78e3ef0c2e1b2c11a566b32d7a09c944cb6ea2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=26f840aa8aaf351d6db02657710d4d67d0386521, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a3a3f7a633db84a38c2c31aa5026844ba19adb9d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=39151120aba86b79c44792da063cd5ba688e3dc5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=578197c089708b3416bc29fcd59d841c72ac308f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e9233b7b682b460975a18b93bafa64c32f9f9684, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=abc92ca53fff204b8c138db0c1875c9b5080b982, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=064260a6230beda04eb252db03555241020324f8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6f3972e436819a532462d5f62ad0816bca52af7e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4bfdf3b9a45c0228b0a2bfdd376e48b58b91f36c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a7a7d8e00e96d0d9230d12060035a1a78239c92b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cf9991e8f9318ae0a27cedd2c50d0050f6bf79b3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c6388d29e31b46dbebd8c97d43839130a7d68206, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d25b460efd4edd6e04d182126d575cccc7c4473b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=97fe06643ca18cf95b7a8d2d832d0d67c550d534, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9d98322b1766e1778b5246be23672ad96544052e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2f0b0a383360b8423522795127961534bdb060e2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, �x��������������%����X�z%�
*�{������0X�$ ����������������0X0Y/X��x�������������8����X��%�
���������$���:��$*����������������:�;�9��isar@redhat.com> - 4:5.22.0-352Petr Pisar <ppisar@redhat.com> - 4:5.22.0-351Petr Pisar <ppisar@redhat.com> - 4:5.22.0-350Petr Pisar <ppisar@redhat.com> - 4:5.22.0-349Petr Pisar <ppisar@redhat.com> - 4:5.22.0-348Petr Pisar <ppisar@redhat.com> - 4:5.22.0-347Petr Pisar <ppisar@redhat.com> - 4:5.22.0-346Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.22.0-345Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-244Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-242Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-328Petr Šabata <contyk@redhat.com> - 4:5.20.2-327Petr Šabata <contyk@redhat.com> - 4:5.20.2-326Petr Pisar <ppisar@redhat.com> - 4:5.20.2-325Lubomir Rintel <lkundrak@v3.sk> - 4:5.20.2-324Petr Pisar <ppisar@redhat.com> - 4:5.20.2-323Till Maas <opensource@till.name> - 4:5.20.2-322Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-321Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-320Petr Pisar <ppisar@redhat.com> - 4:5.20.1-319Petr Pisar <ppisar@redhat.com> - 4:5.20.1-318Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-317Petr Pisar <ppisar@redhat.com> - 4:5.20.1-316Petr Pisar <ppisar@redhat.com> - 4:5.20.1-315Petr Pisar <ppisar@redhat.com> - 4:5.20.1-314Petr Pisar <ppisar@redhat.com> - 4:5.20.1-313Petr Pisar <ppisar@redhat.com> - 4:5.20.1-312Petr Pisar <ppisar@redhat.com> - 4:5.20.1-311Petr Pisar <ppisar@redhat.com> - 4:5.20.1-310Petr Šabata <contyk@redhat.com> - 4:5.20.1-309Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-308Petr Pisar <ppisar@redhat.com> - 4:5.20.0-307Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-306Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-305Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-304Petr Pisar <ppisar@redhat.com> - 4:5.18.2-303Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-302Petr Pisar <ppisar@redhat.com> - 4:5.18.2-301Petr Pisar <ppisar@redhat.com> - 4:5.18.2-300Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-299Petr Pisar <ppisar@redhat.com> - 4:5.18.2-298Petr Pisar <ppisar@redhat.com> - 4:5.18.2-297Petr Pisar <ppisar@redhat.com> - 4:5.18.2-296Petr Pisar <ppisar@redhat.com> - 4:5.18.2-295Petr Pisar <ppisar@redhat.com> - 4:5.18.2-294Petr Pisar <ppisar@redhat.com> - 4:5.18.2-293Petr Pisar <ppisar@redhat.com> - 4:5.18.2-292Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-291Petr Pisar <ppisar@redhat.com> - 4:5.18.1-290Petr Pisar <ppisar@redhat.com> - 4:5.18.1-289Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-288Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-287Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.0-286Petr Pisar <ppisar@redhat.com> - 4:5.18.0-285Petr Pisar <ppisar@redhat.com> - 4:5.18.0-284Petr Pisar <ppisar@redhat.com> - 4:5.18.0-283Petr Pisar <ppisar@redhat.com> - 4:5.18.0-282Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.0-281Petr Pisar <ppisar@redhat.com> - 4:5.16.3-280Petr Pisar <ppisar@redhat.com> - 4:5.16.3-279Petr Pisar <ppisar@redhat.com> - 4:5.16.3-278Petr Pisar <ppisar@redhat.com> - 4:5.16.3-277Petr Pisar <ppisar@redhat.com> - 4:5.16.3-276Petr Pisar <ppisar@redhat.com> - 4:5.16.3-275Petr Pisar <ppisar@redhat.com> - 4:5.16.3-274Petr Pisar <ppisar@redhat.com> - 4:5.16.3-273Petr Pisar <ppisar@redhat.com> - 4:5.16.3-272Petr Pisar <ppisar@redhat.com> - 4:5.16.3-271Petr Pisar <ppisar@redhat.com> - 4:5.16.3-270Petr Pisar <ppisar@redhat.com> - 4:5.16.3-269Petr Pisar <ppisar@redhat.com> - 4:5.16.3-268Petr Pisar <ppisar@redhat.com> - 4:5.16.3-267Petr Pisar <ppisar@redhat.com> - 4:5.16.3-266Petr Pisar <ppisar@redhat.com> - 4:5.16.3-265Petr Pisar <ppisar@redhat.com> - 4:5.16.3-264Petr Pisar <ppisar@redhat.com> - 4:5.16.3-263Petr Pisar <ppisar@redhat.com> - 4:5.16.3-262Petr Pisar <ppisar@redhat.com> - 4:5.16.3-261Petr Pisar <ppisar@redhat.com> - 4:5.16.2-260Petr Pisar <ppisar@redhat.com> - 4:5.16.2-259Petr Pisar <ppisar@redhat.com> - 4:5.16.2-258Petr Pisa�x������������������X��%�
:0���G��$W����������������G�H�F��d1a16c27c56e40ff94ea316daa75d0e35a22afe2008f0044e0c3770a3cdd730363609137b9ad0a7899b555e0942ece823e760e08530cba2f13b8bc1abc64e2395058508dc460895a78e7986b103815c651512c098ae53d59ce4304040811f1e3301608edf268f649a8ffc259d9e77b4fbca1c350c2b005f49e35fb444760c3950ab1210214ab80a5fbe4107bc7682ec7e48d48b25b67b0b75925d96b7bc6ccd94e332ca0b3597d13c034130e6bba8b9229acfa20f13a4c5e2a14726eb46f8cfb3c91ec01a757b7945d538b6a42edb855580cb23b50dc259e6b84ecbc04139ad157a559a6850925f02fcf5ae176264972f40e6f08c00100ba75ad5b0c0493cfcd4f6e534a57455453b0cde818a7fd60790b81633a323cdca6a6a9cf56edc5ae1fcfc8e77af7d16e0ee29ac2a1717d8bcf6e1300b09ed57ec4117c0b3b97ff3b51803cf3011d715656917b5acabd569bfc5ee6a95ea9033ae4b1887afb4802f440786d9d72ed729513fbbe36bcfb6a41d70f1e90da59b554c7cdb5f82b12f669aecd41116a2cc9501250eb70431f3b909a9a22a348159e91f14f42187f533afce1dfe8e158b0069fd58dd2772b3a4d4ae416c6c2243abdd41b9a8fee9b55dec588eea893a2714351e7f1f5b09a79ba85e4a899d070c814fbc3a824a337b62875815374a0fb5245d975e68e5a2a56dad858a88287a99295159678488ce84f9626c9f7797d00423169e711d2dcaa2ba01270b7e8f6a73672751bbe44746d601d5c06035b21656d091904fbf355e4e2bfea64de702ee3888df6e0bd10baa1458acfb3649aee1184a2dd28d5bedcc31e5d0cc0dd7c6922a0242fa8adf185cf4487a8a0c840554a6f3194943252aa5a3a9afd57e7c21dd49b8cde337e8d9ac730d8c6ce3f23e881e79d775d14871a6e92f4e5901d44cfd205f743245ddb126f031b2aa68f4610b40fcea789468e454d20b4f4296a5d49bcf55786459c3fe30655fc20e136d1b51961e6132cc42c1afbd6d94d1fa5888160634fd79a49262169f1534a5731e800ae85a472633b64d5aa2f86d930881fcdef53eee786658fa8fc80809f03253a431c1e7a64b1fd60933e42aa83db3f5a2ebc830ead61968179f2b37db76613a6a95171b17818b305ee4eea4407831aa17a9221e315f4fe241e80dea655267111b59ef1e17368d1f970020f1932d304723152287c5def42ea0516de51cb06ae2a7fbbaca1b3f363327919104d7f68fe9fdfacb774f081eec4013d89c38c4cdb800556c640c2ede43b5a3dca1f20206fb1b4fa3b3b5e77f39491a13345f10bbf2a59a8597098911949dc0e08acf5b3aa7730f16c111fe617d7a74c5477815af4810364bc33f572726badb303b7793dc898672bfcc2be6772747e221bb5ac6a0581d480244c8fc9092fbdfeac4210584b0c8554205d079073003562f8a1499ef4f9e48632753863d2604ff9f0c2dafa2fa62522d2021e1af85186b6958d7130478a57bcd77f568beedd206e56189a13bb311740c9e4cf8c38cc30640d947cadf6bcfb02b034e02cdf5dadda0a80260b3d47b0fe35506e4a2b2b0fc8921010c0e4cebf9e8bdc9776056fdf8b89b5afb39432c532c19feff14c4c9f6263a2360f949cfa80d47aa6033a3ded0c7e084dddc68c746399c8848298370e796bdd357c4248b224b3d32c793f71b047dc1c8a201b11636f042e221f51792e98fa0ac66e0d07937e287ea56b4429fbb4215d64c31107bceb1c9e6cd22d85a692ba63d2b12a9e4e6866ffa0be93409195bf59b2ee80d048f455105b4a665330beae53ead0b863a8cb4c7b9cb41f64db8263a76b5d803a5330acdee9e968ace8cf90322f629ffb0f541225e6499000be08d110a2da980f3e857f7bbd5647ddf5549546430326cf5f6773aea0b6b6c9c91089bb2043f2747510415efe68884c06ef81c34fc1707a460d861592975543ebfa8a7436972f62363b4a2a57f81e8a5eddcfd4331753c5596118f5e6405de7ddf806dafea8a0f2cda0de441bb18d5a8f4c044b3b7562a5a0cac9d4ce56ae9e06ca6f8c06318f1d60ac2e8f84d27f340306d8b2588ccacfadf52815dcb093f1d07cc5740493ef8b96799c0836534434a56c0f3b4856e150e1376a4f3a6bb811aa5d2b398277ea71ea5695e7ebf4c5097ab84f308c5ed222c0efe0c0234a1d9f9e1d850ee0538cd4eb1273f9452c89d6fe8948ba7b403c3f684968ae0a1c12f4b18adeca9e333ae17dbe45a17d8799a4207e3780ae2bd52914f40d97b9b48afe3cd739197ecec6983d10ec8e2a1c65bd768e4510ac54719b2af2c9783826f3fb7ff36f1049db7e6e2cd92cd0e8c6cec6518e92cd982159a8bfc2db3c81f387012fe53c173796c8bba680735df4d5329af4a8f96abcfeff56037f4be5d7e82fa2f719a3bd486186b8a4a910b88bd8a503ee4f077b3c36fdc8e450fda74f899bacbc887c24fe374c2d2c0e6c673684dce91a9900a274502f574b935e7f4f89489dcfbcdc6ae8ea727fbb6026fd6030901ccc709a99e05aee2932e466b928758add67d30be9d6cb5974c7ed3f6200f0d805f0e67c41b123123e891dfb98272c1c7cfe17cfecfafd12a59e5df8a185315b38cd303ae7d0d5a3fca946e1a4d989df7e761cf0c82f025f92253a9f8d283c203a80357167c9915c8121b669fe5c783845b4f38e30ee938088a7431126388158736d379e321d09b2f7b950be7d9d8447af6ec48a2516e8ad8a796373e6f89224d587767de5719578845efa4c02436199bfaf2daa2ef7353075ed9d9377d8e12924f67a42d39fa8605229b57f78df30fb7fbd74c6c5cd06b12�x�����xI������������X�$�
�A����������$k�������������������L/,?+d����	�	8�|�������������	���?�EL�	�
,�8
�		�
 
@
�8"�"h"(�8�9:P>�@�B�G�H `I �X!Y!$Z!L[!P\!X]!�^#db&dd'�e'�f'�l'�t'�u(Hv(�w)\x)�y*<�*��*��*��+++�,�,��
.�.��/// g/$h/(Ccryptsetup-libs2.3.77.el8Cryptsetup shared libraryThis package contains the cryptsetup shared library, libcryptsetup.e+a�x64-builder01.almalinux.org ��AlmaLinuxAlmaLinuxGPLv2+ and LGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Librarieshttps://gitlab.com/cryptsetup/cryptsetuplinuxx86_64-#HIrjo��q�g��8�ŝ ��)���C!$/�R��>�B#��A�A�A�������A큤��������������������������������������e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�O1d`P�Ȉe+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�d6bb4b689200c2348945700a6b0dad5df92bc2015860d15f36a25590814d77b00f8629d71a149e283f11966880fbd4649f72dac58ee73ab2898de5dbd230fdf145670cce8b6a0ddd66c8016cd8ccef6cd71f35717cbacc7f1e895b3855207b338c33cc37871654ec7ed87e6fbb896c8cf33ef5ef05b1611a5aed857596ffafa5956d0a91de87341f2dfb8a368e07f48f551664d6c198961d47cfeb2871211c5476a39c8c29196100c56ea4d99da32f0fe856c7eaf773b3f56d6bd7ebef681636699bffa295584c8aec0b7e152f690cc70e2a98bdc307f724d9ffb911f48f1c96803b4f86d3fb43f763a1a25bd17d59585332d2b4b26261369047d740c4bf534b1473d41a3ebd6fea41a04e21d323efb5570e1b56b44b4482072b564c2a7c44e8fec0c8a6379ce2ebe746d89dfaf34088af9807d16df489899c8343ac81a582d97cfb80aed1ddd3710b56a6fa11e3d75c1fe793607d2e1d40c3447841d2a38070ebd90da02522962a67732b8600e28e93f216ce47f8c2c621a30f35921515af0e35fc8a7e3a5dec7eb29c353acf9b5545702eb121ee02568acd4dabf3e69ee0d017d5bdb3dab5034e4e7f0642abb2ff91f58df5afe154ec46c490d3aabf25203f8fa39aeefe9a99c86df7e0398cc94e4c6c63b32f52002f2470a8d4a6043052870a40840454b8a0dd0a6adf3d6d402180e4c25e591fee5f4251017f1e05d1c29271b075da371f5dbcc25b68ab67f66b249d6afa0a58fa5b9a1ffa19bc3717cd3d1a19c413925c9531e888da4907975ead1e5b7eb23b717c842cad41d07ee92bd62ba2d77cbc6abffc2a23e4eb6b477ecfcd640a48db16715ceccf59fd0282f3af7b83d9af738ef89051a6d93bf11cd1cc8119226bf059ae8c4ef8dc342ab0572a0c1e67fc3cd5ea94fc4486339d314c14f5be4c5189611ea77db7f9ab0022384227cb6876aa26971a476ffc5dc59cffd6953024a7793226e2cffb99b7366a247a../../../../usr/lib64/libcryptsetup.so.12.6.0libcryptsetup.so.12.6.0@��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcryptsetup-2.3.7-7.el8.src.rpm���������������������������������������������������������������������������������������������������������������cryptsetup-libscryptsetup-libs(x86-64)cryptsetup-luks-libslibcryptsetup.so.12()(64bit)libcryptsetup.so.12(�x�������������������X��%�
�\����A��$Q����������������A�B�@��/../../usr/lib64/perl5/auto/POSIX/POSIX.so../../../../usr/lib64/perl5/auto/PerlIO/scalar/scalar.so../../../../usr/lib64/perl5/auto/Encode/Byte/Byte.so../../../../usr/lib64/perl5/auto/IO/IO.so../../../../usr/lib64/perl5/auto/Filter/Util/Call/Call.so../../../../usr/lib64/perl5/auto/List/Util/Util.so../../../../usr/lib64/libperl.so.5.26.3../../../../usr/lib64/perl5/auto/PerlIO/via/via.so../../../../usr/lib64/perl5/auto/arybase/arybase.so../../../../usr/lib64/perl5/auto/PerlIO/encoding/encoding.so�x������������������X��#�
��������������|��$l����������������|�{�}�� (RhBug:1629711)
- Allow enablement on disabled plugin (RhBug:1614539)
- Resolves: rhbz#1622585 - [modularity] dnf should not be proposing distro-sync
- Resolves: rhbz#1614531 - dnf 3.2 does not depsolve correctly
- Bug 1564369 - don't show duplicate errors in dnf output
- Resolves: rhbz#1597257 - dnf should accept localinstall command, at least as an alias
- Resolves: rhbz#1613860 - dnf search behaviour is slightly confusing
- Resolves: rhbz#1625586 - Advise user about alternatives to the non-existing "python" package
- Resolves: rhbz#1614346 - dnf rollback doesn't work after install/downgrade/upgrade
- Resolves: rhbz#1612752 - platform-python should be used in completion_helper
- Resolves: rhbz#1618421 - dnf module install fails to find non-modular dependencies
- Bug 1629655 - not helpful/complete error message when specifying wrong stream or profile
- Bug 1629709 - disabled modules should be identified in the module listing
- Bug 1630761 - [usability] unable to determine if a stream with [d] is enabled or not
- Bug 1625270 - there is ???% [=== when baseurl is wrong
- Resolves: rhbz#1624056 - quoted baseurl is error out- [module] Fixed list and info subcommands (RhBug:1623388) (RhBug:1623535)- New implementation of modularity
- dnf makecache should not fail in red color if no enabled repos (RhBug:1622090)
- [modularity] dnf module profile command doesn't work (RhBug:1622580)
- [modularity] incorrect output in dnf module list (RhBug:1623398)
- [modularity] dnf could be smarter when installing what's already installed (RhBug:1622599)
- [modularity] dnf module install circular error on missing dependency (RhBug:1620233)
- not descriptive output in dnf verbose (RhBug:1612718)
- RFE: provide way to query all packages from module (RhBug:1569068)- [history] Fix 'attempt to write a readonly database' error in addConsoleOutputLine().
- [spec] Improve YUM v3 compat layer.
- [doc] document missing link from yum-rhn-plugin to dnf-plugin-spacewalk (RhBug:1580356)
- [doc] document difference between yum and dnf when listing packages (RhBug:1615834)
- [doc] document missing download functionality after transaction table is displayed (RhBug:1585140)
- [systemd] dnf-makecache.timer: move the ordering after network to .service
- [translations] Update translations from zanata.
- [cli] Fix 'already installed' message output.
- [module] change 'module_nsvp' to 'module_spec'
- [module] show module profiles without ', ...'
- [module] unify usability of RepoModuleDict.get_info*(); fix traceback
- [security] fix update count (RhBug:1585138)
- [cli] enable reposync to use --destdir (RhBug:1582152)
- [repo] Replace dnf.repo.Repo with libdnf implementation.
- [dnf] Limit DeprecationWarning to dnf.* modules only.- [misc] Fallback to os.getuid() if /proc/self/loginuid can't be read (RhBug:1597005)
- [translations] Update translations from zanata.
- [doc] Update module documentation.
- [module] Fix `module provides` output.
- [module] Add `module reset` command.
- [module] Fix module disable command
- [repo] Improve error message on broken repo (RhBug:1595796)
- [doc] Enhance a command documentation (RhBug:1361617)
- [module] Automatically save module persistor in do_transaction().
- [drpm] Fixed setting deltarpm_percentage=0 to switch drpm off
- [repo] Split base.download_packages into two functions
- [output] Use libdnf wrapper for smartcols
- [conf] Do not traceback on empty option (RhBug:1613577)- [sack] Use module_platform_id option.
- [module] Switch module persistor to libdnf implementation.
- [module] Auto-enable module streams based on installed RPMs.
- [transaction] Fix: show packages from the current transaction.
- [conf] Convert any VectorString type to list.
- [module] Replace 'enabled' config option with 'state'.
- [install_specs] Do not exclude groups' packages
- [module] Use module sack filtering from libdnf
- [module] Many UX fixes.- [module] Move 'hotfixes' conf option to libdnf and rename it to 'module_hotfixes'.
- [goal] Exclude @System repo packages from distro_sync.
- [conf] Setup configuration v�x�������������������X�%�
����������������d�$U�����������������d�d�d�g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��f6ba27e87d97ea578f01540a8f84b7eab05d42c178badce712d0cc668d8a9981851313b1176baa3d6896aaeeebef56216ebdd38dcdabb39b3eca36b6645352bcdb4883ed3aa74e07338001b31ec7e3e68546521c54bbdfe68c473b33f8511ca6b89b16216ddd35f028f5bfd3fe0db4f2ead6c9415e7749b7115b0393b427ef2f2702f569302248b8228e493177cf0a469f127f1ce5c76bc684bc90fbdfc45743ef96c716cac393f2cd6da304af029155ecd9f021869cd5a4c341ebdf249036bccacc9ca951aa523d3ed6b9df2366022633925a6729d30cd134a05d2ffe5fb15678b055555957eec2bfb4ce5f91b27bdcfdf73128026be9ce85fcca0126fdcd3dad29fe4ef37fd7c4b256b690caf9371a74e29981f6561b94436dac54a61bf74b813b2c7cff888b5b709b90d4da584afef59b5ce1ea888617d682f1af48578faf8f79b29c5ad479186acaae962a598d9868dc434fd5fa49a008eecfaff1b998caad96bbaa693127b56066ee89a6393a6e7f42fb0fb2b98a2bbdd38a150f0cef67a4fa292b903cb8c2ce1761ba4980cf5bdfb66dcadcbb5c8aecc45b012bc64c23722f6ea87711b7c0cb6ee29c15762c2839e5ad17b9ef579b6e81b6121f035c30561bdb2e985458e809e656c60e4bc83e1d6707746dd8b5badbc10b64198d4770a14c51a129b3ae5795dafd98065be0bb0cbf00b4d4528e85adbf629966f42f5375bf95d1da118ff1e2f143ccb7a564d949de440097b97a49725c03976e167b5207e4b0a779c957ef9026d69c0cb5a621ddc2060af967e0dd5e91ac861fdfbdb2086aa0b661ba9de9618afc948a4d1a82df970a406f6c5bb6fa60572a720a62f098a877c62723e6042e4e4740cd1a6e7799df752d9234386d73a28a098e6eb31cf64be205d08af2557187ec19c03678aa9e29f66e428de29cebdd62cd7c3b5515e54341e30523dadc09d821366f5afb13c9286d540b34c1945406918ed588fa21175f86b69b58b0cd1da6c9b27d87ab4e4ed52f37dc76b7895c210c43469504ebabfe26485cd43a80e0c476e628979612ad28a635577baf68eee476850425a498a1296c2f27189183a001af9e3a5d3c833069a6564971f5966c9ed67c5c79970be752d7d3da32a6c009cf264450726367fd69e7c2a4c185d580ce650021d68e7ab27aaf0d39609500b4fce3b3b65f6752116acb30420de1d53943074a481043f0ab6e70b52e341247c4b217883980ff1e98e4453d1020b0b038cdbf096c4ab8a53cb68fbb498e34e19e46f9d41561596ab69ccf78b1d8bdf2f312e892c060015fae961b44fa1ac954450d3a4a3be0114b8b2a3c98787862f5c1caa8311112f7c0fce12f0acd608c1d340bff43e91a30a19c3e2bb4f64f43db6a0e10124c3b1878390d012756c0a7b90a02d28fdeb7d580fa58fd79cdd4eacd9f2fd512558c6ed659d76b58a5aaf2b790392db9d9ae1b5b535a71c11004e67971e12ff33cf11c6e7304f17cc9998bd7c16539ae9a5ea545f2e0c64086d5e688caba104b6a7ffeccdc3a29489d60a0980961c2032c74eb26ed4eb38878e2658d31c5680df956a00c2289f14f11e75ac739d1123651d16e841f3c74e36daa483c1fed9f8c5c1447202a2d02e5c3b982ab2bd0d4e0a1c56e3daa3470c165aae427211a529b7dad8b0695fb89add3bd32b6d43dcf1a51d1839b915e774d7138afaf618e690efbf414bb95fb89add3bd32b6d43dcf1a51d1839b915e774d7138afaf618e690efbf414bbaa47575ad9a0b1625da2b71261a78e67e11ca65da0bda3a8515a0a216d85dab60db45763a43c17d78a4a0b3fda207ac0be4781ebdde45f04fd4b07a5ced460866f3d1e91ba1b7971929530cb8ac3ef934c0b82a8cd459caf224e241a3e5ad6e91447263f0a840e8135c586e16c3d858cee939deddf4fd905e391869809b4daa20d1e295f6795c28e2c9f59a9a4ea4326ef3de390086aecc41abc015844ecf713ecf05b3d9e4b83344428de2ef342e429804be437d31a96f7784622f933675e3736f4c928003e58c35decac7ac6be32ff2deb8df1b91393dfd7b22a7cc4c195e9828556d03c150bdda090415f29698b602371b9ec80c4ce25ba8b61e5f067f38776386c2273f105f54c5749f2fc854573c371ab185f9248ce295a748e126caae8bab682c5cc06027c82d126ed8e65d7dd9dcc75fa464ccbc95d7f168bd69c732dab3708d2f056b641cf316aaacfb876d4f5e47645198933bfd1a03021e2419fb5e6a3d96fd52c1930259ea503d4f617daceab4af0f59b82c7a0d9ac6227155bde1036e20aba00e0585b96b91a00ae7792dc12501160e117d1f824833de7fe37529e28f0a8d5e2297649af298f5e3209d32fe9486edb1793cc698a757c9127066203d3fc9dceec6c168d219eb9f404ca08b478d5521622834bc24b7d45945702e4a0612a8f7e69e3bc166fc186ca44be1e5b1d020b5da8b5be021f73d48c270b82f13b01�x�������������������X��$�
�y������@����X�$H����������������XWY�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootutil-linux-2.32.1-46.el8.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������p�����X�!%�
ص���������d�$%�����������������d�d�d�ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit.3ssl.gzEVP_OpenInit.3ssl.gzEVP_OpenInit.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_set_tls1_prf_md.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_new.3ssl.gzEVP_PKEY_CTX_new.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_new.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_set_tls1_prf_md.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_md.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_md.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_size.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_cmp.3ssl.gzEVP_PKEY_cmp.3ssl.gzEVP_PKEY_decrypt.3ssl.gzEVP_PKEY_derive.3ssl.gzEVP_PKEY_derive.3ssl.gzEVP_PKEY_encrypt.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_�x������������������X��%�
������@��$P����������������@�A�?��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������`�����X��%�
p��������1��$S��������������������6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.1.1-15Remi Collet <remi@fedoraproject.org> - 0.18.1.1-14Jens Petersen <petersen@redhat.com> - 0.18.1.1-13Harald Hoyer <harald@redhat.com> 0.18.1.1-12Harald Hoyer <harald@redhat.com> 0.18.1.1-11Nils Philippsen <nils@redhat.com> - 0.18.1.1-10Jens Petersen <petersen@redhat.com> - 0.18.1.1-9Jens Petersen <petersen@redhat.com> - 0.18.1.1-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.1.1-7Jens Petersen <petersen@redhat.com> - 0.18.1.1-6Jens Petersen <petersen@redhat.com> - 0.18.1.1-5Jens Petersen <petersen@redhat.com> - 0.18.1.1-4Jens Petersen <petersen@redhat.com> - 0.18.1.1-3Jens Petersen <petersen@redhat.com> - 0.18.1.1-2Jens Petersen <petersen@redhat.com> - 0.18.1.1-1Jens Petersen <petersen@redhat.com> - 0.17-17Jens Petersen <petersen@redhat.com> - 0.17-16Jens Petersen <petersen@redhat.com> - 0.17-15Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.17-14Jens Petersen <petersen@redhat.com> - 0.17-13Jens Petersen <petersen@redhat.com> - 0.17-12Jens Petersen <petersen@redhat.com> - 0.17-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.17-10Jens Petersen <petersen@redhat.com> - 0.17-9Ding-Yi Chen <dchen at redhat dot com> - 0.17-8Ding-Yi Chen <dchen at redhat dot com> - 0.17-7Ding-Yi Chen <dchen at redhat dot com> - 0.17-6Jens Petersen <petersen@redhat.com> - 0.17-5Jens Petersen <petersen@redhat.com> - 0.17-4Jens Petersen <petersen@redhat.com> - 0.17-3Jens Petersen <petersen@redhat.com> - 0.17-2Jens Petersen <petersen@redhat.com> - 0.17-1Jens Petersen <petersen@redhat.com> - 0.16.1-12Nils Philippsen <nphilipp@redhat.com> - 0.16.1-11Jens Petersen <petersen@redhat.com> - 0.16.1-10Jens Petersen <petersen@redhat.com>Jens Petersen <petersen@redhat.com> - 0.16.1-9Jens Petersen <petersen@redhat.com> - 0.16.1-8Jens Petersen <petersen@redhat.com> - 0.16.1-7Jens Petersen <petersen@redhat.com> - 0.16.1-6Karsten Hopp <karsten@redhat.com> 0.16.1-5Jens Petersen <petersen@redhat.com> - 0.16.1-4Jens Petersen <petersen@redhat.com> - 0.16.1-3Jens Petersen <petersen@redhat.com> - 0.16.1-1Jens Petersen <petersen@redhat.com> - 0.16-2Jens Petersen <petersen@redhat.com> - 0.16-1Jens Petersen <petersen@redhat.com> - 0.15-1Jens Petersen <petersen@redhat.com> - 0.14.6-3Jens Petersen <petersen@redhat.com> - 0.14.6-2Jens Petersen <petersen@redhat.com> - 0.14.6-1Thomas Fitzsimmons <fitzsim@redhat.com> - 0.14.5-4Jesse Keating <jkeating@redhat.com> - 0.14.5-3.1Karsten Hopp <karsten@redhat.de> 0.14.5-3Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.2Jesse Keating <jkeating@redhat.com> - 0.14.5-2.2.1Jesse Keating <jkeating@redhat.com> 0.14.5-2.2Jesse Keating <jkeating@redhat.com>Jindrich Novy <jnovy@redhat.com> 0.14.5-2Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Jakub Jelinek <jakub@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Leon Ho <llch@redhat.com>Elliot Lee <sopwith@redhat.com>Leon Ho <llch@redhat.com>Tim Powers <timp@redhat.com>Leon Ho <llch@redhat.com> 0.11.4-6Leon Ho <llch@redhat.com> 0.11.4-5Tim Powers <timp@redhat.com> 0.11.4-4Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-3Nalin Dahyabhai <nalin@redhat.com> 0.11.4-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.4-1Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.11.2-1Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-2Trond Eivind Glomsrød <teg@redhat.com> 0.11.1-1Florian La Roche <Florian.LaRoche@redhat.de>Tim Powers <timp@redhat.com>Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-3Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-2Trond Eivind Glomsrød <teg@redhat.com> 0.10.40-1Trond Eivind Glomsrød <�x��������������o����X�u%�
�����4Y�$$����������������4Y5Y3Y�POINT.3ssl.gzd2i_NAMING_AUTHORITY.3ssl.gzd2i_NETSCAPE_CERT_SEQUENCE.3ssl.gzd2i_NETSCAPE_SPKAC.3ssl.gzd2i_NETSCAPE_SPKI.3ssl.gzd2i_NOTICEREF.3ssl.gzd2i_OCSP_BASICRESP.3ssl.gzd2i_OCSP_CERTID.3ssl.gzd2i_OCSP_CERTSTATUS.3ssl.gzd2i_OCSP_CRLID.3ssl.gzd2i_OCSP_ONEREQ.3ssl.gzd2i_OCSP_REQINFO.3ssl.gzd2i_OCSP_REQUEST.3ssl.gzd2i_OCSP_RESPBYTES.3ssl.gzd2i_OCSP_RESPDATA.3ssl.gzd2i_OCSP_RESPID.3ssl.gzd2i_OCSP_RESPONSE.3ssl.gzd2i_OCSP_REVOKEDINFO.3ssl.gzd2i_OCSP_SERVICELOC.3ssl.gzd2i_OCSP_SIGNATURE.3ssl.gzd2i_OCSP_SINGLERESP.3ssl.gzd2i_OTHERNAME.3ssl.gzd2i_PBE2PARAM.3ssl.gzd2i_PBEPARAM.3ssl.gzd2i_PBKDF2PARAM.3ssl.gzd2i_PKCS12.3ssl.gzd2i_PKCS12_BAGS.3ssl.gzd2i_PKCS12_MAC_DATA.3ssl.gzd2i_PKCS12_SAFEBAG.3ssl.gzd2i_PKCS12_bio.3ssl.gzd2i_PKCS12_fp.3ssl.gzd2i_PKCS7.3ssl.gzd2i_PKCS7_DIGEST.3ssl.gzd2i_PKCS7_ENCRYPT.3ssl.gzd2i_PKCS7_ENC_CONTENT.3ssl.gzd2i_PKCS7_ENVELOPE.3ssl.gzd2i_PKCS7_ISSUER_AND_SERIAL.3ssl.gzd2i_PKCS7_RECIP_INFO.3ssl.gzd2i_PKCS7_SIGNED.3ssl.gzd2i_PKCS7_SIGNER_INFO.3ssl.gzd2i_PKCS7_SIGN_ENVELOPE.3ssl.gzd2i_PKCS7_bio.3ssl.gzd2i_PKCS7_fp.3ssl.gzd2i_PKCS8PrivateKey_bio.3ssl.gzd2i_PKCS8PrivateKey_fp.3ssl.gzd2i_PKCS8_PRIV_KEY_INFO.3ssl.gzd2i_PKCS8_PRIV_KEY_INFO_bio.3ssl.gzd2i_PKCS8_PRIV_KEY_INFO_fp.3ssl.gzd2i_PKCS8_bio.3ssl.gzd2i_PKCS8_fp.3ssl.gzd2i_PKEY_USAGE_PERIOD.3ssl.gzd2i_POLICYINFO.3ssl.gzd2i_POLICYQUALINFO.3ssl.gzd2i_PROFESSION_INFO.3ssl.gzd2i_PROXY_CERT_INFO_EXTENSION.3ssl.gzd2i_PROXY_POLICY.3ssl.gzd2i_PUBKEY.3ssl.gzd2i_PUBKEY_bio.3ssl.gzd2i_PUBKEY_fp.3ssl.gzd2i_PrivateKey.3ssl.gzd2i_PrivateKey_bio.3ssl.gzd2i_PrivateKey_fp.3ssl.gzd2i_PublicKey.3ssl.gzd2i_RSAPrivateKey.3ssl.gzd2i_RSAPrivateKey_bio.3ssl.gzd2i_RSAPrivateKey_fp.3ssl.gzd2i_RSAPublicKey.3ssl.gzd2i_RSAPublicKey_bio.3ssl.gzd2i_RSAPublicKey_fp.3ssl.gzd2i_RSA_OAEP_PARAMS.3ssl.gzd2i_RSA_PSS_PARAMS.3ssl.gzd2i_RSA_PUBKEY.3ssl.gzd2i_RSA_PUBKEY_bio.3ssl.gzd2i_RSA_PUBKEY_fp.3ssl.gzd2i_SCRYPT_PARAMS.3ssl.gzd2i_SCT_LIST.3ssl.gzd2i_SSL_SESSION.3ssl.gzd2i_SXNET.3ssl.gzd2i_SXNETID.3ssl.gzd2i_TS_ACCURACY.3ssl.gzd2i_TS_MSG_IMPRINT.3ssl.gzd2i_TS_MSG_IMPRINT_bio.3ssl.gzd2i_TS_MSG_IMPRINT_fp.3ssl.gzd2i_TS_REQ.3ssl.gzd2i_TS_REQ_bio.3ssl.gzd2i_TS_REQ_fp.3ssl.gzd2i_TS_RESP.3ssl.gzd2i_TS_RESP_bio.3ssl.gzd2i_TS_RESP_fp.3ssl.gzd2i_TS_STATUS_INFO.3ssl.gzd2i_TS_TST_INFO.3ssl.gzd2i_TS_TST_INFO_bio.3ssl.gzd2i_TS_TST_INFO_fp.3ssl.gzd2i_USERNOTICE.3ssl.gzd2i_X509.3ssl.gzd2i_X509_ALGOR.3ssl.gzd2i_X509_ALGORS.3ssl.gzd2i_X509_ATTRIBUTE.3ssl.gzd2i_X509_AUX.3ssl.gzd2i_X509_CERT_AUX.3ssl.gzd2i_X509_CINF.3ssl.gzd2i_X509_CRL.3ssl.gzd2i_X509_CRL_INFO.3ssl.gzd2i_X509_CRL_bio.3ssl.gzd2i_X509_CRL_fp.3ssl.gzd2i_X509_EXTENSION.3ssl.gzd2i_X509_EXTENSIONS.3ssl.gzd2i_X509_NAME.3ssl.gzd2i_X509_NAME_ENTRY.3ssl.gzd2i_X509_PUBKEY.3ssl.gzd2i_X509_REQ.3ssl.gzd2i_X509_REQ_INFO.3ssl.gzd2i_X509_REQ_bio.3ssl.gzd2i_X509_REQ_fp.3ssl.gzd2i_X509_REVOKED.3ssl.gzd2i_X509_SIG.3ssl.gzd2i_X509_VAL.3ssl.gzi2d_ACCESS_DESCRIPTION.3ssl.gzi2d_ADMISSIONS.3ssl.gzi2d_ADMISSION_SYNTAX.3ssl.gzi2d_ASIdOrRange.3ssl.gzi2d_ASIdentifierChoice.3ssl.gzi2d_ASIdentifiers.3ssl.gzi2d_ASN1_BIT_STRING.3ssl.gzi2d_ASN1_BMPSTRING.3ssl.gzi2d_ASN1_ENUMERATED.3ssl.gzi2d_ASN1_GENERALIZEDTIME.3ssl.gzi2d_ASN1_GENERALSTRING.3ssl.gzi2d_ASN1_IA5STRING.3ssl.gzi2d_ASN1_INTEGER.3ssl.gzi2d_ASN1_NULL.3ssl.gzi2d_ASN1_OBJECT.3ssl.gzi2d_ASN1_OCTET_STRING.3ssl.gzi2d_ASN1_PRINTABLE.3ssl.gzi2d_ASN1_PRINTABLESTRING.3ssl.gzi2d_ASN1_SEQUENCE_ANY.3ssl.gzi2d_ASN1_SET_ANY.3ssl.gzi2d_ASN1_T61STRING.3ssl.gzi2d_ASN1_TIME.3ssl.gzi2d_ASN1_TYPE.3ssl.gzi2d_ASN1_UNIVERSALSTRING.3ssl.gzi2d_ASN1_UTCTIME.3ssl.gzi2d_ASN1_UTF8STRING.3ssl.gzi2d_ASN1_VISIBLESTRING.3ssl.gzi2d_ASN1_bio_stream.3ssl.gzi2d_ASRange.3ssl.gzi2d_AUTHORITY_INFO_ACCESS.3ssl.gzi2d_AUTHORITY_KEYID.3ssl.gzi2d_BASIC_CONSTRAINTS.3ssl.gzi2d_CERTIFICATEPOLICIES.3ssl.gzi2d_CMS_ContentInfo.3ssl.gzi2d_CMS_ReceiptRequest.3ssl.gzi2d_CMS_bio.3ssl.gzi2d_CMS_bio_stream.3ssl.gzi2d_CRL_DIST_POINTS.3ssl.gzi2d_DHparams.3ssl.gzi2d_DHxparams.3ssl.gzi2d_DIRECTORY�x�������������P_����X��$�
������v���]�$M����������������]\^�1-0.1Karel Zak <kzak@redhat.com> 2.13-4Karel Zak <kzak@redhat.com> 2.13-3Karel Zak <kzak@redhat.com> 2.13-2Karel Zak <kzak@redhat.com> 2.13-1Karel Zak <kzak@redhat.com> 2.13-0.59Jesse Keating <jkeating@redhat.com>  2.13-0.58Karel Zak <kzak@redhat.com>  2.13-0.57Karel Zak <kzak@redhat.com> 2.13-0.56Karel Zak <kzak@redhat.com> 2.13-0.55Karel Zak <kzak@redhat.com> 2.13-0.54Karel Zak <kzak@redhat.com> 2.13-0.53Karel Zak <kzak@redhat.com> 2.13-0.52Karel Zak <kzak@redhat.com> 2.13-0.51David Zeuthen <davidz@redhat.com> 2.13-0.50Karel Zak <kzak@redhat.com> 2.13-0.49Karel Zak <kzak@redhat.com> 2.13-0.48Karel Zak <kzak@redhat.com> 2.13-0.47Karel Zak <kzak@redhat.com> 2.13-0.46Karel Zak <kzak@redhat.com> 2.13-0.45Karel Zak <kzak@redhat.com> 2.13-0.44Jesse Keating <jkeating@redhat.com> - 2.13-0.43Karel Zak <kzak@redhat.com> 2.13-0.42Karel Zak <kzak@redhat.com> 2.13-0.41Karel Zak <kzak@redhat.com> 2.13-0.40Karel Zak <kzak@redhat.com> 2.13-0.39Dan Walsh <dwalsh@redhat.com> 2.13-0.38Karel Zak <kzak@redhat.com> 2.13-0.37Karel Zak <kzak@redhat.com> 2.13-0.36Steve Dickson <steved@redhat.com> 2.13-0.35Karel Zak <kzak@redhat.com> 2.13-0.34Karel Zak <kzak@redhat.com> 2.13-0.33Karel Zak <kzak@redhat.com> 2.13-0.32Jesse Keating <jkeating@redhat.com> - 2.13-0.31.1Karel Zak <kzak@redhat.com> 2.13-0.31Karsten Hopp <karsten@redhat.de> 2.13-0.30Karel Zak <kzak@redhat.com> 2.13-0.29 Florian La Roche <laroche@redhat.com> 2.13-0.28Dan Walsh <dwalsh@RedHat.com> 2.13-0.27Steve Dickson <steved@redhat.com> 2.13-0.26Karel Zak <kzak@redhat.com> 2.13-0.25Dan Walsh <dwalsh@RedHat.com> 2.13-0.24Steve Dickson <steved@redhat.com> 2.13-0.23Steve Dickson <steved@redhat.com> 2.13-0.22Steve Dickson <steved@redhat.com> 2.13-0.21Jesse Keating <jkeating@redhat.com> 2.13-0.20Jesse Keating <jkeating@redhat.com> 2.13-0.19Karel Zak <kzak@redhat.com> 2.13-0.17Karel Zak <kzak@redhat.com> 2.13-0.16Jesse Keating <jkeating@redhat.com> - 2.13-0.15.1Peter Jones <pjones@redhat.com> 2.13-0.15Jesse Keating <jkeating@redhat.com> - 2.13-0.14.1Steve Dickson <steved@redhat.com> 2.13-0.14Karel Zak <kzak@redhat.com> 2.13-0.13Karel Zak <kzak@redhat.com> 2.13-0.12Jesse Keating <jkeating@redhat.com>Karel Zak <kzak@redhat.com> 2.13-0.11.pre6Karel Zak <kzak@redhat.com> 2.13-0.10.pre5Karel Zak <kzak@redhat.com> 2.13-0.9.pre5Karel Zak <kzak@redhat.com> 2.13-0.8.pre5Karel Zak <kzak@redhat.com> 2.13-0.7.pre5Karel Zak <kzak@redhat.com> 2.13-0.6.pre5Karel Zak <kzak@redhat.com> 2.13-0.5.pre4Karel Zak <kzak@redhat.com> 2.13-0.4.pre4Steve Dickson <steved@redhat.com> 2.13-0.3.pre3Karel Zak <kzak@redhat.com> 2.13-0.3.pre2Karel Zak <kzak@redhat.com> 2.13-0.2.pre2Karel Zak <kzak@redhat.com> 2.12p-9.7Karel Zak <kzak@redhat.com> 2.12p-9.5Jeremy Katz <katzj@redhat.com> - 2.12p-9.3Karel Zak <kzak@redhat.com> 2.12p-9.2Karel Zak <kzak@redhat.com> 2.12p-9Karel Zak <kzak@redhat.com> 2.12p-8Karel Zak <kzak@redhat.com> 2.12p-7Steve Dickson <SteveD@RedHat.com> 2.12p-5Karel Zak <kzak@redhat.com> 2.12p-4Elliot Lee <sopwith@redhat.com> 2.12p-3Steve Dickson <SteveD@RedHat.com> 2.12p-2Elliot Lee <sopwith@redhat.com> 2.12p-1Elliot Lee <sopwith@redhat.com> 2.12j-1Steve Dickson <SteveD@RedHat.com> 2.12a-20Elliot Lee <sopwith@redhat.com> 2.12a-19Steve Dickson <SteveD@RedHat.com> 2.12a-18Elliot Lee <sopwith@redhat.com> 2.12a-16Stephen C. Tweedie <sct@redhat.com> - 2.12a-15John (J5) Palmieri <johnp@redhat.com> 2.12a-14Stephen C. Tweedie <sct@redhat.com> 2.12a-13Phil Knirsch <pknirsch@redhat.com> 2.12a-12Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com> 2.12a-10Steve Dickson <SteveD@RedHat.com>Nalin Dahybhai <nalin@redhat.com> 2.12a-8Phil Knirsch <pknirsch@redhat.com> 2.12a-7Elliot Lee <sopwith@redhat.com> 2.12a-6Steve Dickson <SteveD@RedHat.com>Alasdair Kergon <agk@redhat.com>Alasdair Kergon <agk@redhat.com>Steve Dickson <SteveD@RedHat.com>Jindrich Novy <jnovy@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-1Dan Walsh�x��������������N����X��%�
h������xg���C��$S����������������C�D�B��d59e174fdac2269d55740093bc91a3af2828211b357ee866b91d1d79077e3da1e6af5e9670341ed853aeb2c2a77041a6ef907cf26cc3f23bbb93e4c24e097c09ede74221bc1b8bf95cdf0f6109573b337fba766b3cd361027eb48804560bab0e0972384b78c556f57d5817d51350e92c6ac19ad49d8f848ea8f581d0ce625b39539f9f0f0093f14bc14129564e9132a5b03889a027ab1561f862d36e072d028275e8c876744209b575e2546f07c05621682df82159ec789e1e348fcb8bc748cde66aa0bad58600070adccde5f1f5e4aca122bc6a26aa06b723ff560f1da7edab03f1707b1b430bae1dc26beaf883eea1bf52fdc7fe08e55ab4449452039629ee60a27f18a097a77cfbc764d6eb65b9de8495522cac38694982641d57081c16de66cda43ef7c53c370b2738746fadb96e3848833a4ea4352e3c9fcf2b8c11fd615485c763f34eb46936ce88668fde7642c947c6edb927e733bc31faeed409868ef6195b4b4dd4700735cad0b41ee0065c9786f55653b19e3178228b7f682f2a83b54f6f74c5284e3823fa3df10480afe0b4346dc53e30b547b03b862601c6fdabbf9cec89d2ef3ab03c715059e2123785c70d7a2bb872034d755507a9f8784abb4c0d282655054c1738d52ece37054b26017cb0f96a6e965707ed694238cfadb49a3a817166fa6271d516718dd268d13396f598b2c1a618940d505790e27fb759bac9e1a0bf29fd686ac463cbf9fb82496d12057601577aaa64c19813921a25e8d13f9a08974fd8d05bc04f52d239a3391ca99230af5e48114ce5279a15fb80c92543e5ed80f4fc8153f1e8a33c981024a71c84d83e36ab734028b57d5e18e2745ef135863a9abec5f666b69c8a7a54444ed5e4615f84d93bc69f6efac90c533e865498ce3e7094f1f702153a023709f68e9d9d1d4f1143329015282ffe5dc361a229d25471475f6bcc0058d2c5ff2a36e64f8d8c22bc4439236f244c724c4862eef5d57717f2ed8764d4e9f70d5d7e1ff2fdfd9041c884462b23204f2182d9c0713cca99f022d44f938cf80fb62270830471e15248e579ce03836b14ae51a101d6567c7cb8c422574cddad3c5c7fcb58aaafd1e6c8266387391679e3f18be30c22851db200a8451819b8a3549d8d6c67250017b56e1d0d524fd66fdf5e61fc81c560dad4177ca019e04f239ee2f4e17b4c1f0ac2c57758e4b63cb2d3654afe046a423b400b7809e6a8448b43c07af9bccf87f37fc9555aa6eb521cd707f09e74c3e0ee3b167d4d85eab7ec518aa6baf47ba86a05884c26b3458fd795bdb019060c93bfbadbb799d92afc052e2ed22f375d261fa5e51a21000daaa8bf55b4ba80bbe9bcb437129c33cb38f84cceb21e2948f98083f0d443057a4cb2a5452bf2bdc7e8c5ef211049360e1d26a231076bbed818db6b2db6e0ff43f079e9428b5ab7cc510f6994717fada671c6dd6d518c60cbb320a7ae386e1ad495afd213e9d075725982d751c2fc28291f659fa55d205b9e16e442782f3a987150880d5d5170fe76ba4991ec33a12593c6dfa48d27332c415f71343ee49748c385a8fb84e17696d27e201f26608f34d80a01bdbe970180e732dd248284294a9e08307083b63901e153b59a475603e0bee03762c68ebc293a38fc835344e1499aefb13071652a1750d52668ce71ffb106d704ed38f7783f7621ab73b2654f3298e9d739930a05a7d3572bc6fe448e7c19d2fa3b99a6ec9366151bfa657924162b6de1011bd4bfc288e41cc2d845e911a65bcc57095a43b2dd24bb64880f97f95240db0bb3a3c7a6dd5031ca66bcdcd7bbefdb6773fc8e559bdc7d70e13df5535ec6c83b18808e6ed0af94048303a673505ba3dc64c8f85ce164567d994e3611850da33191e102daa90d42d7ec8f3120fce9e257ec950dde7b6a038bce3e8f9aebc50eb202f67a109eeb791ad97c51ffcf2882c887d738cd52397ffd0559d8d847e8a6993b26ff24de0e606e7137056f4893d303a3afc058b142e14620144ce822bf5d7780fdf2ca5382076ffcd2ea07d26be85f6c72a30bac9ebd39320872720d8c7e4e79bfde06874d05e4d52312528ab1e6cc317e75e418388d77217b80e1cedd209989aae700937bac1d3531e1009f730411a8f40ff9f1eeb0528261bfbf1e15a1b87e9fc5ec323e26a481489e747c84a97ddf073b8819bf79d35b34b0f619af64a48d71740ac0da283f8bb7b386a7466b7673ff29eecfc8c760b4fc8cf8a5fb7ecf8c7001fa93e9ede7f05b4a0d5192016b64b38d525149ea437073341d9c60dd4810b2c7df4854f701442598fcf49bdb35a01f5371d9ba33e212e2b2cb2630f85b58d8c7a5b32bb0be35bf21514b58d7cb85a88959784b8e9df16da06b2bbbd1d1f5185e04c43e39974278a3992501bb70ea54f6eaa3be51436b36a8de472f823cddcbfcbf97f9ca4f85634b3f9abd66d692e12568cf7e42e8e3d668b91620b615e9bc49cec472a195ebf4be8be8061015302027567274ebcd8607943b110b957c493ad7383c33782f7baefa75fe3eb73dede515c8f2c59ecca6891c57e367d4b56ee81518748d86537ac50893d4e36321446bd0e0137a19b83ae592ec27b5648ce416ba0ee47efabbdac7ac1001e21e6db499a1d14bd120f40e791761144c9d080cd0b0142fcf5ef029131135938b9ab728d1b2988be1e63a6d82ad895d3ea87f85b5364e39abca43225ec25abcd34ff5ab356ca47715ad3dbaded71cd0f0b483c234c265081e2f882e2a0699117c1bfafbae4b02a81955695175061469e19ea564a8a9000ae8920bdcd194eb5545f119deb5a7c4be81921�x�������������@>����X��%�
�(������_���h!�$x����������������h!i!�H,�?%�d���� �	$�	H��������������	2�>�S�Y`?
\?	�?
X?T?�?
��?��?�?�>�`?�\���h�8(�o8�x�9И�:O�G�?H�?I�?X�DY٘\��?]��?^�>Rb�bd��e��f��l��t��?u�?v�
w�?x�?y$�'�%\�%`�%f�%�%�%�6'�(6
*<*e�*�*�?,�g,�h,�Cperl-libs5.26.3423.el8_10The libraries for the perl run-timeThe is a perl run-time (interpreter as a shared library and include
directories).h�02x64-builder03.almalinux.org](vAlmaLinuxAlmaLinux(GPL+ or Artistic) and HSRL and MIT and UCDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.perl.org/linuxx86_64)'!H�pX���`-�1X��8
2P#U,��$;��>��$3HA�H� V�M�<�7\�H�P'�6�z�v� )@=�h��o�K46�S|!=+G}-�M�;�Z�?�v3@��18
wI��[-�f�Y��t!�(rjfD�/
�	�T*�� �N~a#F���w
���b����<M�J7co�s2
a^�&�<
)�"�f���4�R���i4O����+�9t�	(�)Xb�I���	�6,$Z!&R�������<2�rruggg[�:�t	Y�(*H6��L`Jb>6���~��4$��&0&:�D00:9�o- ����t�R	tD����l��n-~iEG�k���
u{-3H�R&&p0d*/V<�&4���^0$[n9nb-b&���1��CF��� K�k�ZRpn���~f7��7H"�J��(v2@0F@H�Hv���P&LJv�!>D2&vn�l0	���(�vVB*0@tX��l����]&bb0�4xD��4>����*2��^X�(@x7!��[#�{��A�������A�A�A�A�큤A�A�A큤����A큤��������������A큤����A큤��������������A큤��������������������������������������������������������������������������������A�A큤������������������������������A큤A큤������������������������A큤A큤A큤A큤����A큤A�x��������������-����X��%�
�!�G���I��$Y����������������I�J�H��61c5853c4580f762a6b01fee8c0efcd9c4bc3e734014afd7dc023de17ed82f7a85bfb5a794bb54a2f9e4494240e5fe847ea8d1a8278eba2dd650f3bcbaa7c124154e811d80263afd7d01dde01b821eb122f6f743f327229eba9e3b637f8761291ff45fec4aff95cd84b730159b523ad8cf5629f8dd35c11fe2213eeec21179fb395f4d9ad448872e6e465ade90b19e825037770dc12d27cd43e897480e362dd09305addea68a5c7cb5f0752aa16f07ea34a68f08d570ac73fd51bfc57db169be5877f93a31851c3b488673dfbfa9493c26e105f6d26e9f2e2a0fce0e306791c87dc540b80c1f7489ebd2225d6d922e14575a650330cb02f7424ba7c57f8788937cd6e52d404abc729ab75aa9d45022c0daef213c02c448f09f7c523a4736db4bdc1fb9e420f7ea03ceb09518850d5d37918deb4f6ed64ff72fe20fee99bbdb22d7529bb47749fa0a722fd25c9c480ddebdd1a9a658e4d6ec9d5380f7322ecea5461d046f44289a916c05c36c1e3ed6f6309755b274199ae6ff563296b21fdb46917a8df775c9ee225cff73c264be1076f943012a653b0bc893d8b813db38a75e873a2eace7352613b0feccea7d3bd705e983202479d40e816e9b41d3a1ed909cb5b0218582709b5fc04a27b4075d2a107df75f5ccdad3654dae5b796ad03f5654127a20b48f69da06c0f3effd1c7fc3e6b787c79a0f4e846d02f8b6c71393ead1f147cec270e3dab540527e5f2b45ecf6ceae38f02231dca6c8ec359bb007b13ba9206080bf7143f3e8c15a448d4c9b26dfdf4245ba603eb4ce9182e03b9bbeca0aba7d9b56989af5787bbe7434a9769d4efaf156b5278923ef97e7f0868e19dabe20b50493f55a5635f3170ac83d0a3ba4714a1291af1111b443aae61b6d99a477e6948c5f4de8be785aea40b32585b5dddeee9b77544932c95da8da9b2a37ecbc75e1742cf2cc01ceab118c7e3d3e13ccebcb4ae8f5879bec95e64b78981364a3b13c378f9da526e23452ab31ea5a9a2237347e88007f0535c481cb1d6951fc0629dfd550618e6459b34629b31b09fe96531c544cdd00783bcb9f3d22b02293825abd7dd02f57f601aa5c4e5d61e91d74b64f13d94fd2081571687c405e688eef7cdc2c62ffb5943d835c250c1546e95e8cf244430abbbe338a3f5223a9a3d7c1318c135809c5adb0ed4dd7ac6699d3a94d8f3fc4ee121949863f3767c2cd24599339c7b39b2ce777b9533a9f1c2d5b20b091967576239a18095f0ba8d9f02e8fe6095c41cbae556aa441c6d6e8fd50590fdc6c99b11ca5a7046adbfc5188789994f1f75e5799d97605ec0c23cd65ab0c89e2cd85c02eb63ac5ac93bbb07b3749e4420877b25e91e3d0aefc92e997e55e9ae94c83329f43a5153ebf9276e8e13d2e61a653c7587fc829b02487751ae664d0d97bad11d652bdfd7418d6e74c1b1f3563f500d5f21e3127f559068045728be1a117ea9f1247a46701d9ab54fa5fec9255354aadb8d58a3dd294d2f3b4f7977eea8d3671951d2d7ee446d331867b04ed3b98cc1d5c4571ae3bdf862eea2b3cfb01c61292ac72ebb3e10bdb4b5b465dc068803a1cbf6d27b5097668184e62a2e150d5b3b212282e1ad03a24e8a1ef45b3e76fed5b26cd341611fc9e1f3c34d1ae3e1712e156a2ab5d50a622c294c0befacc19c943ddec77c0ebeae1b41e905e0dd156123f274539220e87518206123d823183ae8dcc9ec3418ef1c07647b81d402d7f829cb7ea0f9070adb826789be0f51730cf90eecd3bba8491fc8248c450128872a12c3a31d90125001565e207e683298e27cc5582e44367a1fefae63e17ea061574340d174560a5275f4b3ef7c9cbe101f76b9b7b425e5cab2208d243de95e989cd9db5a474b43fc71bf12542fb95426ff3a8df76ab12fd70de4c2f4d227130817287e7fd6c392d818e560218b60ab756cd30d6572fa12f0e7c413c3d6ef9e13ed0964f3cc418b9305ad90408ef324a09cf9c27ac990bc88d28f859648560e43f7ff9a7e9608634bf593bdeb8abdccdaeb103959c0c4be7f7a8c7f3157aa43a59740dbf7a14bc3bee73940a3a5d4b01b2f814d6b0b554251731addbd7f243946c769505c419f3c43ccf5450e18df28acf3d4470c4c18004fbf4c20268c3bab690ecd2f76cd0f60e5f1a6756382bd37dd62505e9f8609cf739070345bde966da7e4ca3c3fc14ed2452289d1664c59387d60a6ac7857d378ea025514235474649998b2138368cae97a6abe88e835f800e0679f948827ae63af9570bc342b42b097324ce432e9c5ab066d992adb9f52212131818c22c32c935bfd12711e36d373265ad9418f8562eaaa995dbfc144d2b2f0b1be7ef61ad403ac4561d8a023c52df170bf44fa6950a8511556c85235b3e24f6f34455b9df7f04c84309b1b1ec5e5cd47c9ae56fde5e26c1a4f19afa9eab179f334610678ac514f54af924bd99a13b4a4c5a7f34d9721807e05950c679256d86b3a2538cbc143cf5d7698e95f8c47128a19387ad780211a6b4d7f9e94407e8e254572e9e8309997529e5034339a5bf2281a865e9f2c8f7f3e25b3c681f6030734d80a0f823f957823ac5bc7ee0840012438ae68231c872570e948a541513a6daaac43c793187f5aadf9cf9209e478d2df5894574377a484db3308379dfefcd613707ae7991d6ca04124dadf74ba479e02db5e30645881cf0f41584a40d325e6453800ff54f3eb013244ae2bda538e24a02288ce79b3f683721686d7295e6b7036f1aad4e7fd5a740bbf6c44e07139bfb5efd270b213a5dc0f0cc69a1d46621ef9ff19966fd46a8d915a125a30e7dad�x�������������0����X��$�
�������Hc�W�$h�����������������W�W�W�rtld(GNU_HASH)systemdsystemdsystemd3.0.4-14.6.0-14.0-15.2-14.14.3^p��[�t�Z�m�Z}�@Z|;�Zs@Zp^@Z	�Y�@Yx�@X��@X�A�W�%�W֘�V���V�n@V�=@U�@U�K@U�a@U/�@Ts�Tm�T3�T.��S�@S�@S���S��@S���S9X�R�@R��R�1@R��R�R�Rs��RV��RN��R@-@R/	�R' �R' �Q��Q��@Qy�Q�P�[�P���P�*�P���Pmz@Pi��PW�PG>�PG>�P4�P4�P	H@O�@O�@O�i�O�\@O"��O�O
y�O��N�U@N��N���N�
@N�j@N���Nw.�NT�N�@M�A�M��@M�V�M�@M��Mt�MQ0@MK�@M9u@M!�@M	�@M	�@L��LΫ�L�*@L��L��La?@L�K�s�K?5@K/c@K�@J�l�J�J�H@J��Jj�JT�@I�2�H�,�H�}@H|�@HsV�G�9�G­�G��F�v�FiD�FR�@F	@E�5@E݅�Eّ@E�3@E�`@E#�@E �@D�+@D��@D���Dm�@D`�@DWI�D?��D>=@D5�D+�@DS@C���C�@C�@C�C�:@C��@C��@C��C�q�CP�@B�B�<�B�R�B�:�Bn-@BR}�BJ��B8�B$Y@B#�B5�B	�@BX@A�n@A�U@A��@A�T@A��A�v�AZ��A<Q@A8\�A3�A3�A!�@A�A,�@�}@@��@���@�(�@~y@@ia@@`&�@4�@@,�@?I�@?I�@?B@?B@>��>��>��@>��@>�
@>̻�>̻�>�j@>��>x[�>C��>5@>.��=��=�?�=O�@=@<��<��@;f��;��:݁�:�R�:�i�:�@:yO�:I�9�@9l]�9<�8�Y�8��@8�@8�8}�@7� �7��7h�@7bK�7 `�6�%@6��@6�<@6��6vO@6i @6J�5�3@5���5�5I�@4���4���4M�4L�@4
Q@3�@Michal Ruprich <michalruprich@gmail.com> - 2.0-0.52.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.51.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.50.20160912gitIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 2.0-0.49.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.48.20160912gitFlorian Weimer <fweimer@redhat.com> - 2.0-0.47.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.46.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.45.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.44.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.43.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.42.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.41.20160912gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.40.20160912gitmruprich <mruprich@redhat.com> - 2.0-0.39.20160912gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.38.20160329gitZdenek Dohnal <zdohnal@redhat.com> - 2.0-0.37.20160329gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.36.20150915gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.35.20150915gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.34.20150715gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.33.20150416gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.32.20150416gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.31.20141124gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.30.20141007gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.29.20141007gitLubomir Rintel <lkundrak@v3.sk> - 2.0-0.28.20140707gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.27.20140707gitTom Callaway <spot@fedoraproject.org> - 2.0-0.26.20140707gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.25.20140707gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.24.20131119gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.23.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.22.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.21.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.20.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.19.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.18.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.17.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.16.20131004gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.15.20131004gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.14.20131004gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.13.20130910gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.12.20130910gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.11.20130607gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.10.20130607gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.9.20130607gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.8.20130607gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.7.20130425gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.6.20130109gitJiri �x������������������X�%�
���������������+X�$;����������������+X,X*X�directoryC source, ASCII textASCII textpkgconfig fileUTF-8 Unicode texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)C source, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)�x������������� �����X�g%�
��������P8������od�$����������������odpdnd�P_camellia_192_ctr.3ssl.gzEVP_camellia_192_ecb.3ssl.gzEVP_camellia_192_ofb.3ssl.gzEVP_camellia_256_cbc.3ssl.gzEVP_camellia_256_cfb.3ssl.gzEVP_camellia_256_cfb1.3ssl.gzEVP_camellia_256_cfb128.3ssl.gzEVP_camellia_256_cfb8.3ssl.gzEVP_camellia_256_ctr.3ssl.gzEVP_camellia_256_ecb.3ssl.gzEVP_camellia_256_ofb.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_cast5_cfb.3ssl.gzEVP_cast5_cfb64.3ssl.gzEVP_cast5_ecb.3ssl.gzEVP_cast5_ofb.3ssl.gzEVP_chacha20.3ssl.gzEVP_chacha20_poly1305.3ssl.gzEVP_cleanup.3ssl.gzEVP_des.3ssl.gzEVP_des_cbc.3ssl.gzEVP_des_cfb.3ssl.gzEVP_des_cfb1.3ssl.gzEVP_des_cfb64.3ssl.gzEVP_des_cfb8.3ssl.gzEVP_des_ecb.3ssl.gzEVP_des_ede.3ssl.gzEVP_des_ede3.3ssl.gzEVP_des_ede3_cbc.3ssl.gzEVP_des_ede3_cfb.3ssl.gzEVP_des_ede3_cfb1.3ssl.gzEVP_des_ede3_cfb64.3ssl.gzEVP_des_ede3_cfb8.3ssl.gzEVP_des_ede3_ecb.3ssl.gzEVP_des_ede3_ofb.3ssl.gzEVP_des_ede3_wrap.3ssl.gzEVP_des_ede_cbc.3ssl.gzEVP_des_ede_cfb.3ssl.gzEVP_des_ede_cfb64.3ssl.gzEVP_des_ede_ecb.3ssl.gzEVP_des_ede_ofb.3ssl.gzEVP_des_ofb.3ssl.gzEVP_desx_cbc.3ssl.gzEVP_enc_null.3ssl.gzEVP_get_cipherbyname.3ssl.gzEVP_get_cipherbynid.3ssl.gzEVP_get_cipherbyobj.3ssl.gzEVP_get_digestbyname.3ssl.gzEVP_get_digestbynid.3ssl.gzEVP_get_digestbyobj.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_idea_cfb.3ssl.gzEVP_idea_cfb64.3ssl.gzEVP_idea_ecb.3ssl.gzEVP_idea_ofb.3ssl.gzEVP_md2.3ssl.gzEVP_md4.3ssl.gzEVP_md5.3ssl.gzEVP_md5_sha1.3ssl.gzEVP_md_null.3ssl.gzEVP_mdc2.3ssl.gzEVP_rc2_40_cbc.3ssl.gzEVP_rc2_64_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cfb.3ssl.gzEVP_rc2_cfb64.3ssl.gzEVP_rc2_ecb.3ssl.gzEVP_rc2_ofb.3ssl.gzEVP_rc4.3ssl.gzEVP_rc4_40.3ssl.gzEVP_rc4_hmac_md5.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_rc5_32_12_16_cfb.3ssl.gzEVP_rc5_32_12_16_cfb64.3ssl.gzEVP_rc5_32_12_16_ecb.3ssl.gzEVP_rc5_32_12_16_ofb.3ssl.gzEVP_ripemd160.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_seed_cfb.3ssl.gzEVP_seed_cfb128.3ssl.gzEVP_seed_ecb.3ssl.gzEVP_seed_ofb.3ssl.gzEVP_sha1.3ssl.gzEVP_sha224.3ssl.gzEVP_sha256.3ssl.gzEVP_sha384.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha3_256.3ssl.gzEVP_sha3_384.3ssl.gzEVP_sha3_512.3ssl.gzEVP_sha512.3ssl.gzEVP_sha512_224.3ssl.gzEVP_sha512_256.3ssl.gzEVP_shake128.3ssl.gzEVP_shake256.3ssl.gzEVP_sm3.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cfb.3ssl.gzEVP_sm4_cfb128.3ssl.gzEVP_sm4_ctr.3ssl.gzEVP_sm4_ecb.3ssl.gzEVP_sm4_ofb.3ssl.gzEVP_whirlpool.3ssl.gzEXTENDED_KEY_USAGE_free.3ssl.gzEXTENDED_KEY_USAGE_new.3ssl.gzGENERAL_NAMES_free.3ssl.gzGENERAL_NAMES_new.3ssl.gzGENERAL_NAME_dup.3ssl.gzGENERAL_NAME_free.3ssl.gzGENERAL_NAME_new.3ssl.gzGENERAL_SUBTREE_free.3ssl.gzGENERAL_SUBTREE_new.3ssl.gzGEN_SESSION_CB.3ssl.gzHMAC.3ssl.gzHMAC_CTX_copy.3ssl.gzHMAC_CTX_free.3ssl.gzHMAC_CTX_get_md.3ssl.gzHMAC_CTX_new.3ssl.gzHMAC_CTX_reset.3ssl.gzHMAC_CTX_set_flags.3ssl.gzHMAC_Final.3ssl.gzHMAC_Init.3ssl.gzHMAC_Init_ex.3ssl.gzHMAC_Update.3ssl.gzHMAC_size.3ssl.gzIMPLEMENT_ASN1_FUNCTIONS.3ssl.gzIMPLEMENT_LHASH_COMP_FN.3ssl.gzIMPLEMENT_LHASH_HASH_FN.3ssl.gzIPAddressChoice_free.3ssl.gzIPAddressChoice_new.3ssl.gzIPAddressFamily_free.3ssl.gzIPAddressFamily_new.3ssl.gzIPAddressOrRange_free.3ssl.gzIPAddressOrRange_new.3ssl.gzIPAddressRange_free.3ssl.gzIPAddressRange_new.3ssl.gzISSUING_DIST_POINT_free.3ssl.gzISSUING_DIST_POINT_new.3ssl.gzLHASH.3ssl.gzLHASH_DOALL_ARG_FN_TYPE.3ssl.gzMD2.3ssl.gzMD2_Final.3ssl.gzMD2_Init.3ssl.gzMD2_Update.3ssl.gzMD4.3ssl.gzMD4_Final.3ssl.gzMD4_Init.3ssl.gzMD4_Update.3ssl.gzMD5.3ssl.gzMD5_Final.3ssl.gzMD5_Init.3ssl.gzMD5_Update.3ssl.gzMDC2.3ssl.gzMDC2_Final.3ssl.gzMDC2_Init.3ssl.gzMDC2_Update.3ssl.gzNAME_CONSTRAINTS_free.3ssl.gzNAME_CONSTRAINTS_new.3ssl.gzNAMING_AUTHORITY.3ssl.gzNAMING_AUTHORITY_free.3ssl.gzNAMING_AUTHORITY_get0_authorityId.3ssl.gzNAMING_AUTHORITY_get0_authorityText.3ssl.gzNAMING_AUTHORITY_get0_authorityURL.3ssl.gzNAMING_AUTHORITY_new.3ssl.gzNAMING_AUTHORITY_set0_authorityId.3ssl.gzNAMING_AUTHORITY_set0_authorityText.3ssl.gzNAMING_AUTHORITY_set0_authorityURL.3ssl.gzNETSCAPE_CERT_SEQUENCE_free.3ssl.gzNETSCAPE_CERT_SEQUENCE_new.3ssl.gzNETSCAP�x�������������������X��$�
��������@J������5X�$%����������������5X4X6X�����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������/sbin/fixfiles/sbin/restoreconconfig(policycoreutils)policycoreutilspolicycoreutils(x86-64)@	@@@@@@@@@@@@@@@@



@/bin/bash/bin/sh/bin/sh/bin/shconfig(policycoreutils)coreutilsdiffutilsgawkgreplibaudit.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.27)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libselinux-utilslibselinux.so.1()(64bit)libsemanage.so.1()(64bit)libsemanage.so.1(LIBSEMANAGE_1.0)(64bit)libsemanage.so.1(LIBSEMANAGE_1.1)(64bit)libsemanage.so.1(LIBSEMANAGE_3.4)(64bit)libsepollibsepol.so.1()(64bit)libsepol.so.1(LIBSEPOL_1.0)(64bit)libsepol.so.1(LIBSEPOL_1.1)(64bit)rpmrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)sedutil-linux2.9-26.el8_102.9-12.9-13.0.4-14.6.0-14.0-15.2-1filesysteminitscriptsselinux-policy-base39.663.13.1-1384.14.3e�Z�e�@c��@c�c��c�R@b��b8�a�e�a�@aC1�`�i@`Gc@`3��`>�`U�`�@^!��]�|@]��@]ʞ�]µ�]o�@]^��]G@\��@\�@\��\l@\�[�[�%@[Ѱ@[��[ā@[���[�Q@[W�[P}@[2*�[�[��[@Z�l�Z���Z���Z��@Z���Z�
�Z��@Z�v@Z}�@Zq��Z`�@Z:P�Z1@Zf�Y��@Y�(@Y�(@Y�V@Y�@Y}�@Y{'@Yy�X�-�X��X�f@X��X��@X�B�X���XZn�X@�X43@W�H@W�9�W��@W�g�W�@W�~�Wq@Wk�@W3�W'A@W#L�W�W�@V��V�@V��@V�I�V�=@Vn�@VK�VI�@VD@V@��V9�@VZ�Vq�U�U��U��Ŭ�U�L@U�@U�@U�(�U�(�U��@U�4@U�4@U�K@U�y@U���UJ@U+��T�g�T�f�Tk4�TZ@TZ@T!`�S�@S�u�S�/�Sϣ�S���S��S{C�Su��Sp��Sh�Sh�S`�SZN@SX��S:�@S4�S2�@S0@R�@R�@R���R�a@R��R�=�Rʚ�RƦ@RƦ@R�1@R��@R��@R���R��@R��R�G@R��@R��RrF@RrF@Rj]@R^�RW�@RW�@RN��RL
�RIg�RF�R9��R' �R' �R%�@R �@RC@R�R6�R6�R�@Q��@Q�d�Q�Q�p@Q�*@Q�@Q�5�Q��@Q�L�Q�L�Qֵ@Q�4�Q��@Q�@@Q�@@Q��@Q�K�Q�K�Q��@Q��@Q�y�Q�y�Q�(@Q��Q���Q��@Q�a�Q��@Q�'@Q�'@Q��Q��Q��@Q��@Qu&@Qf��QeT@Qd�Qb�@Q\�QYv�QT0�QR�@QR�@QP<@QJ�@QJ�@QHS@QA��Q=�@Q8�@Q7/�Q5�@Q4��Q0�@Q/F�Q/F�Q*�Q*�Q']�Q']�Q']�Q&@Q&@Q$��Q"�Q�Q�Q�@Q.�Q�@Q
\�Qs�P�D�P�D�P�[�P�[�P��P��@P�r�P��PѬ@P�	@P�	@P��P���P���P�7@P���P���P�N@P�N@P���P��@P��@P�*�P�6@P�6@P�6@P��P��P�M@P��@P��@P�@P�d@P��@P�o�P�o�P��P�{@P�)�P�)�P�5@P�@�P~��P~��P}L@P}L@Puc@Pt�Pr�@Pp@Pmz@Pa��PU�@PU�@PQ�P"T�P��P��O�j�O���O�0@O�"�O�"�O��O�9�O�
�O�s@O��@O�~�O�8�O���O�D@O�@Oz�@Oz�@Ou�@OtN�Or�@Oi�OX�@OX�@ON@OKp@OB5�O<�O;�@O+�@O))@O'�O&�@O"��O!@@O!@@O!@@O�O�O�@O�O�@O@O��O
�N�m@N��N��@N��@N��@N�U@N��N��N��@Nå�Nå�N�@N��@N��@N��N���N��@N��N��@N��@N��@N�]�N�]�Nw.�Np�@Nh�@Ng\�Nf@N`�@N\�NL��NL��N.�@N��NN@N��N�M���M�@M��M��M�@M��@M�L@M��@M�m�M�@M�'�M�'�M�>�M��@M�@M��M�2@M��M��M�I@M��@M��@Mz�Mz�Mwk�Mv@Mv@Mt�Mo��Mg��MR��MJ��MJ��MIG@M9u@M6�@M0:�M%��M$]@M�@M��M	�@M��L�L�L�[@L�[@L��@LΫ�LΫ�Lʷ@L�q@L�*@L�A@L�A@L�@L�@L��L��@L�)@L{�@L{�@Lu�Ls�@Lrb�Le3�Le3�Lc�@LZ��LZ��LZ��LZ��LYV@LT@LP�LP�LN�@LMx�LF�@LE��Lk@Lk@Lk@L0�L�@L�@L�@LG�LG�K�^�K�u�K�u�K�u�K��K��K�F�K�@K޺�K�t�K�#@K��K��K��KŮ@K�\�K�"@K�9@K��K��@K��@K�[�K�r�K�,�K��@K��K��@K��@K���K{�@Kz��Ks�@Kl@Kie@Kb�Ka|@Ka|@K`*�KXA�KU��KO@KG@KG@KD{@K+n�K*@K(�K �K?�K��K@K�K�K>�J��@J��J��@J��@Jݦ@J�T�J�`@J��Jս@J�1@Ję�Ję�J�H@J�@J�v@J�$�J�$�J�0@J�0@J�0@J�G@J�G@J���J�^@J��J�u@J�#�J�#�J��J��@J�:�J��@J��@J���J���J�@J�@J��Jyt@Jp9�JlE@JS8�JD�@J'�@J#�J�J��J�I�x������������������X��$�
��������0�������W�$m�����������������W�W�W�ld- fixed tcp timers info in netstat (#466845)- fixed ifconfig's man page (#454271, #432328)- fixed man pages for arp (#446195)
- fixed netstat --interfaces option (#446187)
- fixed clearing flags in ifconfig (#450252)- netstat displays correct sctp statistics (#445535) <zprikryl@redhat.com>- fix buffer for newer kernels (#435554)- fix for GCC 4.3- Autorebuild for GCC 4.3- rebuilt- fix netplugd init script (#242919)- better SELinux patch by <dwalsh@redhat.com>- fix segfault for empty interface (#234045)- we don't have -n/--node option (#225554)- quiet sctp (#229232)- spec file cleanup (#226193)- touch /etc/ethers (#225381)- fix arp unaligned access (#220438)- fix nameif crash for 16char long interface names (#209120)- fix -I option for nestat, works as -I=eth0 again.
- add dist tag- directory entries . and .. should be skipped- rebuild- switch --trim to --notrim .. make it less confusing- BuildRequires: libselinux-devel (#191737)- add netdevice.h, fix x25
- fix ifconfig crash when interface name is too long (#190703)- fix arp man page to correspond to man ethers (#190425)- display sctp connections using netstat -S <jbj@redhat.com>- fix wrong definition of _PATH_PROCNET_X25_ROUTE (#188786)- add note about -T to netstat- add note to ifconfig(8) about supported format for IPv4 addresses (#176661)- remove duplicate arp entries (#185604)- show inodes in netstat (#180974)- bump again for double-long bug on ppc(64)- new option for netstat - -T stops trimming remote and local addresses (#176465)- rebuilt for new gcc4.1 snapshot and glibc changes- mii-tool manpage fixed (#180055)- forget to enable the new selinux option :( - config.make changed- new option for nestat, -Z shows selinux context. Patch by <dwalsh@redhat.com>- clear static buffers in interface.c by <drepper@redhat.com> (#176714)- rebuilt- add note to hostname man page about gethostbyname() (#166581)
- don't ship any rarp man page (#170537)- fixed buffer overflow in arp (#164695)- ifconfig - fixed virtual interface dropping (#162888)- fr man pages are back (#159702)- etherwake man page changed to ether-wake (#159156)- don't show "duplicate line" warning (#143933)
- netstat has new statistcs (#133032)
- /etc/neplug is owned by net-tools (#130621)- flush output in mii-tool (#152568)- added mii-diag tool
- added newer ether-wake
- remove useless -i option from ifconfig
- stop trimming interface names (#152457)- rebuilt- behaviour of netstat -i option changed (#115987)
- netstat -i shows all interface, -I<Iface> only one- added RPM_OPT_FLAGS
- execshield patch for netplug <t8m@redhat.com>- small typo in german translation (#148775)- included infiniband support (#147396) <tduffy@sun.com>
- added etherwake man page- net-plug-1.2.9 - no changes, upstream included Red Hat patches
- ether-wake-1.08 - few changes in implementation (#145718)- don't report statistics for virtual devices (#143981) <kzak@redhat.com>
- fixing translation headers - content type format
- kill bitkeeper warning messages- filter out duplicate tcp entries (#139407)- added note to hostname(1) (#140239)
- fixed --num-ports option for netstat (#115100)- mii-tool(8) fixed, labeled as obsolete, added info (#138687)
- netstat crashing on i64 fixed (#138804) Patch by <Andreas.Hirstius@cern.ch>- IBM patch for netstat -s returning negative values on 64bit arch (#144064)
- broadcast calulated if only netmask provided (#60509)- fixed fail to assign the specified netmask before adress is assigned
- patch by Malita, Florin <florin.malita@glenayre.com>- spec file updated, added conversion for french and portugal man pages to UTF-8- parse error fixed (#131539)- The return value of nameif was wrong (#129032) - patch from Fujitsu QA- Trunc patch added (#128359)- Added patch for SI units by Tom "spot" Callaway <tcallawa@redhat.com> #118006- Fix installopts for netplug.- Build requires gettext.- Update to latest netplugd version.- Fixed initscript patch for netplug (#127351)- rebuilt- Fixed compiler warning/error in netplug.
- Up�x�������������������X��%�
�r��������������$W��������������������ve java stuff to gettext-devel (#132239)
- add BuildRequires: gcc-c++ (#132518)
- add some missing install-info and ldconfig (#131272)
- fix dir ownership (#133696)
- run autotools for 1.9- rebuilt- use --without-included-gettext to avoid the need of libintl.so (#125497)
- remove preloadable_libintl.so- moved some of the shared lib to main pkg
- added more build requires- add conditionals for patch and requires auto* (#125216)- packaged lib files for devel
- moved some of the files to different sub-pkg
- fix problem on x86_64 build- rebuilt- rebuilt- rebuilt to 0.14.1- rebuilt 0.12.1
- fix including files and excludes some patches- rebuilt- 0.11.5- rebuilt- add online help for msghack replacement- add patch to fix gettextize (#78720)- remove unpackaged files from the buildroot- Use %{_libdir} instead of /usr/lib (#72524)- install ulonglong.m4, which is required by uintmax_t.m4, which is already
  being installed- 0.11.4- automated rebuild- automated rebuild- 0.11.2
- include some new files- Add patch to make it compile with C99 compilers (#62313)- 0.11.1- update gettext to 0.11
- disable patch4- automated rebuild- improve automake handling- Add URL
- Add automake workaround (#56081)- 0.10.40 - libintl is now LGPLed (it was GPLed). Note that RHL
  uses the glibc version, and don't include libintl from gettext.
- include new man pages
- don't include the elisp mode - bundle it into the main emacs package,
  like we do for XEmacs.
- README-alpha no longer exists, so don't list it as a doc file- Rebuild - this should fix #52463- Fix handling of multiline entries (rest of #50065)
- don't use the references of the last entry in a po file
- remove duplicates when inverting
- Own the en@quot and en@boldquot locale dirs (#52164)
- Handle entries with a first line of "" as identical to those
  without- Added "--append" and "-o" to msghack, which should address 
  initial concerns in #50065- New msghack - from scratch, in python- msghack is back- Include some docfiles- 0.10.38
- do not include charset.alias- Build statically.- 0.10.37
- Disable all but two patches- Initialize proper fonts when entering po-mode (#29152)- More fix about msgmerge.- Fix for msgmerge not to break multibyte strings
  at Japanese locale.- fixed the %lang generator to not have "./" in the lang- add an init file for the emacs po-mode
- update source URL- put gettext in /bin for initscripts use
- %langify- prereq /sbin/install-info- Added patch from Ulrich Drepper- update DESTDIR patch (#12072)- automatic rebuild- fix problems wrt to DESTDIR (#12072)- use FHS paths
- add buildroot patch for .../intl/Makefile.in, was using abs. install path- minor configure tweaks for ia64- add --comments to msghack- fix bug #9240 - gettextize has the right aclocal patch- add the --diff and --dummy options- add the --missing option to msghack- updated msghack not to merge in fuzzies in the master catalogs- updated msghack to understand --append- updated msghack to correctly deal with sorting files- msghack updates- auto rebuild in the new build environment (release 8)- added patch for misc hacks to facilitate rpm translations- patch to allow to build on ARM- add Emacs po-mode.el files.- include the aclocal support files- remove devel package (functionality is in glibc)- update to 0.10.35.- add gettextize.
- create devel package for libintl.a and libgettext.h.- translations modified for de, fr, tr- added info handling
- added misc-patch (skip emacs-lisp modofications)- removed locale.aliases as we get it from glibc now
- uses a buildroot- Built against glibc/bin/sh/bin/sh�x������������������X�%�
�������&������x�$h����������������xwy�								
	
	



	


	



RRR$R!R RRQRRaRR#R$RR!R RRRaRR$RR!R RRRaRR$RR!R RRRaR R!RRRaRR$RR!R RRRaRMRNRLRJRIRR$RR!R RRHRRaRR#RR$RR!R RRQRDRRaR;R6RRRR$RR#R!R RR5R	RYRFRDRRaRR$RR!RR RRRaRJRIRR$RR!R RRHRRaR
RSRKRJRIR$RRR!R RR8R9R:R>R<R7R;R6R5R	RFRDRHRYRRRRaRERR$RR!RR RRDRRaRR R!RRRaRRR$R!R RRQRRaRR$RR!R RRRaRRRRR$RR!R RRRRaRR$RR!R RRRaRR#R$RR!R RRRaRR$RR!R RRRaRR$RR!R RRRaRR#R$RR!RR RRDRRaRPRRR$RR!R RRORRaRCRARRR$R#R!R RR@RBRRFRRaRR R!RRRaRSRRRMRJRIRRRR$R#R!R RR9R;R6R	R5RYRFRDRHRRRRaRJRIRRR#R$RR!R"R RRHRRaRJRIRR#R$RR!R RRHR�x�����x�����������X&]%�
x��yd�$i����������������ydzdxd�TIME_to_tm.3ssl.gzASN1_TYPE_cmp.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_pack_sequence.3ssl.gzASN1_TYPE_set.3ssl.gzASN1_TYPE_set1.3ssl.gzASN1_TYPE_unpack_sequence.3ssl.gzASN1_UTCTIME_adj.3ssl.gzASN1_UTCTIME_check.3ssl.gzASN1_UTCTIME_cmp_time_t.3ssl.gzASN1_UTCTIME_print.3ssl.gzASN1_UTCTIME_set.3ssl.gzASN1_UTCTIME_set_string.3ssl.gzASN1_add_oid_module.3ssl.gzASN1_generate_nconf.3ssl.gzASN1_generate_v3.3ssl.gzASN1_tag2str.3ssl.gzASRange_free.3ssl.gzASRange_new.3ssl.gzASYNC_WAIT_CTX_clear_fd.3ssl.gzASYNC_WAIT_CTX_free.3ssl.gzASYNC_WAIT_CTX_get_all_fds.3ssl.gzASYNC_WAIT_CTX_get_changed_fds.3ssl.gzASYNC_WAIT_CTX_get_fd.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_set_wait_fd.3ssl.gzASYNC_block_pause.3ssl.gzASYNC_cleanup_thread.3ssl.gzASYNC_get_current_job.3ssl.gzASYNC_get_wait_ctx.3ssl.gzASYNC_init_thread.3ssl.gzASYNC_is_capable.3ssl.gzASYNC_pause_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_unblock_pause.3ssl.gzAUTHORITY_INFO_ACCESS_free.3ssl.gzAUTHORITY_INFO_ACCESS_new.3ssl.gzAUTHORITY_KEYID_free.3ssl.gzAUTHORITY_KEYID_new.3ssl.gzBASIC_CONSTRAINTS_free.3ssl.gzBASIC_CONSTRAINTS_new.3ssl.gzBF_cbc_encrypt.3ssl.gzBF_cfb64_encrypt.3ssl.gzBF_decrypt.3ssl.gzBF_ecb_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_ofb64_encrypt.3ssl.gzBF_options.3ssl.gzBF_set_key.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO_address.3ssl.gzBIO_ADDRINFO_family.3ssl.gzBIO_ADDRINFO_free.3ssl.gzBIO_ADDRINFO_next.3ssl.gzBIO_ADDRINFO_protocol.3ssl.gzBIO_ADDRINFO_socktype.3ssl.gzBIO_ADDR_clear.3ssl.gzBIO_ADDR_family.3ssl.gzBIO_ADDR_free.3ssl.gzBIO_ADDR_hostname_string.3ssl.gzBIO_ADDR_new.3ssl.gzBIO_ADDR_path_string.3ssl.gzBIO_ADDR_rawaddress.3ssl.gzBIO_ADDR_rawmake.3ssl.gzBIO_ADDR_rawport.3ssl.gzBIO_ADDR_service_string.3ssl.gzBIO_accept_ex.3ssl.gzBIO_append_filename.3ssl.gzBIO_bind.3ssl.gzBIO_callback_ctrl.3ssl.gzBIO_callback_fn.3ssl.gzBIO_callback_fn_ex.3ssl.gzBIO_closesocket.3ssl.gzBIO_connect.3ssl.gzBIO_ctrl.3ssl.gzBIO_ctrl_get_read_request.3ssl.gzBIO_ctrl_get_write_guarantee.3ssl.gzBIO_ctrl_pending.3ssl.gzBIO_ctrl_reset_read_request.3ssl.gzBIO_ctrl_wpending.3ssl.gzBIO_debug_callback.3ssl.gzBIO_destroy_bio_pair.3ssl.gzBIO_do_accept.3ssl.gzBIO_do_connect.3ssl.gzBIO_do_handshake.3ssl.gzBIO_eof.3ssl.gzBIO_f_base64.3ssl.gzBIO_f_buffer.3ssl.gzBIO_f_cipher.3ssl.gzBIO_f_md.3ssl.gzBIO_f_null.3ssl.gzBIO_f_ssl.3ssl.gzBIO_find_type.3ssl.gzBIO_flush.3ssl.gzBIO_free.3ssl.gzBIO_free_all.3ssl.gzBIO_get_accept_ip_family.3ssl.gzBIO_get_accept_name.3ssl.gzBIO_get_accept_port.3ssl.gzBIO_get_bind_mode.3ssl.gzBIO_get_buffer_num_lines.3ssl.gzBIO_get_callback.3ssl.gzBIO_get_callback_arg.3ssl.gzBIO_get_callback_ex.3ssl.gzBIO_get_cipher_ctx.3ssl.gzBIO_get_cipher_status.3ssl.gzBIO_get_close.3ssl.gzBIO_get_conn_address.3ssl.gzBIO_get_conn_hostname.3ssl.gzBIO_get_conn_ip_family.3ssl.gzBIO_get_conn_port.3ssl.gzBIO_get_data.3ssl.gzBIO_get_ex_data.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_fd.3ssl.gzBIO_get_fp.3ssl.gzBIO_get_info_callback.3ssl.gzBIO_get_init.3ssl.gzBIO_get_md.3ssl.gzBIO_get_md_ctx.3ssl.gzBIO_get_mem_data.3ssl.gzBIO_get_mem_ptr.3ssl.gzBIO_get_new_index.3ssl.gzBIO_get_num_renegotiates.3ssl.gzBIO_get_peer_name.3ssl.gzBIO_get_peer_port.3ssl.gzBIO_get_read_request.3ssl.gzBIO_get_retry_BIO.3ssl.gzBIO_get_retry_reason.3ssl.gzBIO_get_shutdown.3ssl.gzBIO_get_ssl.3ssl.gzBIO_get_write_buf_size.3ssl.gzBIO_get_write_guarantee.3ssl.gzBIO_gets.3ssl.gzBIO_hostserv_priorities.3ssl.gzBIO_info_cb.3ssl.gzBIO_int_ctrl.3ssl.gzBIO_listen.3ssl.gzBIO_lookup.3ssl.gzBIO_lookup_ex.3ssl.gzBIO_lookup_type.3ssl.gzBIO_make_bio_pair.3ssl.gzBIO_meth_free.3ssl.gzBIO_meth_get_callback_ctrl.3ssl.gzBIO_meth_get_create.3ssl.gzBIO_meth_get_ctrl.3ssl.gzBIO_meth_get_destroy.3ssl.gzBIO_meth_get_gets.3ssl.gzBIO_meth_get_puts.3ssl.gzBIO_meth_get_read.3ssl.gzBIO_meth_get_read_ex.3ssl.gzBIO_meth_get_write.3ssl.gzBIO_meth_get_write_ex.3ssl.gzBIO_meth_new.3ssl.gzBIO_meth_set_callback_ctrl.3ssl.gzBIO_meth_set_create.3ssl.gzBIO_meth_set_ctrl.3ssl�x������������������X��$�
p�X��W�$l�����������������W�W�W�eam
- mark localized man pages with %lang- 3 patches merged upstream
- removed 2digit.patch (#718610)
- removed fgets.patch (probably not needed anymore)- next 11 patches merged upstream
- removed bcast.patch (seems to be fixed upstream)
- removed netstat-p-basename.patch (upstream is not happy with it)
- netstat-leak.patch merged into duplicate-tcp.patch- removed virtualname.patch
- added back isofix.patch
- improved mii-registers.patch- upstream git snapshot
- reduced number of patches from 95 to 32
- netstat -T/--notrim option is now -W/--wide- Removed HFI support.
- Improved num-ports.patch- Merge all upstream fixes into net-tools-1.60-upstream.patch- Upstream is migrating to Sourceforge.- Fixed ether-wake(8) and mii-diag(8) man pages (#742629)- Improved arp-ethers.service unit file (#735617)- Improved netstat_stop_trim.patch to not truncate IPV6 UDP sockets (#732984)- Update for 2 digit Linux version numbers (#718610)- Added arp-ethers.service systemd unit file to run 'arp -f /etc/ethers'
  on startup of system. Don't ship default /etc/ethers (#713759)- Do not mention /proc/net/socket in ifconfig(8) (#661905)
- Merge all 'man page only fix' patches into net-tools-1.60-man.patch- Fix possible problems found by static analysis of code.- patch netstat to separate basename of -p only if it is absolute
  path (in order to make argv[0]="sshd pty/0" display as sshd, and not as /0).- plipconfig man page and usage output fixes. (#694766)- Fix mii-tool/mii-diag/ether-wake to not default to eth0 because
  since Fedora 15 network devices can have arbitrary names (#682367)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Improve scanf-format.patch (#668047)- Improve route(8) man page saying that 'route mss' actually sets MTU (#671321)- Fix the handling of some of the HAVE_* flags ifdef vs if. (BerliOS #17812)- fixed mii-diag(8) man page (#663689)
- fixed route(8) man page (#664171)- fixed ifconfig(8) man page (#663469)- improved netstat(8) man page (#614931)- added netstat(8) support for RcvbufErrors, SndbufErrors (BerliOS #17645)- Rebuilt for gcc bug 634757- HFI support- fixed memory leak in netstat when run with -c option- improved statistics-doubleword.patch (Bug #579854)- updated mii-tool to support gigabit links (#539575)- fixed statistics.c to use unsigned long long (instead of int) to handle 64 bit integers (Bug #579854, Debian #561161)
- fixed typo in statistics.c (Bug #579855)- fixed overflow patch (#551625)
- ifconfig interface:0 del <IP> will remove the Aliased IP on IA64 (#473211)
- interface slip: cast keepalive/outfill to unsigned long to fix warnings on 64bit hosts -- no functional changes since these only have an 8bit range anyways
- interface: fix IPv6 parsing of interfaces with large indexes (> 255) (Debian #433543)- Move hostname to separate package- return defining of BuildRoot even it's no longer necessary
  (https://fedoraproject.org/wiki/Packaging:Guidelines#BuildRoot_tag)
  to silent rpmlint false warning- in mii-tool.c use <linux/mii.h> instead of "mii.h" and fix Bug #491358- Make "hostname -s" display host name cut at the first dot (no
  matter if the host name resolves or not) (bug #531702)- netplug moved to separate package
- #319981 and #322901 - minor man pages changes
- applied changes from berlios cvs, which fix: Berlios #16232, Gentoo #283759 and polish Makefile and slattach- netstat - avoid name resolution for listening or established sockets (-l) by return fast. 
- netstat - --continuous should flush stdout
- added missing man pages (iptunnel, ipmaddr, netplug, netplug.d, netplugd.conf)
- added note about obsolete commands to existing man pages 
- let the user know that ifconfig can correctly show only first 8 bytes of Infiniband hw address- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- scanf format length fix (non exploitable?) from Fabian Hugelshofer <hugelshofer2006@gmx.ch>
- URL tag changed to http://net-tools.berlios.de/- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebui�x�������������h�����X��%�
�����������������$.���������������������)]��)]��)]��)]��)]��)]��)]��)]��)]��)]��)]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]��)]��)]��)V�SQ]��)]��]�қTk�%P��*P��*T��P��*WY�P��*WY�W\	]��]��]��(]��(]��(Vf�Vf�V�SQVf�VzHkVzHkVf�VzHkWY�]��(]��"WY�Tk�'VzHkP��*P��*P��*P��*P��*P��*]��"V�SQV�SQV�SQV�SQV�SQV�SQW\W\dW\jW\
6W\
=W\
6W\
>W\
6W\jW\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
>W\jW\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
6W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
>W\
6W\
>W\
6W\jW\
6W\
>W\dW\jW\
6W\
>W\
6W\
>W\
7W\
>W\
7W\
>W\
7W\
>W\
7W\jW\
7W\
>W\
7W\
>W\
7W\
>W\dW\
7W\
>W\	]��W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�]��W\�]�� 3cade7e28fcef68312108df54585b6eda7ccd5efb5ef9033d421ae4c8cb6f2dcf252061af47e1f773ed29e3010f24412f5c7359b3ed5a74a3b7ac84e2b0959fbd6500b47e8dd42f1ef88d0effb9203bbc5d23f0bade3d6fac41468ae9dc4d3a24c84ed5af2781e2b9a11be085d2bcbae5dd6739cf3be5d5fefcb86290d97a060f54da466596be271a1e3b604ede62ddd54f1e903fc620e380ac1c27ba16561612b57870c232dd3c8f48f43259fc341da5563cc0f198d9f3aaa482b62c117a3c5a0ad19ea873e2f5cfb9f6e39189b0f3a5b810c1f00e2f2985a67062d6b0363a6fbb01d670de00b8663de15cbd3e6432cc34a961bff7c765781a0e8ef05d879ca2978eb4a21396e5ab7e0a44b67c4d653018b01ec39ce4455d68ac36e54d325f2a9f7060e57eed0826bfb8cb85712ac932a505830d2ac949fa3f2ae85e3428cdc7743106fe77f222e4876dff59c18152490f3e5220b9a8effb3f23146b3b0ee1b049cbc732103b8142b46ea7107dd4694834caad39a49ce5ecc7edbb7bb28f8eecac3cb4e41992c121acb05a5244d054bd4d79d3b568a1e874dcf429a04309cb530ee13ef31458d3eb6cecc75fc1e4026e2ba89766d9f8b7c21594977d4d8c599f276b3c4d898796cc66fd6a2760329b871f1ca319c0e6a13d8c7703ae116680e271ec77dbd5bcefd23c4721b15b679caf833fb770c04c8ab21c08d2954616c53b4c889b79416b1da7641b380f892411bd8543f1d618beb84fca2587761c6f990186c4c6075f0b4dc15ce6799f4f1aab30f453d66696313f678f0ec14268d458f66855fd6b5fd6fa5088a46b17ea86cd3dceb12cf47535fd4c0e6dd314b5951fcc425fa83e18e9b54f5b1fc8d977138bd9855b23140f9d473338484d30207d405b344049bc22036c131d4982770e0b5296cd9d86f51045601087ba382b18a4fc219a4e91505c0b6dce1ac8a61f6435e6bc6874a3c1313f5ce54c623cc35b5f4ee2f6f990858a05ac854b5809c652ce9148529b26bbdd8154ddf12764da0e82d2c3c1e0240df767b62ac86e017efe06d3bd1438d243f8bc69ec553172ed0dc08453220894eb086252ba417a438cd309a759996323aa818aa8befd4a0768eba9ff7b5a0860df3e21b2bfdef52893bfcdd5ca3a81f3714d5591682c845a1cbf46359c8953a637c1b38e4d8db4cdddffacb2096ac4fce6178403c842d68f8b0de95bd8ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b9033fe5361f24b7c49ba12911c08f5a33f9cb18871d95d9fb881f5b8a4793e04288676e5840760b6adfc1c825615a6ccae0d8803018a18e8a3c511d28d9b62f51af4336e4a9cb4becdd86dd91104bf57fb92d55910b3479499c77e1e27b9c21c7101ee8289abcf7f86d48b4b10fc82da76b20e39c238159f0e2bbd263d8d930edb59e983b35e4c818b00ee5568cede04ef1c2eb24d4dd96e4e91c9b904e866927950a5c49a50383b8a984e82f23e48b5ac1f5649ff0a07830d4f5403e0cde33d73bca4068f64726454f71bcd1670e4da6e3d8f96d596642554b6025f94548841056700348e6ed9006f0ef3d6c5beaf22fa5ac358b9a16c57e74b8ed312b3ef3592e3eb1a786c9d725ac8f41030c63e37ec94cf4db04d926398fbab5138e862695255d6d31196dca079b1c43f65282953af5d6586bd1ada936931ec3bb0a502cf3b11623b4cb92fd33a0c35ec9a3d5c3ee0d960f3288951c10b3dfb6d5670c2c65fe3a60192fe6f655e9373d6b3c5368b63cd4d8c66b0050a7bb67bd12b6171daa65f1c7ed8274f848d63b32b8ec66f438c8dbe67c659a939b0e6f649803dd59f7a4949781fbd03ce1e1a16b797a856edfe8cbf18550aa28e52bbd1c64434ab9da76d28bb08e5db9aadf20bfa00b963ef21b53804a7b76d4acd63280b6008cf4c85181c39f44376083d31004805c7e069fd681a8c2c98a4f8fa79d39b4800b71ac8739004a6f74a9a482bb70af3d17ba0d3ac32964e666302160dc8e6590eb1a35b8ed85e3a2a4ce7157180b40ffab00bd8a24b4891c9ffc3e3bc94cb161d62e744cd5a3b72f3d2a12b6740416c201b35c77808a981feae8a7c9b674cd3ee875e00001b364b311c593a1a80c02fe2dd68cbeff7014515f4d54b3bf62dc74370a179033234736a58f1610c73e1c8c08faf1b2ef1397d878dd7d2cbd888ca0f2da4ffc3b0b89aa6625c051e69cce1e341f973f62ca9�x��������������w����X��$�
���������Y������m�$}����������������mln�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()cacsdadeeseteufifrglhrhuiditjanlplptruslsvtrukvizhzh2.32.1-46.el82.1.60.52.32.1-46.el82.32.1-46.el82.32.1-46.el8

2.1.50.52.19�x�������������Xg����X�.$�
��������XQ���������$o���������������������� available
    resolves: rhbz#953128
  - man: various updates and corrections
  - functions: fixed usb and bluetooth handling
  - tuned: switched to lightweighted pygobject3-base
  - daemon: added global config for dynamic_tuning
    resolves: rhbz#1006427
  - utils: added pmqos-static script for debug purposes
    resolves: rhbz#1015676
  - throughput-performance: various fixes
    resolves: rhbz#987570
  - tuned: added global option update_interval
  - plugin_cpu: added support for x86_energy_perf_policy
    resolves: rhbz#1015675
  - dbus: fixed KeyboardInterrupt handling
  - plugin_cpu: added support for intel_pstate
    resolves: rhbz#996722
  - profiles: various fixes
    resolves: rhbz#922068
  - profiles: added desktop profile
    resolves: rhbz#996723
  - tuned-adm: implemented non DBus fallback control
  - profiles: added sap profile
  - tuned: lowered CPU usage due to python bug
    resolves: rhbz#917587- new-release:
  - cpu plugin: fixed cpupower workaround
  - cpu plugin: fixed crash if cpupower is installed- new release:
  - audio plugin: fixed error handling in _get_timeout
  - removed cpupower dependency, added sysfs fallback
  - powertop2tuned: fixed parser crash on binary garbage
    resolves: rhbz#914933
  - cpu plugin: dropped multicore_powersave as kernel upstream already did
  - plugins: options manipulated by dynamic tuning are now correctly saved and restored
  - powertop2tuned: added alias -e for --enable option
  - powertop2tuned: new option -m, --merge-profile to select profile to merge
  - prefer transparent_hugepage over redhat_transparent_hugepage
  - recommend: use recommend.conf not autodetect.conf
  - tuned.service: switched to dbus type service
    resolves: rhbz#911445
  - tuned: new option --pid, -P to write PID file
  - tuned, tuned-adm: added new option --version, -v to show version
  - disk plugin: use APM value 254 for cleanup / APM disable instead of 255
    resolves: rhbz#905195
  - tuned: new option --log, -l to select log file
  - powertop2tuned: avoid circular deps in include (one level check only)
  - powertop2tuned: do not crash if powertop is not installed
  - net plugin: added support for wake_on_lan static tuning
    resolves: rhbz#885504
  - loader: fixed error handling
  - spec: used systemd-rpm macros
    resolves: rhbz#850347- new release:
  - remove nobarrier from virtual-guest (data loss prevention)
  - devices enumeration via udev, instead of manual retrieval
  - support for dynamically inserted devices (currently disk plugin)
  - dropped rfkill plugins (bluetooth and wifi), the code didn't work- new release:
  - systemtap {disk,net}devstat: fix typo in usage
  - switched to configobj parser
  - latency-performance: disabled THP
  - fixed fd leaks on subprocesses- fix: powertop2tuned execution
- fix: ownership of /etc/tuned- new release:
  - daemon: allow running without selected profile
  - daemon: fix profile merging, allow only safe characters in profile names
  - daemon: implement missing methods in DBus interface
  - daemon: implement profile recommendation
  - daemon: improve daemonization, PID file handling
  - daemon: improved device matching in profiles, negation possible
  - daemon: various internal improvements
  - executables: check for EUID instead of UID
  - executables: run python with -Es to increase security
  - plugins: cpu - fix cpupower execution
  - plugins: disk - fix option setting
  - plugins: mounts - new, currently supports only barriers control
  - plugins: sysctl - fix a bug preventing settings application
  - powertop2tuned: speedup, fix crashes with non-C locales
  - powertop2tuned: support for powertop 2.2 output
  - profiles: progress on replacing scripts with plugins
  - tuned-adm: bash completion - suggest profiles from all supported locations
  - tuned-adm: complete switch to D-bus
  - tuned-adm: full control to users with physical access- New version
- Systemtap scripts moved to utils-systemtap subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- another powertop-2.0 c�x��������������V����X�%�
�����������d�$Q�����������������d�d�d�3db14cc88f6c411a360e634c136ae31d27cd1d2b18620f5532b4fa029edc26396ba018e4a99629dafca98fa1e73d620998ea0192e357ca23128625ea85b8b925498f279b60510136a001f5cfb30903ebf798fbdc817905265c134e913f89fe20110b68e8899cca019171106fed40215f6b2ed33c51038a6b391f8ac010c66e0e186779cbc55bb723b25facd4d47a3420c55bceff6327114f5cb10e2c550a11ed55431628a7948ac3096ad0f1e36bddd55178e8c6e7031c84cd636397289a07f244064f22e312dd2a3ed7bebfdb20a4b7185b3857b6873fc2b322483188cab50d346ca1118d1404807309716b1ae0db6449991c14e6b8a3128ca08ab6070471a4d902daf8139c102d9161b3185b62351c81dd866e1d8d61b180f59cf907cee98549a45fc682a5c5b27e155ea29e0795745ef0a4270893f833deb8574c3424e050211cbd53dbf511a9cbe487bc22e8e38517f24579a399f3179fb6bd82e9ec7bdd8b0a8edd45cceed259b803a878be555a4bd1927c514649aa4c95e06b876fa2f0b5851fbef24257223ad53e6e41768939ec53391584688de1ede6da1c7afc34134dcc084f66b3d9aab31ef4568e7e5a07b4e9d8a92bb822373242a669cbf38235c20eb8d26065948b7f25916d3b5b19a857337d0b559e979f079b175a2857d875d0b83996ae1f12bab5ac1c0bfdb732858821ce6dc8a1130091181498d599c836050cca6d543ca63b139e745aaece12a766a09d8b73456ccfc6d5c75eb977e84e2e962a92b4d8472ad50003a6e861c6147263cf25625c190f4b6f1212b4b81ef532a6ad4167d7ba2eb5c013a04d92dfd8d9125ab1a77efa6b8e3c6cecf64d9efaedf6fc9a591c2978bd85e3134ccafeb47129286f18dba33627f8ddb80130556e14ae9666d9b59274a20fb201db5bbc7ffb3f4032499b380f8381d763e95ba22b3dc2e4c044dd6eb296eca152526e3ccc305ffed4d24585273312a23a0378780431d3599552c38edd924230847f1b6610c8f1688f42e6e752d01434f1597298fe23c3b6ea744d26431558cebb2646af1d6379a912863fdd8090b3fd23a9e462cfd07dd64fec40fc3a01d1b588c6d05cf4eb191c5af9bbf0bf81bc6bf7ad836b6a1d17ff08dd342fb67e574da3d37d6e3e96096002b70a6dc7b038a91f8ef63b1bf5da9888c7da8e87575b48ff26c65cc9a19c424e8d45f1120784755f37962dd815028315ef8147e1279a3dfaa8437e53cd3a306fa60e84dbfbdcc704841bdf108a75c23dda40f6a1e2ec43f1888e6eef3103c1e8570ef92259c754f4b973f3c9d4d6cf7675ba86b41845b04b3555aa9d0243e295ba1e423fdd5547e30dd713b3eb4bfbfcc8b8cf4ea3505eea2545d41bacffc4b34f9bc5065bcabf8da77324aa7ee1efc851c3ae999254019aab89463cc0a5ab1c13588c69f057bf84c51043a4fe82d2bd25c3c27a7443a14f73fb5614f4ec326db7f8e8a514710e5d8e6c09df0a1ff2cb85ce394d5385f20ae6a1a44baadf70ce82fbc17daab99be6436d1d4c735f3146166fdf2e59edfd0ce4ddba3424b1a508188bd73dcd4e6f129c19c30667422ec5e33f388e4490eab1a42b0af5eece6e88bf2c2484cc68cadae40722be1a7a9d3840189824b7fa3d5f87e9b54e7b5f6bdf9ceddc2df1899469b30cc612e19310d250b6578459a16c867eca03ffdba32c463923746313d8ed168219ba3cdbc297438cf1e3f90d73b7c7e654310a9d82295db4cefb183d90791fa8e4c4f30d2a5992fbed106deaedb2a58d3eea1054abdee9b404be3fe9bef1a1c54698c52c390094ecc4b0674d31a62e175de811b1f93d4da30afb5cd76a5c172585dd533b2763226bf06bf3ecece06803bbe77410a8a8782c36ac7de935d006dbc972c5a66aaa68fc7901cf56eb51a8cf5aa3baed5561ae505a0c3e7756f7ce1a21a47b7cd0592f25230a0dd2040ace93fb742f044930630bf5f92030baef3e71a8f60635f965fc874554f0985323a2b37575a8229c366a7f8ef3ed56009c120c59ab1f1b0322fa63b399dd9d8cd1b05a3792fc2a1ec4c96e2701b1eb7c6f27ccc0e2aa2c6c225b1e9d704caed397d2dbfa85ffab4cefe7abc75d5082377f6411166c22f75f72b1163e59ce4119980f42e77f1e4ed5a7d25f650f76fc57c40fe933a7c84c963daffd3aa9b5633a18aa7ac24199d9370d4cc547b00db7a5446f3a851642e2e2597680e3499e7db6a646171a3b9425a726f4dfacab220e2e14e655f2eadd58715832f76abeba61e2f68c216a4f4f3873753d38ce772b09df2ad748aa1f7ff5c88937a543eb845a1bcd9cd514417e6482fb438600c25681dbd453f3dcdf3f5e58c9ba8a6753ee435a062e7b412b926339232ff8b793d58b3d6c17f8ffcc3fd8ac15021e90a5cb51080b556bd21e92a44367e79e636f09e8a4bf6b99537bc748�x�������������HF����X��%�
�������HY���)��$9����������������)�*�(��../0123456789:;;<<<<;;;;;;;==;;>>?;@;;;;;;;;AAAA;;B;CD;;;;EEEEEEEEFFFFFFFFFFFFFFF;GHGIGJKJLGMGNOPOGQRGSGTGUGVGWXWYWZW[G\G]^G_`aGbGcGd;eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeffffffffffffffffffeeeee;;;gg;;hhh;;;;;;;;iiiiiiiiiii;;;;jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkllllmmlllnlolllpppppllllqqrrrrqlssssslllltluuuvvlwwlllxxxxllyllzlll{{l|ll}l~~~~~~~~~lll�l��lllllllllll�lllllllll�lll��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������llllll�perlperl5.26.3.build-id00ac4539aeb462508c811e4e9b589d476b7b8f3d0789a40331769143eac65087200fc9ee07673eca0b93a2c0e77051df14d9030fd92d070d87536ff4106c8ce60fb6a70ca010eddc08655cec22149b221192ff9fe30513a27467baeeb3ac4b0c46ade69414927ecfe0c603ccb7153250ef2f52f12614542216bc822e4ec2050b8c267a7095a6fe3ceaff5c911844a37b15cfa03be2cb97c07817e17e9ebc50be1bc4cd0bba113258f0015fdceca91323141831bb20307d9d535d93a26fd5238cc181a63b187ed0892fc46f25fa2c9ce10bd177a351ff4ffcbc38df5e30655675b453c3b9ff261dde6fd07866714a933f316f1260b949023b936dad89521d017e169906a13239efc797250ec716ad27df6214fa2581354112366feac23936d5e5f06afeed41e3034fa6a4a5b03c94a41868acedbf6b992ee0ac410�x������������`5����X"�$�
��������PZ�������W�$g�����������������W�W�W�fecd62394f8d5b7eb7621233f2c5f1d4193396afa56440684ab9e68152632c0b2cad69b1cc86e13b73bdfa58f1bb7b38e03d1f8cd79086c87a5bfd7487f78cd84db10660f8b630f288cc273687cbf8e1d5a609881779b153cce850fbc6ab11f96606a1125cbec0185e718427aab60744d58fd7b46d3fa321944958399e1f59e73c844afdf33f7f3b509b8b46fbe7343932efa176da925fa7dbd0f467b0e3dac63157d627905bb4241903957e57db159d3bbd99db81ba9162696892ed7b8a5468f7d1ecc7c3b4469c9d01b6c9bce89666af42aaaff975c11b70e6116cb3d07e73792a4a3addb09f362ac02dd748fa5ab30047dba5da16af29f20073e141f92aa4e954e2fe6df6f1917bd49a45fab9ac0efbc25fe2da3ae10c09b4b74752b2e40bd8bae09a76a98d5d2a107c796086284a6dacdcd4245b382d6f6e6240da312f3b926cdfe84a86a2c1edde58ccd6dceb1041a63d6b3c96e86d565eb076c5792b23dba63750365a97692da57b65c105aba6154b59844d86fc0ca550155957cee865d3869d56374172417474a82ad28b4efb1c2c34cff6b224c0f2086c9525d37aabd5618d5d8897ad058658b1e3860632fbb9cf7ef85ca24516b57dcdb8fd730a66a66cdda7c775006d16d3848cb1be885c88f615caac80f5311f98f8bfd561d1aa384d9f249eb9db6fbc3af7057f346a91e48028bebdc2d2fd9b775ba6fbf6c781426e9b83b2decb9cfc6d653acdd99329e1f8d0a3872d73668585be68f1052158438aae064cb4951067fd0bab0fc345ec727bc79b1ad616c2d72fc6e4c454cfa554fa027481538b7b6badd9f7c7b6fe18965d3e463b4fd4166d195293e6503133d91d9e2a9a6e87eb4857e3b439d87bdb620a5e9cdf4279aa40c5025b944c3545be4734519e109f38632c9f3314e0b2d248b460c5a6ac240d13e71df355d7d96eb813d54ee388d9901edb02842c06fad913a86d1d51ffc736f3bf9201a932e0c6bfc4afce356d4cbb2cf417e7450676df4b290860fc39a59baab0c2b7660c5cee61b208d9ca3bf6ff9b79c1f1f98f3a750c1c66ec172eecfce8d5cf4de65dcd4f8308d28700d5d62287747ceb4243900434872978bbf474caf6ac36f1bb30627571c73fce6e0c03504ac21c11ad4da3dda13074de8070e53de08d17f6123248cfbebd61b2e81860208b3ca6545a4b66d799ff094e60c9a3efdff3facfb1d2add1992efaefc33a0fb7ce86ff0f4fdda261b55e2a63fcbc48e4d44f4dc77977c851622845eff5b9ba62994418310e024f325../../../../usr/sbin/nameif../../../../usr/sbin/arp../../../../usr/sbin/mii-diag../../../../usr/sbin/ifconfig../../../../usr/sbin/ipmaddr../../../../usr/sbin/plipconfig../../../../usr/sbin/iptunnel../../../../usr/sbin/ether-wake../../../../usr/sbin/slattach../../../../usr/sbin/route../../../../usr/bin/netstat../../../../usr/sbin/mii-tool�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnet-tools-2.0-0.52.20160912git.el8.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������net-toolsnet-tools(x86-64)@@@@@@@



@/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)�x�������������8%����X�,$�
`n����a���������$m����������������������� mode
    resolves: rhbz#1259039
  - realtime: added check for isolcpus sanity
    resolves: rhbz#1264128
  - pm_qos: fixed exception if PM_QoS is not available
    resolves: rhbz#1296137
  - plugin_sysctl: reapply system sysctl after Tuned sysctl are applied
    resolves: rhbz#1302953
  - atomic: increase number of inotify watches
    resolves: rhbz#1322001
  - realtime-virtual-host/guest: added rcu_nocbs kernel boot parameter
    resolves: rhbz#1334479
  - realtime: fixed kernel.sched_rt_runtime_us to be -1
    resolves: rhbz#1346715
  - tuned-adm: fixed detection of no_daemon mode
    resolves: rhbz#1351536
  - plugin_base: correctly strip assignment modifiers even if not used
    resolves: rhbz#1353142
  - plugin_disk: try to workaround embedded '/' in device names
    related: rhbz#1353142
  - sap-hana: explicitly setting kernel.numa_balancing = 0 for better performance
    resolves: rhbz#1355768
  - switched to polkit authorization
    resolves: rhbz#1095142
  - plugins: added scsi_host plugin
    resolves: rhbz#1246992
  - spec: fixed conditional support for grub2 to work with selinux
    resolves: rhbz#1351937
  - gui: added tuned icon and desktop file
    resolves: rhbz#1356369- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- new-release
  - plugin_cpu: do not show error if cpupower or x86_energy_perf_policy are missing
  - plugin_sysctl: fixed quoting of sysctl values
    resolves: rhbz#1254538
  - tuned-adm: added log file location hint to verify command output
  - libexec: fixed listdir and isdir in defirqaffinity.py
    resolves: rhbz#1252160
  - plugin_cpu: save and restore only intel pstate attributes that were changed
    resolves: rhbz#1252156
  - functions: fixed sysfs save to work with options
    resolves: rhbz#1251507
  - plugins: added scsi_host plugin
  - tuned-adm: fixed restart attempt if tuned is not running
  - spec: fixed post scriptlet to work without grub
    resolves: rhbz#1265654
  - tuned-profiles-nfv: fix find-lapictscdeadline-optimal.sh for CPUS where ns > 6500
    resolves: rhbz#1267284
  - functions: fixed restore_logs_syncing to preserve SELinux context on rsyslog.conf
    resolves: rhbz#1268901
  - realtime: set unboud workqueues cpumask
    resolves: rhbz#1259043
  - spec: correctly remove tuned footprint from /etc/default/grub
    resolves: rhbz#1268845
  - gui: fixed creation of new profile
    resolves: rhbz#1274609
  - profiles: removed nohz_full from the realtime profile
    resolves: rhbz#1274486
  - profiles: Added nohz_full and nohz=on to realtime guest/host profiles
    resolves: rhbz#1274445
  - profiles: fixed lapic_timer_adv_ns cache
    resolves: rhbz#1259452
  - plugin_sysctl: pass verification even if the option doesn't exist
    related: rhbz#1252153
  - added support for 'summary' and 'description' of profiles,
    extended D-Bus API for Cockpit
    related: rhbz#1228356- packaging fixes for rpm-4.12.90
- dropped qemu-kvm-tools-rhev requirement (not in Fedora)- new-release
  related: rhbz#1155052
  - plugin_scheduler: work with nohz_full
    resolves: rhbz#1247184
  - fixed realtime-virtual-guest/host profiles packaged twice
    resolves: rhbz#1249028
  - fixed requirements of realtime and nfv profiles
  - fixed tuned-gui not starting
  - various other minor fixes- new-release
  resolves: rhbz#1155052
  - add support for ethtool -C to tuned network plugin
    resolves: rhbz#1152539
  - add support for ethtool -K to tuned network plugin
    resolves: rhbz#1152541
  - add support for calculation of values for the kernel command line
    resolves: rhbz#1191595
  - no error output if there is no hdparm installed
    resolves: rhbz#1191775
  - do not run hdparm on hotplug events if there is no hdparm tuning
    resolves: rhbz#1193682
  - add oracle tuned profile
    resolves: rhbz#1196298
  - fix bash completions for tuned-adm
    resolves: rhbz#1207668
  - add glob support to tuned sysfs plugin
    resolves: rhbz#1212831
  - add tuned-ad�x������������������X�Z%�
�{������ ����|d�$l����������������|d}d{d��x�������������(����X��$�
Ћ����������6X�$&����������������6X5X7X��I��I��I�z�I�@Iܑ�I��I�y�I��@I�a�I��@I���I��@I�U@I��I��I��Ix_�Iw@Iu��Im�Il�@IcG�IFF�I?�@I:i@I7�@I5#@I3�I1.�Is�I"@I-�I9@I	��IP@IP@I��I�@Ig@H�r�H�~@H�f@H�f@H�Y�H�@H�e@H��H��H�|@H��@H�o�H�)�H��H��@H�@�H���H�@H�@H�@Ht�@HsV�HsV�Hkm�Hkm�Hj@Hh�H`�H_�@HVU�HQ�HQ�HO�@H-w@H-w@H(1@H(1@H!��H!��H�@H�@G��@G�@G߮�G��@G��G��G�D@G�O�G�[@G�@G�}�G�}�G�,@G�,@G�,@G��G��G��@G��@G�Z@G��G�e�Gx�Gx�Gk��GjY@Gi�Gi�Gbp@G^{�G]*@GR�@GAz�GAz�GAz�GAz�G=�@G=�@G<4�G2�@G/�G/�G+@G)��G(n@G�@G�@GJ�G��GV@GV@GV@G@G�@G'@G2�G2�G2�F��F��@F�I�F���F���F�F�F�w�F�&@F�@F�1�F��Fޚ@F��F��F�@F�@FҼ�F��F��@F�v�F�v�Fɂ@F�u�F��@F��@F�;@F��F��@F���F�i@F��@F�@F{��Fzh@Fo�@Fo�@Fm9@Fm9@Fc��Fc��F`
@FN�FLC�F; @F7+�F5�@F/B�F/B�F-�@F-�@F(�@F&@F&@F&@F&@F$��F#e@F �@Fp�F@F�F*�F*�FA�F��F�@F�@F�@E�{@E�@�E�@�E�@E�@E��E��@E݅�E݅�E��E��E��E�K@E�V�Eɿ@E��@E�J@E�J@E�J@E��E��@E��@E�x@E���E���E���E�=�E��@E���E�I@E�%�E��@E���EyS�Ex@Ev��Ep@Emv@Emv@Emv@El$�El$�Ef�Ed;�Ea��Ea��E]�@E\R�E\R�E[@E[@E[@E[@EY��EY��ES@EO#�E*9�E&E@E
�E~�E~�E~�E�@E	D@E	D@E�E�EO�E[@E	�D��@D��@D� �D� �D��@D��@D��@D��@D�D��D��@DГ�DГ�D�B@DȪ�D���D��@D�{�D�{�D�A@D�X@D��@D�4�D��@D���D��@D���D�W@D���D��D��D|3�Dv�DtJ�DtJ�Dr�@Do�Dhm@Dhm@Dhm@Da�D_2�D]�@DY�DGw�DC�@D?��D5�D5�D3�@D*v�D)%@D�D�D�D�D�@D��D��D��Dj@Dj@D$@D/�C��@C���C��@C�t�C�@C�C�C�C�E�C��@C��C�@C�h@C�h@C�h@C�h@C�@C�@C�@C�-�C�-�C�-�C��@C��C��Cǖ@Cá�Cá�C�
@C�
@C���C��C�,�C�8@C��C��@C��@C��@C���C�	@C�q�C�q�C� @C��C��C�}@C�+�C��@C��C��@C�B�C��@C|p�C{@Cx|@Ct��Cq�Cq�Cp�@Cp�@CoA�C^@C^@CW��CT�CT�CP�@CO��CNL@CL��CJW�CFc@CE�CC�@C:��C:��C1K@C/��C)b@C&�@C%m�C��C�@C@C@C
��C�C	�@C&�B�T�B��B�w@Bۙ�B�@B@B��B�]@B��@B��@B��B��B��@B���Br!�B^[@B]	�BZf�BZf�BU �BS�@B9q@B6�@B06�B.�@B-��B$Y@B#�B@B@B��Bp@B�B�@B*@B�@B�@B�@B�@BL�BL�B	�@B��BX@B��B��A��A�)@A�)@A��A��@A��A��A��A�@A�n@A�3�A�3�A�3�AҜ@Aƾ�A���A��@A��Ax�@Ax�@Ak�@A]F�A]F�AT@AR��AP�A@E�A3�A,@A,@A,@A+-�A+-�A)�@A(��A ��A[�A��A,�A�A�@@�	@@���@��@@�7@@�7@@�@@�@@��@��@@�p�@�@@��@@��@��@@��@@�5@@�5@@��@@���@�c@@�n�@�n�@�z@@��@@���@�b@@z��@u>�@mU�@l@@h�@h�@h�@h�@d@@b�@`&�@Y�@@Y�@@Y�@@X=�@X=�@X=�@X=�@X=�@U��@U��@U��@O@@M��@M��@Hk�@=�@=�@=�@;<�@4�@@,�@@��@�@@�@@R�?��?��@?��?�D@?��@?��@?z��?q�@?a�@?a�@?2?@?2?@?2?@?/�@>�<@Vit Mojzis <vmojzis@redhat.com> - 2.9-26Vit Mojzis <vmojzis@redhat.com> - 2.9-25Vit Mojzis <vmojzis@redhat.com> - 2.9-24Vit Mojzis <vmojzis@redhat.com> - 2.9-23Vit Mojzis <vmojzis@redhat.com> - 2.9-22Vit Mojzis <vmojzis@redhat.com> - 2.9-21.1Vit Mojzis <vmojzis@redhat.com> - 2.9-20Vit Mojzis <vmojzis@redhat.com> - 2.9-19Vit Mojzis <vmojzis@redhat.com> - 2.9-18Petr Lautrbach <plautrba@redhat.com> - 2.9-17Vit Mojzis <vmojzis@redhat.com> - 2.9-16Vit Mojzis <vmojzis@redhat.com> - 2.9-15Vit Mojzis <vmojzis@redhat.com> - 2.9-14Vit Mojzis <vmojzis@redhat.com> - 2.9-13Petr Lautrbach <plautrba@redhat.com> - 2.9-12Vit Mojzis <vmojzis@redhat.com> - 2.9-11Vit Mojzis <vmojzis@redhat.com> - 2.9-10Vit Mojzis <vmojzis@redhat.com> - 2.9-9Vit Mojzis <vmojzis@redhat.com> - 2.9-8Petr Lautrbach <plautrba@redhat.com> - 2.9-7Petr Lautrbach <plautrba@redhat.com> - 2.9-6Vit Mojzis <vmojzis@redhat.com> - 2.9-5Petr Lautrbach <plautrba@redhat.com> - 2.9-4Vit Mojzis <vmojzis@redhat.com> - 2.9-3Petr Lautrbach <plautrba@redhat.com> - 2.9-2Petr Lautrbach <plautrba@redhat.com> - 2.9-1Petr Lautrbach <plautrba@redhat.com> - 2.8-16.1Petr Lautrbach <plautrba@redhat.com> - 2.8-15Petr Lautrbach <plautrba@redhat.com> - 2.8-14Petr Lautrbach <plautrba@redhat.com> - 2.8-13Petr Lautrbach <plautrba@redhat.com> - 2.8-12Petr Lautrbach <plautrba@redhat.com> - 2.8-11.1Petr Lautrbach <plautrba@redhat.com> - 2.8-10Petr Lautrbach <plautrba@redhat.com> - 2.8-9Petr Lautrbach <plautrba@redhat.com> - 2.8-8Petr Lautrbach <plautrba@redhat.com> - 2.8-7Petr Lautrbach <plautrba@redhat.com> - 2.8-6.1Petr Lautrbach <plautrba@redhat.com> - 2.8-5Petr Lautrbach <plautrba@redhat.com> - 2.�x�������������������X��%�
�������������!�$�����������������!�!�!�- update Archive::Tar to 1.38- 462444 update Test::Simple to 0.80- move libnet to the right directory, along Net/Config.pm- do not create directory .../%{version}/auto- 457867 remove required IPC::Run from CPANPLUS - needed only by win32
- 457771 add path- CGI.pm bug in exists() on tied param hash (#457085)
- move the enc2xs templates (../Encode/*.e2x) to -devel, (#456534)- 455933 update to CGI-3.38
- fix fuzz problems (patch6)
- 217833 pos() function handle unicode characters correct- rebuild for new db4 4.7- remove db4 require, it is handled automatically- 453646 use -DPERL_USE_SAFE_PUTENV. Without fail some modules f.e. readline.- 451078 update Test::Harness to 3.12 for more testing. Removed verbose 
test, new Test::Harness has possibly verbose output, but updated package
has a lot of features f.e. TAP::Harness. Carefully watched all new bugs 
related to tests!- bump the release number, so that it is not smaller than in F-9- CVE-2008-2827 perl: insecure use of chmod in rmtree- 447371 wrong access permission rt49003- make config parameter list consistent for 32bit and 64bit platforms,
  add config option -Dinc_version_list=none (#448735)
- use perl_archname consistently
- cleanup of usage of *_lib macros in %install- 449577 rebuild for FTBFS- 448392 upstream fix for assertion- sparc64 breaks with the rpath hack patch applied- 447142 upgrade CGI to 3.37 (this actually happened in -21 in rawhide.)- sparc64 fails two tests under mysterious circumstances. we need to get the
  rest of the tree moving, so we temporarily disable the tests on that arch.- create the vendor_perl/%{perl_version}/%{perl_archname}/auto directory 
  in %{_libdir} so we own it properly- fix CPANPLUS-Dist-Build Provides/Obsoletes (bz 437615)
- bump version on Module-CoreList subpackage- forgot to create the auto directory for multilib vendor_perl dirs- own multilib vendor_perl directories
- mark Module::CoreList patch in patchlevel.h- 437817: RFE: Upgrade Module::CoreList to 2.14- xsubpp now lives in perl-devel instead of perl.- back out Archive::Extract patch, causing odd test failure- add missing lzma test file- conditionalize multilib patch report in patchlevel.h
- Update Archive::Extract to 0.26
- Update Module::Load::Conditional to 0.24- only do it once, and do it for all our patches- note 32891 in patchlevel.h- get rid of bad conflicts on perl-File-Temp- use /usr/local for sitelib/sitearch dirs
- patch 32891 for significant performance improvement- Add perl-File-Temp provides/obsoletes/conflicts (#433836),
  reported by Bill McGonigle <bill@bfccomputing.com>
- escape the macros in Jan 30 entry- Autorebuild for GCC 4.3- disable some futime tests in t/io/fs.t because they started failing on x86_64
  in the Fedora builders, and no one can figure out why. :/- create %{_prefix}/lib/perl5/vendor_perl/%{perl_version}/auto and own it
  in base perl (resolves bugzilla 214580)- Update Sys::Syslog to 0.24, to fix test failures- add some BR for tests- 5.10.0 final
- clear out all the unnecessary patches (down to 8 patches!)
- get rid of super perl debugging mode
- add new subpackages- first attempt at building 5.10.0�x������������������X��%�
�������������V�$����������������VVZ��Lh�K�do) [1651752]
- [block] virtio-blk: Consider virtio_max_dma_size() for maximum segment size (Philipp Rudo) [1651752]
- [virtio] virtio: Introduce virtio_max_dma_size() (Philipp Rudo) [1651752]
- [kernel] dma: Introduce dma_max_mapping_size() (Philipp Rudo) [1651752]
- [kernel] swiotlb: Add is_swiotlb_active() function (Philipp Rudo) [1651752]
- [kernel] swiotlb: Introduce swiotlb_max_mapping_size() (Philipp Rudo) [1651752]
- [mm] x86/mm: Create a workarea in the kernel for SME early encryption (Lianbo Jiang) [1564427]
- [x86] x86/mm: Identify the end of the kernel area to be reserved (Lianbo Jiang) [1564427]
- [x86] x86/kdump: Export the SME mask to vmcoreinfo (Lianbo Jiang) [1564427]
- [fs] proc/vmcore: Fix i386 build error of missing copy_oldmem_page_encrypted() (Lianbo Jiang) [1564427]
- [fs] kdump, proc/vmcore: Enable kdumping encrypted memory with SME enabled (Lianbo Jiang) [1564427]
- [iommu] iommu/amd: Remap the IOMMU device table with the memory encryption mask for kdump (Lianbo Jiang) [1564427]
- [kernel] kexec: Allocate decrypted control pages for kdump if SME is enabled (Lianbo Jiang) [1564427]
- [mm] x86/ioremap: Add an ioremap_encrypted() helper (Lianbo Jiang) [1564427]
- [documentation] Documentation: Add ARM64 to kernel-parameters.rst (Jeremy Linton) [1640855]
- [arm64] arm64/speculation: Support 'mitigations=' cmdline option (Jeremy Linton) [1640855]
- [arm64] arm64: ssbs: Don't treat CPUs with SSBS as unaffected by SSB (Jeremy Linton) [1640855]
- [arm64] arm64: enable generic CPU vulnerabilites support (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for speculative store bypass (Jeremy Linton) [1640855]
- [arm64] arm64: Always enable ssb vulnerability detection (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for spectre-v2 (Jeremy Linton) [1640855]
- [arm64] arm64: Always enable spectre-v2 vulnerability detection (Jeremy Linton) [1640855]
- [arm64] arm64: Use firmware to detect CPUs that are not affected by Spectre-v2 (Jeremy Linton) [1640855]
- [arm64] arm64: Advertise mitigation of Spectre-v2, or lack thereof (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for meltdown (Jeremy Linton) [1640855]
- [arm64] arm64: Add sysfs vulnerability show for spectre-v1 (Jeremy Linton) [1640855]
- [arm64] arm64: Provide a command line to disable spectre_v2 mitigation (Jeremy Linton) [1640855]
- [documentation] powerpc/fsl: Add FSL_PPC_BOOK3E as supported arch for nospectre_v2 boot arg (Jeremy Linton) [1640855]
- [documentation] Documentation: Document arm64 kpti control (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Whitelist HiSilicon Taishan v110 CPUs (Jeremy Linton) [1640855]
- [arm64] arm64: Add MIDR encoding for HiSilicon Taishan CPUs (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Whitelist Cortex-A CPUs that don't implement the CSV3 field (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Update arm64_kernel_use_ng_mappings() when forced on (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Avoid rewriting early page tables when KASLR is enabled (Jeremy Linton) [1640855]
- [arm64] arm64: capabilities: Merge duplicate Cavium erratum entries (Jeremy Linton) [1640855]
- [arm64] arm64: capabilities: Merge entries for ARM64_WORKAROUND_CLEAN_CACHE (Jeremy Linton) [1640855]
- [arm64] arm64: Use a raw spinlock in __install_bp_hardening_cb() (Jeremy Linton) [1640855]
- [arm64] arm64: KVM: Guests can skip __install_bp_hardening_cb()s H�x�������������������X��%�
`n���P����1��$!����������������1�2�0��ion- Do not distribute File::Spec::VMS (bug #973713)
- Remove bundled CPANPLUS-Dist-Build (bug #973041)- Update SystemTap scripts to recognize new phase__change marker and new probe
  arguments (bug #971094)
- Update h2ph(1) documentation (bug #948538)
- Update pod2html(1) documentation (bug #948538)
- Do not double-own archlib directory (bug #894195)- Move CPANPLUS-Dist-Build files from perl-CPANPLUS
- Move CPAN-Meta-Requirements files from CPAN-Meta
- Add perl-Scalar-List-Utils to perl-core dependencies- Require $Config{libs} providers (bug #905482)- Correct typo in perl-Storable file list (bug #966865)
- Remove bundled Storable (bug #966865)- Sub-package Storable (bug #966865)- Use lib64 directories on aarch64 architecture (bug #961900)- Make regular expression engine safe in a signal handler (bug #849703)
- Remove bundled ExtUtils-ParseXS, and Time-HiRes- Sub-package Time-HiRes (bug #957048)
- Remove bundled Getopt-Long, Locale-Maketext, and Sys-Syslog- Fix leaking tied hashes (bug #859910)
- Fix dead lock in PerlIO after fork from thread (bug #947444)
- Add proper conflicts to perl-Getopt-Long, perl-Locale-Maketext, and
  perl-Sys-Syslog- Sub-package Sys-Syslog (bug #950057)- Sub-package Getopt-Long (bug #948855)
- Sub-package Locale-Maketext (bug #948974)- Remove bundled constant, DB_File, Digest-MD5, Env, Exporter, File-Path,
  File-Temp, Module-Load, Log-Message-Simple, Pod-Simple, Test-Harness,
  Text-ParseWords- Filter provides from *.pl files (bug #924938)- Conflict perl-autodie with older perl (bug #911226)
- Sub-package Env (bug #924619)
- Sub-package Exporter (bug #924645)
- Sub-package File-Path (bug #924782)
- Sub-package File-Temp (bug #924822)- Sub-package constant (bug #924169)
- Sub-package DB_File (bug #924351)- Correct perl-Digest-MD5 dependencies
- Remove bundled Archive-Extract, File-Fetch, HTTP-Tiny,
  Module-Load-Conditional, Time-Local- Correct dependencies of perl-HTTP-Tiny
- Sub-package Time-Local (bug #922054)- 5.16.3 bump (see <http://search.cpan.org/dist/perl-5.16.3/pod/perldelta.pod>
  for release notes)
- Remove bundled autodie, B-Lint, CPANPLUS, Encode, File-CheckTree, IPC-Cmd,
  Params-Check, Text-Soundex, Thread-Queue- Fix CVE-2013-1667 (DoS in rehashing code) (bug #918008)- Sub-package autodie (bug #911226)
- Add NAME headings to CPAN modules (bug #908113)- Fix perl-Encode-devel dependency declaration- Sub-package Thread-Queue (bug #911062)- Sub-package File-CheckTree (bug #909144)
- Sub-package Text-ParseWords
- Sub-package Encode (bug #859149)- Remove bundled Log-Message
- Remove bundled Term-UI- Correct perl-podlators dependencies
- Obsolete perl-ExtUtils-Typemaps by perl-ExtUtils-ParseXS (bug #891952)- Sub-package Pod-Checker and Pod-Usage (bugs #907546, #907550)- Remove bundled PathTools- Sub-package B-Lint (bug #906015)- Sub-package Text-Soundex (bug #905889)
- Fix conflict declaration at perl-Pod-LaTeX (bug #904085)
- Remove bundled Module-Pluggable (bug #903624)- Run-require POD convertors by Module-Build and ExtUtils-MakeMaker to
  generate documentation when building other packages- Sub-package Pod-LaTeX (bug #904085)- Remove bundled Pod-Parser- Fix CVE-2012-6329 (misparsing of maketext strings) (bug #884354)- Do not package App::Cpan(3pm) to perl-Test-Harness (bug #893768)- Remove bundled Archive-Tar
- Remove bundled CPAN-Meta-YAML
- Remove bundled Module-Metadata- Remove bundled Filter modules- 5.16.2 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)- Remove bundled podlators (bug #856516)- Do not crash when vivifying $| (bug #865296)- Conflict perl-podlators with perl before sub-packaging (bug #856516)- Do not leak with attribute on my variable (bug #858966)
- Allow operator after numeric keyword argument (bug #859328)
- Extend stack in File::Glob::glob (bug #859332)- Put perl-podlators into perl-core list (bug #856516)- Remove bundled perl-ExtUtils-Manifest
- perl-PathTools uses Carp- Override the Pod::Simple::parse_file to set output to STDOUT by default
  (b�x������������������X��%�
�����q�����$X��������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������������������������������������������������������������������������������bebebgbgcacacscsdadadedeelelen@boldquoten@boldquoten@quoten@quoteoeseseteteufififrfrgaglglhrhuididititjajakokonbnbnlnlnnnnpaplplptptptptrororuruskskslslsrsrsvsvtrtrukukvivizhzhzhzhzh0.19.8.1-17.el80.19.8.1-17.el8	


         !!!!!!"##$$%%&&''(())**++,--../00112334566778899::;;<<=>>??@@AABBCCDDEEFFGGHHIIJJKLLMMMMMMMMMMMMMMMMMMMMenvsubstgettextgettext.shmsgattribmsgcatmsgcmpmsgcommmsgconvmsgenmsgexecmsgfiltermsgfmtmsggrepmsginitmsgmergemsgunfmtmsguniqngettextrecode-sr-latinxgettext.build-id041a454fb24bb87f4a680a9e44e4210f7aff9b30076deb60a2f2af66db58bc601bafe5745115b9fe72c98b0f3d47f44fd5e5360553af0301a899e913a25f4d93acfe31e6de5bce53ec18b4e4d1c9ba1b2939ffbcd5d3cbc720b8185126b8c52bf8d167245354ef87a746eb3951f578a1e74ce4a5ca73bc2b77967f6069c312b906edcd699b8e115de3a5d12e4e511446305fac8274d5928a72d82fd53e3285329c3c540de0f517c3b2b225395228963f1f1874c1394bd094b3d348d5c499c7e0a469c30d254b3f5368b93c48850b3784102c00e29ef0bd8bb9e24228317a64d4bb4e1b6f0cc92871d721acb06a3e4478e1c8a7aab31a8c380ff33b1d0e6acb9730384ea2eb1b5eafd4590247827e9bee85b22ecc2f3d53f8dfae4a9ac79e2becec15072a7fa74191eac46d7ac15733fdf04b4463c0468b684acdc39a7e737e9ab2694d74d7806909a3870baeb6eae6ec032984c3b7489b9214a19a5004c01c72d6305e44af458f493b78bb8c2a6c9ec3871bb0f664c3bb01c128c5e7f6997f3c09f1a6c06e7250b74015b5361179cf985a1ded20cf35f4d74d8e2ab1e09449881623f6572773f4194d29b93fadc7d1bb88c4300fd721gettextcldr-pluralshostnameproject-idurlgetuser-emailgettextAUTHORSBUGSCOPYINGCOPYING.LIBDISCLAIMNEWSREADMETHANKSenvsubst.1.htmlgettext.1.htmlngettext.1.htmlgettextgettext-0.19.8itsappdata.itsappdata.locglade.locglade1.itsglade2.itsgsettings.itsgsettings.locgtkbuilder.itsABOUT-NLSitspoMakefile.in.inMakevars.templateRules-quotboldquot.seden@boldquot.headeren@quot.headerinsert-header.sinqu�x�������������������X��$�
���������������$l��������������������CRYPTSETUP_2.0)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@@



@/sbin/ldconfig/sbin/ldconfiglibblkid.so.1()(64bit)libblkid.so.1(BLKID_2.15)(64bit)libblkid.so.1(BLKID_2.17)(64bit)libblkid.so.1(BLKID_2.21)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdevmapper.so.1.02()(64bit)libdevmapper.so.1.02(Base)(64bit)libdevmapper.so.1.02(DM_1_02_97)(64bit)libjson-c.so.4()(64bit)libjson-c.so.4(JSONC_0.14)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libssl.so.1.1()(64bit)libuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3d�D@d� �c�S@c��@cd��bs@a�N�`-@`�@_G�@^ϧ�^�%@]҇�]i�]UI@]�@\�-@\�|�\�[m~@[j�@Z�K@Z�2@Z��@Ondrej Kozina <okozina@redhat.com> - 2.3.7-7Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-6Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-5Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-4Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-3Ondrej Kozina <okozina@redhat.com> - 2.3.7-2Ondrej Kozina <okozina@redhat.com> - 2.3.7-1Ondrej Kozina <okozina@redhat.com> - 2.3.3-4Ondrej Kozina <okozina@redhat.com> - 2.3.3-3Ondrej Kozina <okozina@redhat.com> - 2.3.3-2Ondrej Kozina <okozina@redhat.com> - 2.3.3-1Ondrej Kozina <okozina@redhat.com> - 2.3.1-1Ondrej Kozina <okozina@redhat.com> - 2.2.2-1Ondrej Kozina <okozina@redhat.com> - 2.2.0-2Ondrej Kozina <okozina@redhat.com> - 2.2.0-1Ondrej Kozina <okozina@redhat.com> - 2.2.0-0.2Ondrej Kozina <okozina@redhat.com> - 2.2.0-0.1Milan Broz <mbroz@redhat.com> - 2.0.6-2Ondrej Kozina <okozina@redhat.com> - 2.0.6-1Ondrej Kozina <okozina@redhat.com> - 2.0.4-2Ondrej Kozina <okozina@redhat.com> - 2.0.4-1Ondrej Kozina <okozina@redhat.com> - 2.0.3-1Björn Esser <besser82@fedoraproject.org> - 2.0.2-2Milan Broz <gmazyland@gmail.com> - 2.0.2-1- Rebuild due to missing CI environment
- Resolves: #2212772 #2193342- patch: Delegate FIPS mode detection to configured crypto backend
- patch: Disallow use of internal kenrel crypto driver names in "capi"
- patch: Also disallow active devices with internal kernel names
- patch: Fix init_by_name to allow unknown cipher format in dm-crypt
- patch: Fix reencryption to fail properly for unknown cipher
- patch: Fix activation of LUKS2 with capi format cipher and kernel
- Resolves: #2212772 #2193342- change cryptsetup-devel dependency from cryptsetup to cryptsetup-libs
- Resolves: #2150254- patch: Remove LUKS2 encryption data size restriction.
- patch: Abort encryption when header and data devices are same.
- Resolves: #2150254- patch: Fix internal crypt segment compare routine
- Resolves: #2110810- patch: Fix cryptsetup --test-passphrase when device in
  reencryption
- Resolves: #2058009- update to cryptsetup 2.3.7
- fixes CVE-2021-4122
- patch: Fix suboptimal optimization in bundled argon2.
- patch: Fix bogus memory allocation/device read with
         invalid LUKS2 headers
- patch: Fix typo in luksRepair prompt.
- Resolves: #2021815 #2022301 #2031859- patch: Fix reencryption for custom devices with data segments
  set to use cipher_null.
- Resolves: #1927409- patch: Fix crypto backend to properly handle ECB mode.
- Resolves: #1859091- patch: Fix possible memory corruption in LUKS2 validation
	 code in 32bit library.
- Resolves: #1872294- Update to cryptsetup 2.3.3
- Resolves: #1796826 #1743891 #1785748- Update to cryptsetup 2.3.1
- Resolves: #1796826 #1743891 #1785748- Update to cryptsetup 2.2.2
- LUKS2 reencryption honors activation flags (one time and persistent).
- LUKS2 re�x�������������������X��%�
x����������$[��������������������=4ea2eb1b5eafd4590247827e9bee85b22ecc2f3d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3f5368b93c48850b3784102c00e29ef0bd8bb9e2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6d7ac15733fdf04b4463c0468b684acdc39a7e73, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=84c3b7489b9214a19a5004c01c72d6305e44af45, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c5e7f6997f3c09f1a6c06e7250b74015b5361179, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=13a25f4d93acfe31e6de5bce53ec18b4e4d1c9ba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1b2939ffbcd5d3cbc720b8185126b8c52bf8d167, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=329c3c540de0f517c3b2b225395228963f1f1874, stripped, too many notes (256)ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=076deb60a2f2af66db58bc601bafe5745115b9fe, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f6572773f4194d29b93fadc7d1bb88c4300fd721, stripped, too many notes (256)directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=53f8dfae4a9ac79e2becec15072a7fa74191eac4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4478e1c8a7aab31a8c380ff33b1d0e6acb973038, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4228317a64d4bb4e1b6f0cc92871d721acb06a3e, strippedUTF-8 Unicode textASCII textHTML document, ASCII textXML 1.0 document, ASCII textmakefile script, ASCII textUTF-8 Unicode text, with escape sequencesassembler source, ASCII textGNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (\321\201\320\260\320\274\320\276 \320\265\320\267\320\270\321\206\320\270 \320\262\321\212\320\267 \320\276\321\201\320\275\320\276\320\262\320\260 \320\275\320\260 XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8.1 '                                (only XML based languages)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                              (seulement les langages de la famille XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (XML\245\331\241\274\245\271\244\316\270\300\270\354\244\316\244\337)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (XML \352\270\260\353\260\230 \354\226\270\354\226\264\353\247\214 \354\247\200\354\233\220)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (tylko j\304\231zyki oparte na XML-u)'GNU message catalog (little endia�x�������������p�����X��%�
������������J��$Z����������������J�K�I��3daac36c131dfe1039e38f5e6b782e0dda408473646d485cc9bfda4a8a359ad6437ffc64d21a02b18a8cbfee8f4dc280d6fac3184f669c8b37503ac57abd480ed1f3f92cc731739a60ca1adecd33d40d80c31a8b11a5ad2df01f711d0a23103f690922659bf0a25d4b247f1edb61617dd60690988435839d835d99881bd160620d6a6d06705cbbc42a513d5f9ceea3e6314cd2684a247a8e19526490bd7e47ef00902a425e78e156a08391e4a668daf5d169bba86f2ba7d830248daf003b03a384307a71e240635d14bfe4d0aad1be4482fd168f4116b621698ec7c170bcbe25992bdc488c2b3ebb31e220ce6f3600751af0229d14afbdc12d2acaee4919b62bdcdcbd65361ee06015ac0e9aa1ca49c6276a80c246e9cbc072d9c95a3704f590746a22d97280b296259747356efeae437a1cb985e0bc8b128593480e3e36954d66d7941d76a90954b90428051aba3be631ba5a6e516acd06f2314847f59179aa5f4219b730c9bf269f5c6e615d9acf1ea4e5b1ab2c5c1d82ea8751691eb8a8d7abd2e727635a9db44d37cdf24eec593609a49ed64d643eee6b538844c724bda063ad1b70874d6edf8d44fd95c935f648101c47e4e989a7c09c473df0abe2929842c7490a670482308deec88ceed8b31cd47bd406ac0a6b1fb45476e6b2bb9cbe695eee63d9b2f6d480811c71a96e7f696d6b20a13181018a6cf3fefed34498746ad7b2a9ff787106abb53437944c2c7cfb17b71d38bc3dacaae2b6dbfea230733eec153fcf0aed18d8f5c0ca2f876cba53bf11aa7e1656dcc701ad0b9f38b49cbf6c6faa49067ac891bf3df9faea8110eeda14035b186f47ffa95ba4cec8a60f9f8cb40cd7a7c7f9d67ddbe09f67fd36cf00c3a1ee9ab190bef54f83adb2e5e4452eabd4d449e038154160e9df40d312439b80d657201033cd872fe5c2347d51467fb4db94bdd79d936039d7644335e47e82b0685f10e614f7aa0fc1892062d8239c0357ee52613823527519cab7da4fb18cd651240040db949813c3a8e861afc376adc9b569de953c2bd72008feb5243b2b3fb94f05446b7fd4a30be8d4fc6c24a4a9872c92f78e93896389e547c74ca697f35986583e17e905fdbee6d31aa8f09f4644a9748a51a5ae6baa438a97cf8e1bbc32b7dab1b2c69b6162d0998095087499e9619b39e18f00a206ca57d321c785326a8d360260472517e5d7fc27ad6dd2d03a0d4388e41a4d704fb9f506a387dc05a51c07f51d8106970b9706831e3475fa9f7957f6e78bdd211153fc6546f3c0a10b20ff1c6270692c55ba3f00834bc56ac634c1a4b0a75240ccc1eb087a12d13ba96000f02614783aa16e9ce0f11342ce39309bc3c35a0c16281f865d3c6c2013f050c1a8b570937fdd3e07a75413dd39963c0d0134355df072a678ee4f018af54522aa4ad9250dc6363d99237f93a4c604b99acbb1be4c571309b2da5fbbc713215068590146b04df6f8a5e97e5ea8e87ce3ca78e5d345ad0e334a29ab2f12d9b909d1f8128ef67931fa22520c5cb8b1f0bfbe1b861e6ff29dad471b1fe41327d40299ffa842a73f1a5aea2572933e1e8ddb1966d2fcb264a4b483862a1a7387bba583fb94288d5a81e5a7db2bfdb01331935f46bbb58168ed29e1d77202c84646bb4f202e02df81b173cbbc28cc24e3e7c6cb027ed0c542c831390086256f8caf96d30800fc810e7b032763351cde00d6ea1e36f5d62d6a460dd9149465cb0c2b77fdfd1ebd97a340d3a2a6c40baa79a89be6dc6ec421b2c66d3d3c948c2f1df1e30b1dbd7df466eb53bef87983fa6b86ffb289517b893326285853fe5ce20cd5f6ff877b20b3cb30c830c263edf1798a79c9d89c3c63d2d5b6fa41d60f7eb25022e04cc4410c624ef3aab853ab0389ff81031ddce8639a42c353589909e9c390c5efcb67789ca805e23d059a4efe3f36425a49473d550326c4c8d3f0a4c2174ff658d5ce80d1cc0651fdfcd33c77c49e4412178adb97555ee92e51a7bc9947b4fb554707b09ebc47c0ed16f925027768e6e97bd920e0c1157196498835677f4d02e1f380cfedc3d3054af632cbee993eb761ff53cf718abc4af40a2ad9d723e639b923071a6beecec41d45c0b0b89a613f950f5fbdc4cf22eca4ac042f625abee90e1cf6b7ae973c3cf1f7d49615cbbe99f6dc65ec867ac56a2efadb1e656a6e9d786282b5db8e4eadc00bf200f9e090eb0cc7395853c67d55a7612f2cf659b65b7a600553c057d26835b046da5cb8253f872e31bbca98724bc4f270027f53fbb187f594edf3fe72ca0872883b1980e8d30714785f76836897790c212c0f7aa2803cff9621cd8d6b51da12efeaf42f08b303d5723dcec53f1f028aa7a9585d802192a2cc4c515188d60848e7ce492d8aab34cbd63e322bfc621bfb833195191a8f83dab571535aedbc4b75d6ccd3a2eb7da496c04e2f059f12f5b341c53b7cd7d2b262dbaae19381c079f6aba30e40e17c43cae15f2cfea8eb4be067b13638bdd6e08807e12cb8e46711d9130f1dc82df1546166ff55787d50b3a7322f9ac0cca91195dda8d258b8fc9e90900861e7a403309b300a319510b3b23a84a0e12e239aa6b325c15b1a82977d123c9430f7700b1d9ff7a8e69ad48070cd22b73a597ef6f639888a480408f162b33189834a425370d4a06a76fac3c290638789270bbca6a18957843c6858577d9e0a724b07553f9e289e4c5e4cfbc42bed4336ebcdea259f3baf69c8fd4bd3e88850c32257d695b9d4b1b546994ee63c1147471fac3364f2703cd5dc89a8f03695c92806354135e33b467319f4cb30612af314cf9ff�x������������������X��%�
������P����4��$$����������������4�5�3��
- Fix regular expression matching (RT#130307)- Fix crash in Storable when deserializing malformed code reference
  (RT#68348, RT#130098)
- Fix crash on explicit return from regular expression substitution (RT#130188)
- Tighten dependencies between architecture specific sub-packages to ISA
- Fix assigning split() return values to an array
- Fix const correctness in hv_func.h (bug #1242980)- Tie perl-Errno release to interpreter build because of kernel version check
  (bug #1393421)- Fix crash in "evalbytes S" (RT#129196)
- Fix crash in splice (RT#129164, RT#129166, RT#129167)
- Fix string overrun in Perl_gv_fetchmethod_pvn_flags (RT#129267)
- Fix crash when matching UTF-8 string with non-UTF-8 substrings (RT#129350)
- Fix parsing perl options in shell bang line (RT#129336)
- Fix firstchar bitmap under UTF-8 with prefix optimization (RT#129950)
- Avoid infinite loop in h2xs tool if enum and type have the same name
  (RT130001)
- Fix stack handling when calling chdir without an argument (RT#129130)- perl-core depends on Parse::CPAN::Meta module instead of package name to allow
  upgrading perl-CPAN-Meta to 2.150010 (bug #1370681)- Avoid loading of modules from current directory, CVE-2016-1238, (bug #1360425)- Fix handling \N{} in tr for characters in range 128--255 (RT#128734)- Fix building without perl in the build root
- Own systemtap directories by perl-devel- Fix a crash in lexical scope warnings (RT#128597)- Fix a crash in "Subroutine redefined" warning (RT#128257)- Fix a crash when vivifying a stub in a deleted package (RT#128532)- Do not let XSLoader load relative paths (CVE-2016-6185)- Fix line numbers with perl -x (RT#128508)- Do not crash when inserting a non-stash into a stash (RT#128238)- Do not use unitialized memory in $h{\const} warnings (RT#128189)
- Fix precedence in hv_ename_delete (RT#128086)
- Do not treat %: as a stash (RT#128238)- Fix compiling regular expressions like /\X*(?0)/ (RT#128109)- Do not mangle errno from failed socket calls (RT#128316)- Fix a memory leak when compiling a regular expression with a POSIX class
  (RT#128313)- Remove reflexive dependencies
- Use pregenerated dependencies on bootstrapping
- Specify more build-time dependencies- Stop providing old perl(MODULE_COMPAT_5.22.*)
- Update license tags- 5.24.0 bump (see <http://search.cpan.org/dist/perl-5.24.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages; Update or remove patches- 5.22.2 bump (see <http://search.cpan.org/dist/perl-5.22.2/pod/perldelta.pod>
  for release notes)- Weak perl-Encode-devel dependency on perl-devel to Recommends level
  (bug #1129443)
- Remove perl-ExtUtils-ParseXS dependency on perl-devel (bug #1129443)
- Require perl-devel by perl-ExtUtils-MakeMaker
- Provide MM::maybe_command independently (bug #1129443)
- Replace ExtUtils::MakeMaker dependency with ExtUtils::MM::Utils in IPC::Cmd
  (bug #1129443)
- Remove perl-ExtUtils-Install dependency on perl-devel (bug #1129443)
- Remove perl-ExtUtils-Manifest dependency on perl-devel (bug #1129443)- Do not filter FCGI dependency, CGI is non-core now- Remove bundled perl-IPC-SysV (bug #1308527)- Fix CVE-2016-2381 (ambiguous environment variables handling) (bug #1313702)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Remove bundled Math-BigInt (bug #1277203)- 5.22.1 bump (see <http://search.cpan.org/dist/perl-5.22.1/pod/perldelta.pod>
  for release notes)- Rebuild to utilize perl(:VERSION) dependency symbol- Do not own IO::Socket::IP manual page by perl-IO- Sub-package Attribute-Handlers
- Sub-package Devel-Peek
- Sub-package Devel-SelfStubber
- Sub-package SelfLoader
- Sub-package IO
- Sub-package Errno
- Correct perl-Digest-SHA dependencies
- Correct perl-Pod-Perldoc dependencies
- Move utf8 and dependencies to perl-libs
- Correct perl-devel and perl-CPAN dependencies
- Sub-package IPC-SysV
- Sub-package Test
- Sub-package utilities (splain) into perl-utils
- Provide perl version in perl(:VERSION) dependency symbol- Sub-package Memoize
- Sub-package Net-Ping
- Sub-package �x�������������`o����X��%�
������������u!�$e����������������u!t!v!�z)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3he@c���ama�`�9@_��@_ܙ�_��@\	@[�<@[�]�[CN@[��Z��@ZԐ@Z��@Z}�@Zy��Zs@Zo�Zc/@Z\��ZT��Y��Y��Y��Y���Y|x�Yy�YS�@YG��Y6�@Y0�X�D�X��@X��X��@X��X���X|��Xwo�Xo��XW�X@�X#�X&�W�i�W��@W��W�P�W��W��W~D@W~D@WzO�Wm �Wj}�Wg�Wb��W_�W=��W<Y@W3�W'A@W�@V�@V�x�V��V�=@Vp�Vn�@V&,�V�@V�@Uĝ�U���U��@U��U���U���Ux&�Up=�Un�@UlI@U.R�U/@U/@U�@U
�@U�T�s@T�~�T�-@T��Tܕ�Tи@T�7�T|X@Tl�@Td�@TcK�TP�TH�T&@T�T=@TH�S��S�@S�S׌�S�\�S��S���SF��S>��R�R��@R�a@R�&�R�&�R�@R�v@Rfh�R-�@R
�Q��Q��@Q��Q�@Qک�Q�c�Q��Q��Q�b�Q�@Q�y�Q�?@Q��Q��Q��@Qzl@QeT@Qd�Q^��Q^��QP<@QLG�QJ�@QHS@QC
@QA��Q5�@Q"�Q�Q�Q�@Q�Q�@Q�@Q��Q	@Q	@Q��Qs�P��@P�P�@P�Z�P�Z�P��@P��P~��P`K@P\V�P[@PXb@PS@PPy@PO'�PG>�P7l�P(�@P#�@P#�@P	H@P
�O�@O�O�R�OЗ�O�F@O�F@OȮ�OȮ�O�]@O�t@O���O�~�O��@O�@O� �OC�@O/��O(@O�@O�@N�x�N�N��@N�1�N��@N�=@N�H�N��@N�0�N�S@N�
@N�$@N��@N��@N���N���N��@Ny�Nq�NoE�N\�NG��N;�@N2��N.�@N)f@N%q�N!}@N��Np�N*�N��M�6@M�6@M�6@M��@M���M���M�M�M�M�)�M��M��@M��@M��@M��@MT�M_��MQ0@MA^@M@�M@�M>�@M=i�M�M�L�L�7�L��@L��@L��@L�d�L�@L��@L��@L�{�L�A@L�)@L�)@L�)@L�)@Lk�@LMx�L>�@L9�@L7@L5��L(��L�K��K�.�Kы�KŮ@KŮ@K�"@K�r�K�!@K��@K��@K��@K��Kl@K0��K/c@K+n�K+n�K�@K�@K�@K�@KV�K@K��K�Ję�Ję�J��@J�u@J���J��@Jr�Jn�@Jm��Jj�JW-@JS8�JS8�J,�@J'�@J&e�I�4�I�@@I�@@I̿�I��@I�y�I���I���I�V@I��@I�U@I�U@I�w�I�1�Itk@IO�@IBR@I/�@I*�@Ig@H��H�O@H�f@H�f@H��@Hϟ�H�@H��H�@�H���H�z@Hu��Ht�@Hl�@Hj@Hd�@H`�HO�@HNl�HI&�H:�@H5`@H1k�H.�G߮�G߮�G߮�G߮�G߮�G��G��G��G�.@G�.@G�.@G�.@G�.@G��@G��G�f�G�f�G��G��@G�e�GN��Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-423Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-422Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-421Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-420Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-419Petr Pisar <ppisar@redhat.com> - 4:5.26.3-418Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-417Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-416Petr Pisar <ppisar@redhat.com> - 4:5.26.2-415Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-414Petr Pisar <ppisar@redhat.com> - 4:5.26.2-413Petr Pisar <ppisar@redhat.com> - 4:5.26.2-412Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-411Petr Pisar <ppisar@redhat.com> - 4:5.26.2-410Florian Weimer <fweimer@redhat.com> - 4:5.26.1-409Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.1-408Petr Pisar <ppisar@redhat.com> - 4:5.26.1-407Petr Pisar <ppisar@redhat.com> - 4:5.26.1-406Petr Pisar <ppisar@redhat.com> - 4:5.26.1-405Björn Esser <besser82@fedoraproject.org> - 4:5.26.1-404Petr Pisar <ppisar@redhat.com> - 4:5.26.1-403Petr Pisar <ppisar@redhat.com> - 4:5.26.1-402Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-401Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-400Petr Pisar <ppisar@redhat.com> - 4:5.26.0-399Petr Pisar <ppisar@redhat.com> - 4:5.26.0-398Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.0-397Fedora Release Engineering <releng@fedoraproject.org> - 4:5.26.0-396Petr Pisar <ppisar@redhat.com> - 4:5.26.0-395Petr Pisar <ppisar@redhat.com> - 4:5.26.0-394Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-393Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-392Petr Pisar <ppisar@redhat.com> - 4:5.24.1-391Petr Pisar <ppisar@redhat.com> - 4:5.24.1-390Petr Pisar <ppisar@redhat.com> - 4:5.24.1-389Petr Pisar <ppisar@redhat.com> - 4:5.24.1-388Petr Pisar <ppisar@redhat.com> - 4:5.24.1-387Petr Pisar <ppisar@redhat.com> - 4:5.24.1-386Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.1-385Igor Gnatenko <ignatenko@redhat.com> - 4:5.24.0-384Petr Pisar <ppisar@redhat.com> - 4:5.24.0-383Petr Pisar <ppisar@redhat.com> - 4:5.24.0-382Petr Pisar <ppisar@redhat.com> - 4:5.24.0-381Petr Pisar <ppisar@redhat.com> - 4:5.24.0-380Petr Pisar <ppisar@redhat.com> - 4:5.24.0-379Petr Pisar <ppisar@redhat.com> - 4:5.24.0-378Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-377Petr Pisar <ppisar@redhat.com> - 4:5.24.0-376Petr Pisar �x������P������x^����X'X%�
H�~d�$n����������������~dd}d����1:1.1.1k-14.el8_61:1.1.1k-14.el8_61.1.1k1.1.1k1.1.1k�x�������������PN����X��$�
���������m���a�$q����������������a`b�e release
- fix #1829245 - mount -a tries to mount already mounted cifs shares when we cannot query up to root dir- improve CI tests portability to rhel-8 kernel- add git to BuildRequires due to autosetup -Sgit- fix spec file typo- fix test for #1739443- fix #1739443 - lscpu reports wrong hypervisor in nested virt on s390x
- fix #1743555 - command chfn adds some useless commas with GECOS information into /etc/password- fix error path in mountinfo patch (#1751447)- cleanup mountinfo libmount patch (#1751447)- fix #1751447 - improve /proc/self/mountinfo reliability- fix #1739179 - partx failed on nvme devices with exit code 1- fix #1734553 - blkid_get_dev() leak file descriptor to underlying block device
- fix #1719069 - findmnt warning "recommended root FS passno is 1" for XFS- fix #1732769 - lscpu not showing Physical socket, chips information- fix #1681062 - improve loopdev use in gating tests- fix #1699310 - rpm -V setup fail on /var/log/lastlog
- fix #1702712 - pam_env bypassed for root user when using su- fix #1681062 - implement gating tests- fix #1658206 - improve dependence between subpackages- fix #1656437 - Failing tests from testsuite
- fix #1653781 - unable to umount by loop backing file
- fix #1655650 - RHEL8.0 - fdisk -l shows the conflicting partitions name for the mpath
- fix #1653413 - blkid: add --no-part-details to not return metadata from empty partitions- fix #1624877 - libuuid: name-based UUIDs are not compatible with RFC4122- fix #1614967 - Lslogins doesn't fail with nonexisting username
- cleanup patches list- fix #1614364 - losetup: /dev/loop1: failed to set up loop device
- fix #1614852 - mount man page says sync option has no effect for ext4
- fix #1614843 - Man page of logger is missing -S option- refresh lastlog patch 
- fix #1595882 - wipefs should erase also secondary LUKSv2 header* rebuild to verify build flags- upgrade to v2.32.1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32.1-ReleaseNotes- Build only the python3 bindings- sync spec file with Fedora
- move /etc/adjtime config from initscripts to util-linux
- fix #1560642 - uuidd.service does not start
- remove unused build option --enable-libmount-force-mountinfo (it's default now)
- disable assert code- fix #1560283 - column does not properly handle spaces at beginning of tab-separated table columns- upgrade to v2.32- add BuildRequires gcc- upgrade to v2.32-rc1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for switch to libxcrypt- Fix directory ownership in python subpackage- fix dmesg for multi-line records- upgrade to final v2.31
- move rfkill to sbin (for backward compatibility)- fix build error- upgrade to v2.31-rc2
- enable rfkill- temporary disable rfkill (fix #1494855)- upgrade to v2.31-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.31/v2.31-ReleaseNotes- upgrade to v2.30.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.2-ReleaseNotes- make ln-s usage more robust- fix post install script- fix #1390191 - systemd read-only container produces errors- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- upgrade to v2.30.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.1-ReleaseNotes- upgrade to v2.30- upgrade to v2.30-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30-ReleaseNotes- upgrade to v2.29.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.2-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- upgrade to v2.29.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.1-ReleaseNotes- Rebuild for Python 3.6- upgrade to v2.29- upgrade to v2.29-rc2- upgrade to v2.29-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29-ReleaseNotes- upgrade to stable 2.28.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.2-ReleaseNotes- upgrade to stable 2.28.1
  http://ftp.kernel.org/pub/linux/utils/�x������<���h=����X8�$�
�a������HA������_X�$O����������������_X^X`X�ed patch from Dan Walsh.
        * Merged restorecon verbose output patch from Dan Walsh.
        * Merged setfiles altroot patch from Chris PeBenito.- Don't run load_policy on a non SELinux kernel.- Update to version from NSA
        * Merged context validation patch for genhomedircon from Eric Paris.
- Fix verbose output of restorecon- Update to version from NSA
        * Changed setfiles -c to call set_matchpathcon_flags(3) to
          turn off processing of .homedirs and .local.- Update to released version from NSA
        * Merged rewrite of genhomedircon by Eric Paris.
        * Changed fixfiles to relabel jfs since it now supports security xattrs
          (as of 2.6.11).  Removed reiserfs until 2.6.12 is released with
          fixed support for reiserfs and selinux.- Update to released version from NSA
- Patch genhomedircon to handle passwd in different places.- Fix genhomedircon to not put bad userad error in file_contexts.homedir- Cleanup error reporting* Merged load_policy and genhomedircon patch from Dan Walsh.- Fix genhomedircon to add extr "\n"- Fix genhomedircon to handle blank users- Update to latest from NSA
- Add call to libsepol- Fix genhomedircon to handle root
- Fix fixfiles to better handle file system types- Fix genhomedircon to handle spaces in SELINUXPOLICYTYPE- Update to latest from NSA
        * Merged several fixes from Ulrich Drepper.- Apply Uli patch
        * The Makefiles should use the -Wall option even if compiled in beehive
        * Add -W, too
        * use -Werror when used outside of beehive.  This could also be used unconditionally
        * setfiles/setfiles.c: fix resulting warning
        * restorecon/restorecon.c: Likewise
        * run_init/open_init_pty.c: argc hasn't been checked, the program would crash if
called without parameters.  ignore the return value of nice properly.
        * run_init: don't link with -ldl lutil
        * load_policy: that's the bad bug.  pointer to unsigned int is passed, size_t is
written to.  fails on 64-bit archs
        * sestatus: signed vs unsigned problem
        * newrole: don't link with -ldl- Update to latest from NSA
        * Changed load_policy to fall back to the original policy upon
          an error from sepol_genusers().- Only restorecon on ext[23], reiser and xfs- Update to latest from NSA
        * Merged new genhomedircon script from Dan Walsh.
        * Changed load_policy to call sepol_genusers().- Remove Red Hat rhpl usage
- Add back in original syntax
- Update man page to match new syntax- Fix genhomedircon regular expression
- Fix exclude in restorecon- Trap failure on write
- Rewrite genhomedircon to generate file_context.homedirs
- several passes- Update from NSA
        * Changed relabel Makefile target to use restorecon.- Update from NSA
        * Merged restorecon patch from Dan Walsh.- Update from NSA
        * Merged further change to fixfiles -C from Dan Walsh.
        * Merged updated fixfiles script from Dan Walsh.
- Fix error handling of restorecon- Fix sestatus for longer booleans- More cleanup of fixfiles sed patch
        * Merged further patches for restorecon/setfiles -e and fixfiles -C.- More cleanup of fixfiles sed patch- More cleanup of fixfiles sed patch
- Upgrade to latest from NSA
        * Merged patch for open_init_pty from Manoj Srivastava.- More cleanup of sed patch
- Upgrade to latest from NSA
        * Merged updated fixfiles script from Dan Walsh.
        * Merged updated man page for fixfiles from Dan Walsh and re-added unzipped.
        * Reverted fixfiles patch for file_contexts.local;
          obsoleted by setfiles rewrite.
        * Merged error handling patch for restorecon from Dan Walsh.
        * Merged semi raw mode for open_init_pty helper from Manoj Srivastava.
        * Rewrote setfiles to use matchpathcon and the new interfaces
          exported by libselinux (>= 1.21.5).- Fix fixfiles patch
- Upgrade to latest from NSA
        * Prevent overflow of spec array in setfiles.
- Add diff comparason between file_contexts to f�x��������������,����X��$�
���������������dX�����$t����������������dXcXeX�	


ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=347d9c125ed18fd9bd011e4eb08fd906bbabc7f5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ae7e2784ab0ed6ceab9cd814959316751f043647, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3f996c930d2f96d497a06b94ff3c5e75d372d7a1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e6b8b29beb9a9cc689a1ca6ee006401056c9982, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=72fde2aa98926b7bf93f63e747af9666d4dee9c8, strippeddirectoryPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ee08bf55f4e16f0a193078635793a073d975af04, strippedBourne-Again shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6e359d2b9f27e4085fe8dd88866d17572f4b4544, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=344352788b234c87a220c8f2ee19e03ff36c8834, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e02ff9762ff3506eaed795eea435fe32d18c2da2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b8599377a36e3808e46d82101db19e68ad8a78ba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=619d297b56e297ccb0ef334af02898a844e46d24, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=50cb817d94efdc45a4ce57ee07b7556248356328, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)
�x�����ȔX����XU�$�
 S�W���\X�$L����������������\X[X]X�nges- Add auditing to semanage- Update from upstream
        * Merged clone record on set_con patch from Ivan Gyurdiev.- Update from upstream
        * Merged genhomedircon fix from Dan Walsh.
        * Merged seusers.system patch from Ivan Gyurdiev.
        * Merged improve port/fcontext API patch from Ivan Gyurdiev.
        * Merged genhomedircon patch from Dan Walsh.- Update from upstream
        * Merged newrole audit patch from Steve Grubb.
        * Merged seuser -> seuser local rename patch from Ivan Gyurdiev.
        * Merged semanage and semodule access check patches from Joshua Brindle.- Add a default of /export/home- Cleanup of the patch- Correct handling of symbolic links in restorecon- Added translation support to semanage
- Update from upstream
        * Modified newrole and run_init to use the loginuid when
          supported to obtain the Linux user identity to re-authenticate,
          and to fall back to real uid.  Dropped the use of the SELinux
          user identity, as Linux users are now mapped to SELinux users
          via seusers and the SELinux user identity space is separate.
        * Merged semanage bug fixes from Ivan Gyurdiev.
        * Merged semanage fixes from Russell Coker.
        * Merged chcat.8 and genhomedircon patches from Dan Walsh.- Fix genhomedircon to work on MLS policy- Update to match NSA
        * Merged chcat, semanage, and setsebool patches from Dan Walsh.- Fixes for "add"-"modify" error messages
- Fixes for chcat- Add management of translation file to semaange and seobject- Fix chcat -l -L to work while not root- Update to match NSA
        * Merged semanage fixes from Ivan Gyurdiev.
        * Merged semanage fixes from Russell Coker.
        * Merged chcat, genhomedircon, and semanage diffs from Dan Walsh.- Update chcat to manage user categories also- Add check for root for semanage, genhomedircon- Add ivans patch- Update to match NSA
        * Merged newrole cleanup patch from Steve Grubb.
        * Merged setfiles/restorecon performance patch from Russell Coker.
        * Merged genhomedircon and semanage patches from Dan Walsh.
        * Merged remove add_local/set_local patch from Ivan Gyurdiev.- Fixes for mls policy- Update semanage and split out seobject
- Fix labeleing of home_root- Update to match NSA
        * Added filename to semodule error reporting.- Update to match NSA
        * Merged genhomedircon and semanage patch from Dan Walsh.
        * Changed semodule error reporting to include argv[0].- Update to match NSA
        * Merged semanage getpwnam bug fix from Serge Hallyn (IBM).
        * Merged patch series from Ivan Gyurdiev.
          This includes patches to:
          - cleanup setsebool
          - update setsebool to apply active booleans through libsemanage
          - update semodule to use the new semanage_set_rebuild() interface
          - fix various bugs in semanage
        * Merged patch from Dan Walsh (Red Hat).
          This includes fixes for restorecon, chcat, fixfiles, genhomedircon,
          and semanage.- Fix restorecon to not say it is changing user section when -vv is specified- Fixes for semanage, patch from Ivan and added a test script- Fix getpwnam call- Anaconda fixes- Turn off try catch block to debug anaconda failure- More fixes for chcat- Add try catch for files that may not exists- Remove commands from genhomedircon for installer- Fix genhomedircon to work in installer
- Update to match NSA
        * Merged patch for chcat script from Dan Walsh.- More fixes to chcat- rebuilt- Update to match NSA
        * Merged fix for audit2allow long option list from Dan Walsh.
        * Merged -r option for restorecon (alias for -R) from Dan Walsh.
        * Merged chcat script and man page from Dan Walsh.- Update to match NSA
- Add gfs support- Update to match NSA
- Add chcat to policycoreutils, adding +/- syntax
`- Require new version of libsemanage- Update to match NSA
        * Changed genhomedircon to warn on use of ROLE in homedir_template
          if using �x������������������XI�%�
�������������������$Y��������������������ot.sedremove-potcdate.sinstylespo-default.csspo-emacs-x.csspo-emacs-xterm.csspo-emacs-xterm16.csspo-emacs-xterm256.csspo-vim.cssgettext.info.gzgettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.moenvsubst.1.gzgettext.1.gzgettextize.1.gzmsgattrib.1.gzmsgcat.1.gzmsgcmp.1.gzmsgcomm.1.gzmsgconv.1.gzmsgen.1.gzmsgexec.1.gzmsgfilter.1.gzmsgfmt.1.gzmsggrep.1.gzmsginit.1.gzmsgmerge.1.gzmsgunfmt.1.gzmsguniq.1.gzngettext.1.gzrecode-sr-latin.1.gzxgettext.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/04//usr/lib/.build-id/07//usr/lib/.build-id/13//usr/lib/.build-id/1b//usr/lib/.build-id/24//usr/lib/.build-id/2b//usr/lib/.build-id/2e//usr/lib/.build-id/32//usr/lib/.build-id/3f//usr/lib/.build-id/42//usr/lib/.build-id/44//usr/lib/.build-id/4e//usr/lib/.build-id/53//usr/lib/.build-id/6d//usr/lib/.build-id/7e//usr/lib/.build-id/84//usr/lib/.build-id/8f//usr/lib/.build-id/c5//usr/lib/.build-id/cf//usr/lib/.build-id/f6//usr/lib64//usr/lib64/gettext//usr/share/doc//usr/share/doc/gettext//usr/share//usr/share//usr/share/gettext-0.19.8//usr/share/gettext-0.19.8/its//usr/share/gettext//usr/share/gettext/po//usr/share/gettext/styles//usr/share/info//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en@boldquot/LC_MESSAGES//usr/share/locale/en@quot/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_HK/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-sec�x�������������������X�y%�
��������������0Y�$ ����������������0Y1Y0X��x������������� �����X��%�
XX����������l!�$|����������������l!k!m!�4e8071117daa1462fc00c18a8ee4679c98976dec4e84dd5601df776f9e2e8ebf2e6c30b2c72f681ea9f5a5445c1f68fc00cd8b492a731be5d61b46d5bcbd542a98a556bbeda921171189343d3b89540907c4c16ad7acde7370e2458c83848818e973a5ab895a5f32a9c6835ac08fde1c59e2302c5ba3731ebafa49a7c8b187aa3579c5ad85458dc1d4a69f8f3d385275c551f14e87fc6d4d01b918852f43944746059e08f2f5e7c811906f79743662e4d63ba6f4f9e196eca25b0e03977b03700c72a50c6e67d05301882ba0e229ed1c00dc4722407744290e420f1dae71f59fb1d262003f36dcf41b36f8eac8ccea53562b78eb3d8ee53d51135fd7eb0c9b2b1a998d5a12e37c48b06543c0b0a30b855c91c6cc6f2ed3d29cdc6c8e654a54ae7038f66b6875413dfdb9b7a47fffaff9480ad4e883f97e4654b8df54edc7e0aecd2e4d41172704c12cf192866a6b488af15474f63973d8f1064a77a91b1c33c1a785be5eba71869d55529020360216990274c84dcecef61df6c6685ecff97746427deb37fd0b9846fd2a0813ea78699535120bcb6c92840e9d20977b49e93ab07c16cab1f67198dd0a76ce372a9c9a7ea30c5aaef280e92f64a7d78aa08002fefb3ca633966af7afc32e0c6829fb97d3d4b889a0fe0bcbabcd764e16e7fd37d4f4438a6a475727f3bdb0c0bfcac1dfba2112c52e53db8ba690bbd66378d9f96244acebcee2a568453bec65393aa6ced34cdad76bccb51e85616e8481036622fefcc5505f487cf3d96e1aead216ec5746a1488f1da79c6968353d9b0efd7da7732d2bc3f0c936b427036064dcd4e8295cddde295b05bea95544f63e71e7d19c8b08322d7333685b93948a089c872c003887ea0639af99bfb37a70055c7ed70c95a216497cd206f4ec57039eb39d815f7a2685b587ee3b5345b547682d3abeac1da6495707516cceab022541ced1d3f4264c243312d70ddb5e449743658cdb9e3287620aa69947d1643a0b5f85dbd0c05036e7ca0181d18f06d1833f3ef3b3b1f45b849e242f9b016b50bd1ce87258e1ff5b5d80f15554c6c72e898f56258ccbe67702de4c22b7247fde4e104d1797fa2159b23ca85e4db0a06b705888603798d11ff62a45026ecbb8eb4ccee42f89b5052665959ebcce0bcb342dc876167e26798530373099b7077d2ae2eb88e8ece8dc80f5a9494b542741f1b1eb098a0073a803ef2f7209aa3d6835691f4f70a115dfe3d079b83951eb8b39aafcf5c17c006236c79702c592c7b12b2b1960532beeac06b376980de29e885cb74cd8eea47d3420055c7bc034860fc47ad6ef9207f58b101706718465fcc2201e7452c4d2c0770ec0f1caa0a91e2888512c29119b66cbca86468a2b3fe0a50649d4ac9160a3c2b928bf51ca14c7a9efa9fd698455a9f209da48d6048398a0016ed900db3dfda98e238499d755d98a25bb6e14a7911a8539b5eeb15f14e7509566324e475cfe7923aeda62c940ded47065649e9d182e9fdbeec515166db38bcfc7266bdb3258cdbce7dcc1876bfc922b8b56adbb1c68871299c6d9b5c873cffe7d13f6eead7e91f4a2c5f59d2b7aa1294d4f78299176c84753bc2876070c7678a1327a5054c74dc01ee40f24f1522e5d49ed948ea588bace5df645f90af72ad22f40f17a5c9f8c2588208f872080271ea3ca841f273a891c9bc72a10d9fae6d9016c4b4cca3c8dbb48f762c3f9ec8614b4ebb811db513aee2140ef2d8c485787c98d1e16c4af1084bdc312e75d64afd644146d3312aeba74c35291c286a54d77133c9cf485bdb056003e8081ed4b784274a05e6636ed115c450a71ca7e097a0a0ca718f87a9b14b61f7413d9c11c5da7bf19c00185ec3967092aca6c621e5e120cfbb3362fa6b7a3158a7a96c0089af3a93e203fa18303e6da44bf0d2922b5bd5c5f19f171e4387c8ac4ef009a30e91f6146df197ff662dfc991203285679bb3ff129c2f389d77fa668142af8c821364ae36e231b574f2338895f4187ec48396d64bfe2a00c2257e000042e196cb0dafbc787fbcb8db02a2e012b27de8c6ef3ddf300b57848196855a260a2c9e8897f2158273280fa3bafbade0ca4bef08d345742c57c194f837c2270aa8b5ece4569da7e292dcdcfcfc741e63241085df8fe4532d427fc2ef98c9951ea5a168fe50f09c00fab153d671bb6f6c5e3e93bf4bfe5aa53cd390311fdf280b780a9662ed794cd7d55b52e67565df7b2696f22417d33e662a314b04ff8077ef67b485137c33baab7162269e5b8723bf08a5d597b9d35d6d38616a6c381e56e438bad92ba0ba8fab15005ff67b9ce3bc16b66d531bf042fd43f31d5bb4ba1b8664ceab0dde3f3e5ae7c60f84c58ba6ce2bdecaf9fe803dfb7491487e37ce76609a37e99f89da43544a00633c4e578fd39c102588807709ffea4223b2f2afb8be03ae7a3e856bc954e762f1db761354e6a572bcf60a9d0a7269162591d5a37beec2086e4a60ff53cb9bd0a2f4791af7c6f9eaf72c3598d06fc57479347dec5d080152e2db562d29d65dbe2b6a62e8ba73f1897976fcafc37b57f4c638409b483c8b660a985dfddb9e436ed41627e1f058e0e47f9a96c5cd41b28b5222c466d15cf1cb162fd8b55b36cf25635b77bbcc4c394eaa6a3b35d49547d7936c0cf95da8d5ff968b66cfb9d9f2f00c32afc16fdf4a77da78db810a8c16ec3a1b9f4f85a4b5ad23d5fee6e6424d0c0c7753e69930f48381cdd6aae6b81a099e4fd47d765e1f9fb57cb2f2a3d9a2e3e9968d73fe0de421cdc289a6959f995fe73b07e3e470beda39d24184ff08b9d0977e�x�����ؓ������8�����X��$�
@�����Y�$I����������������YXZ�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������/bin/dmesg/bin/kill/bin/more/bin/mount/bin/umount/sbin/blkid/sbin/blockdev/sbin/findfs/sbin/fsck/sbin/nologinconfig(util-linux)ejectrfkillutil-linuxutil-linux(x86-64)util-linux-ng@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@



@/bin/sh/etc/pam.d/system-authaudit-libsconfig(util-linux)coreutilsld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libaudit.so.1()(64bit)libblkidlibblkid.so.1()(64bit)libblkid.so.1(BLKID_1.0)(64bit)libblkid.so.1(BLKID_2.15)(64bit)libblkid.so.1(BLKID_2.17)(64bit)libblkid.so.1(BLKID_2.18)(64bit)libblkid.so.1(BLKID_2.20)(64bit)libblkid.so.1(BLKID_2.21)(64bit)libblkid.so.1(BLKID_2.23)(64bit)libblkid.so.1(BLKID_2.25)(64bit)libblkid.so.1(BLKID_2.30)(64bit)libblkid.so.1(BLKID_2_31)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.12)(64bit)libc.so.6(GLIBC_2.13)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libc.so.6(GLIBC_2.9)(64bit)libcap-ng.so.0()(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libfdisklibfdisk.so.1()(64bit)libfdisk.so.1(FDISK_2.26)(64bit)libfdisk.so.1(FDISK_2.27)(64bit)libfdisk.so.1(FDISK_2.28)(64bit)libfdisk.so.1(FDISK_2.29)(64bit)libfdisk.so.1(FDISK_2.30)(64bit)libfdisk.so.1(FDISK_2.31)(64bit)libfdisk.so.1(FDISK_2.32)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libmountlibmount.so.1()(64bit)libmount.so.1(MOUNT_2.19)(64bit)libmount.so.1(MOUNT_2.20)(64bit)libmount.so.1(MOUNT_2.21)(64bit)libmount.so.1(MOUNT_2.22)(64bit)libmount.so.1(MOUNT_2.23)(64bit)libmount.so.1(MOUNT_2.24)(64bit)libmount.so.1(MOUNT_2.25)(64bit)libmount.so.1(MOUNT_2.30)(64bit)libmount.so.1(MOUNT_2_37)(64bit)libncursesw.so.6()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libpam_misc.so.0()(64bit)libpam_misc.so.0(LIBPAM_MISC_1.0)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libselinux.so.1()(64bit)libsmartcolslibsmartcols.so.1()(64bit)libsmartcols.so.1(SMARTCOLS_2.25)(64bit)libsmartcols.so.1(SMARTCOLS_2.27)(64bit)libsmartcols.so.1(SMARTCOLS_2.28)(64bit)libsmartcols.so.1(SMARTCOLS_2.29)(64bit)libsmartcols.so.1(SMARTCOLS_2.30)(64bit)libsmartcols.so.1(SMARTCOLS_2.31)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libtinfo.so.6()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)libutempter.so.0()(64bit)libutempter.so.0(UTEMPTER_1.1)(64bit)libutil.so.1()(64bit)libutil.so.1(GLIBC_2.2.5)(64bit)libuuidlibuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)libuuid.so.1(UUID_2.31)(64bit)libz.so.1()(64bit)pamrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1.0.62.32.1-46.el82.32.1-46.el82.32.1-46.el82.32.1-46.el82.32.1-46.el82.32.1-46.el81.1.3-73.0.4-14.6.0-14.0-15�x�����@�������������X�?%�
�������� �����d�$�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������������X�W%�
p���������������d�$o����������������d�d~d�efghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���������x������������������X�%�
@/��������������y�$i����������������yxz�RaRJRIR9R6R;RR$RR!R RR5R	RYRFRDRHRRaRPRIR$RR#RR!R RRHRFRORRaRJRIRR#R$RR!R RRHRRaR6RLRJRIRRR$R!R RRHR5R	RYRFRDRRaRRRRR$RR!R RRRRaR R!RRRaRRRR R!RRQRRaR$RRR!RR RR<R=R7R9R8R;R6R5R	RYRDRFRRaR6R;R!R RR5R	RYRFRDRRaRRR$R!R RRRaRR$RR!R RRFRRaRIRR$RRR!R RRHRRaR R!RRRaR R!RRRaR R!RRRaR RRRaRWRUR#R!RR RRDRVRTRRaRR$RR!R RRRaR R!RRRaRR$RR!R RR&RRaR R!RRRaRRR$RR!R RRQRRaRWRCRARRR#R!R RR@RBRVRRaRR#R$RR!R RRRaR R!RRQRRaRRR!RR RR<R=R7R:R9R8R;R6R5R	RYRFRDRRaRR$R!R RRRaRR!R RRRaR R!RR[RZRYRRaRZRJRIRR$RR!R RRYRHRRaRRR$RR!R RRRaRIRR$RR!R RRHRRaR$RRR!RR RRaRR R$R!RRRaRR$RR!R RRRaR%R"RRR$RRR!R RRRaRR$RR!RR RRDRRaRRRR$R#R!R RR
RRRR
R	RYRRaRRRR$R#R!R RRRaRRRR$R#R!R RRRaR6R;RRR$R!R RRKRIR-R0R+RHR*R5R	RYRFRDR?RQRRaRR#R!R"R RRRaRR#R!R RRRaRR$RR!R RRRaRR$R#RR!R RRRaRIRRR$R#R!R RRR-R/R,R0R.R1R+R*R	RYRHRQRRaRR RR	RYRRaR
RRRRR$R#R!RR RR7R8R;R6R5R	RFRYRDRRaRR$R#RR!R RR\RRaRRRR$R#R!R RRRaR R!RRRaR8R<R;R6R9RRRR$R#R!R RR5R	RYRFRDRRaR3R$RRR!R RR2RRRaRR$RR!R RRRaRJRIRRRR$R#R!R RRHRRaR R$R!RRRaRR$RR!R RR\RRaRRRR$R#R!R RRRaRRRRZRRRR$R#R!R RRYR	RFRRaR R!RRRaRIR
R
RRRRRRRR$R#R!R RR	RYRHRRaR RRRaR R!RRRaRRRR$R#R!R RRRaRJRIRRR#R$RR!R RRHRRaRR$RR!R RRRaRWRCRARRR#R!R RR@RBRVRRaRIRRRR$R#R!R RR-R.R/R,R0R+R*R	RYRHRQRRaR(RRRR$R!R RR'RFRRaRZRRR R!RR	RYRRaR
RRR R!RR8R9R;R6R5R	RFRDRYRRaRRRIRR$R#RR!R RR7R8R9R;R6R	R5RYRFRDRHRRaR!R RRRaRRR
RRRRJRIRR$R#RR!R RR	RYRHRRaRIRRRR$R#R!R RRHRRautf-8e960c4b3ea942cc136ae5b87ac0597bad5f894570eeb8678b0bb65ac8b26ee17?����'�<�3!�^���P,��*����%�f�

	*����%�-3�3@�\He��N³6�s� ��v�PD�ɚ�2��T���-��PZoԇ%ǼLf��9B��Z�z�?�<�c@"�Pmz#$8;⯙��)�)�<n�tW�*��m%�
zx������U2��Zߟr>��]����-�&#l"���/�q:�O+��ҽ���BQ�9�
Z�1�m���A��W1�#�&���l���o8���VW�E�P��s�W���@;����;�4p܋e�Ў��ҍ��Q���PԎ]����:j2�����_����D����Dk_N\+3�Xh{�s�vM�3������1Uze&!/��@�`�8���������Eư��5Q][�K����c~b��Z�����O��K7h]��]���
���Z�X���F�N��<�2��#�)�,b�h�	\)���=�D|���P��G��}t7�{�;��H7��%�J�\58��� "C�<��!>bC�ͩ3�p����TT);���>�H�xBv�@��"P��]4p0:�Ŵ��7��"��z���3!�^���P,��*����%�f�

	*����%���9`���(S�x�������������x�����X��$�
*�����^X�$N����������������^X]X_X�module_expand to use shared libsepol.
        Fixed audit2why to call policydb_init prior to policydb_read (still
        uses the static libsepol).- Update to match NSA
        * Updated for changes to libsepol.
        Changed semodule and semodule_package to use the shared libsepol.
        Disabled build of semodule_link and semodule_expand for now.
        Updated audit2why for relocated policydb internal headers,
        still needs to be converted to a shared lib interface.- Update newrole pam file to remove pam-stack
- Update run_init pam file to remove pam-stack- Update to match NSA
        * Fixed warnings in load_policy.
        * Rewrote load_policy to use the new selinux_mkload_policy()
        interface provided by libselinux.- Rebuild with newer libararies- Update to match NSA
        * Merged patch to update semodule to the new libsemanage API
        and improve the user interface from Karl MacMillan (Tresys).
        * Modified semodule for the create/connect API split.- More fixes to stop find from following nfs paths- Update to match NSA
        * Merged run_init open_init_pty bug fix from Manoj Srivastava
          (unblock SIGCHLD).  Bug reported by Erich Schubert.- Update to match NSA
        * Merged error shadowing bug fix for restorecon from Dan Walsh.
        * Merged setfiles usage/man page update for -r option from Dan Walsh.
        * Merged fixfiles -C patch to ignore :s0 addition on update
          to a MCS/MLS policy from Dan Walsh.- Add chcat script for use with chcon.- Fix restorecon to exit with error code* Updated version for release.- Add prereq for mount command- Update to match NSA
        * Changed setfiles -c to translate the context to raw format
        prior to calling libsepol.- Use new version of libsemange and require it for install- Ignore s0 in file context- Update to match NSA
        * Merged patch for fixfiles -C from Dan Walsh.- Update to match NSA
        * Merged fixes for semodule_link and sestatus from Serge Hallyn (IBM).
          Bugs found by Coverity.- Fix fixfiles to call sort -u followed by sort -d.- Change fixfiles to ignore /home directory on updates- Update to match NSA
        * Merged patch to move module read/write code from libsemanage
          to libsepol from Jason Tang (Tresys).- Update to match NSA
        * Changed semodule* to link with libsemanage.- Update to match NSA
        * Merged restorecon patch from Ivan Gyurdiev.- Update to match NSA
        * Merged load_policy, newrole, and genhomedircon patches from Red Hat.- Update to match NSA
        * Merged loadable module support from Tresys Technology.- Update to match NSA
        * Updated version for release.- Fix Ivan's patch for user role changes- Add Ivan's patch for user role changes in genhomedircon- Fix warning message on reload of booleans- Update to match NSA
        * Merged fixfiles and newrole patch from Dan Walsh.
        * Merged audit2why man page from Dan Walsh.- Add call to pam_acct_mgmt in newrole.- Update to match NSA
        * Extended audit2why to incorporate booleans and local user
          settings when analyzing audit messages.- Update to match NSA
        * Updated audit2why for sepol_ prefixes on Flask types to
          avoid namespace collision with libselinux, and to
          include <selinux/selinux.h> now.- Fix fixfiles to accept -f
- Update to match NSA
        * Added audit2why utility.- Change -f flag in fixfiles to remove stuff from /tmp
- Change -F flag to pass -F flag  to restorecon/fixfiles.  (IE Force relabel).- Update to match NSA
        * Fixed signed/unsigned pointer bug in load_policy.
        * Reverted context validation patch for genhomedircon.- Update to match NSA
        * Reverted load_policy is_selinux_enabled patch from Dan Walsh.
          Otherwise, an initial policy load cannot be performed using
          load_policy, e.g. for anaconda.- remove is_selinux_enabled check from load_policy  (Bad idea)- Update to version from NSA
        * Merged load_policy is_selinux_enabl�x�������������������XL�%�
 ���������n!�����$~����������������n!m!o!�2217db821298733b0c4b31adedaeb875e4256be86ccbacf38e1b8545eb3b683afe5c623a98ef4a5a2cc139c2da85027884f9998a75f04c8efc02b36e23ecccb724a4bced7a0538caab1a99f951b9fc7830eb262c8b3ed30919c1ef2ac2c1530c5734a8f94f0839ce9d4debe4ef304c4004ebca58269b749062367a9801b324a794df4f15fb3495e020c2ea5e192eb7e0629d1005fdede840d2fda8a349f122c63453737b3c5cbe31f17c3bc7b63f35172166e7c017903fffe10928eac9d9edcd67aa44d2bc5f1254a86b325ecdb675ea5936c00134258ec473000a46f9dbb01564061bff36f02aa576688b336a4da41df9ff225adf990d004034c885b94c7b4f2fc2cda8b2588331eecbcdd71d95d89b64a7ccc39872cd5a6a55b1d63a4a96f50554f15098ed039a382e8bd5ec7d302535256ce11041d1d4c1479edecc293960e1836e1531ad52dd96b4d2c15f3e40421e66f85ce08887a4a1f135aee858247e4ecaeb214aab18645db2dc271897a7bceb2f0229f34f67d3c2125f4228457728689c0fb654559b71b69584977c5470eb8d36e3021da6e397dadcdce8e4ca5ad799967c7d42b415632f66cbb36e0d599cfe2e227d8dad5d741e23a3a1fe770658ec8770332d5628245d98014cd7cfe0fe91a4d2a0fb12799b1501b2b32ddb7d38818ba7fabccc1b9d0cd6d0e64386c09f20e7e3e9a772b5f8984d57c1ff52eb448cae3f87d44c3be93c227c4cd1be88cd6673725fae7c2b3e6a4d7ad739b4f8c0617b0d9c20fc75687e31dc1b93a55f10f04b9ca9b61e9e1396d87a40adb30cc8dc1a4947e6e6550208932d5eb1d38ec300e92704f922284f9165b691eed8e3b081611314fd1cbd57a2b4b3725b02c31a8fb04cceafc0c99dfef6595983c3bbc47885630bc8cfb18d352c774e8d5fa39996460d07fd8f22bc330d8eeab675cf27ce3bd492e8c7e4ed2ea4df203544e5838aaad6d5779c1041efd5ee7d78b0bee1863f05eca4f1e8ac8d56d50b512153f3f407756a4e5374637f7934723ebb9ca79556cc67709f02b2416771e4ea582351936959ead016820a93d180bb97c3821e3fffbb94d217c3bf721825aadc279a31490d68ccf4a918211a6b247d74d9b7edd07f90363e46847048104137872a9336e05fc1456c31042a96584ff80dea0ff17a4fcd491f9c2ace34b98f5b86b5ac6a43160f846119b0fb849e9070eb1259d0b920fad097d12f01c8000d72e0a12f2a756e9f64dd575e438116d48d811a04bd072d49c420f83413dadfcc366baa93018e4f605fc25813a2fe14734355b534e1de73b10c109271da60982ea0adcd5c71ea95b675cf98b4904ef0db95291e974751abdd36f90666615b78ce45476225aadb87bbc9a58dcdcb06517072cd997b7bcde23c88ef4bc764d2c43acd6c48044cdef5049f436a089e6a6a8b38d5d651ba34b4906c67838c10bb8cb4635267f2441ce69034379ba619d9b4e003e82332f5c6ea00ae084f26c3e7f7391dd8410b6bb6f47c43f683db8818f686461d342feb22282ead8ba6288c38df710d64ee619711710d1c37f2c97f17b050f111db26568b35802afaa0c1dd5ac35fcb458f6c6aeaec0993c97a30df076b50c333bea42beaa6d7e5536fbe2ec1f4cc6fdac5c3ce8b3e15b06b3f34203d719acbae5560c501fc51cfee1522cdcef874e6161738d3e72054aafd892c3990287185e4d30eb31e7331609b6a2b9d1a8a07ef73240b271681b3cbbde2ac2e4cf43ca7c2beed36bf5d040c924ce20e98b0ae0f02a8cc2e8cf01bad2b829b7c4cab3f9ce148a3455396663e3ac1ec56d022283fc9d65814c5f105b07dd6a22b403d260b955a6ecda30c54db7ab6681d259b70233ba4c0189829aac943fc8c60d61ce2e89c84e561b9b227ec8ce10b862330ea45f1acd6d6a65305d2247204b620a957305d1017f8a7fa030ed66a3dfb392268f6a53464c3167d925b758bc9c2753a65c27c4cdea987221181ce668071202ea4550d173ed912dda51152795e4cd44becdedde9166a9a3158a6c4dcef0f1f5a3344a5254a3d6958dc40cb2b4799b35fe539bc0994ef8a4ad60ef2718a66d1632aba9d26c0ee6ca22acfedf5d219f0543df72db8b1d06434a1781a3800569cbcbe13cdcd5f39d0e5468f9ce7bb3c6ac597b44942a90f58561c10c3cc76b2d0825a3faf1e12c87b9fb0311c0d007a956bb1a814696ac861b12f433fc1198e960b5df18ce93f5e4352a7e80981b5d0c4efbb58d974286896e3b4277e1e85cfb42bec57958e843c7e8c766f5e56a50cd7e85bf61162ee3db28b6bb9466f3e1cb31eb2a676d51dff6c19d107de4c5adbea622d40e3ea668fd1424291cc26021569d17985b031c84a0075778bcc0e0b81eee5789e40aaed71dbd06533f2f9fe6475c1251f77ecf26737a3e04f666728d34b9566e0029287bfdfefe0b7afc5d64faffc757ee00bddf6a9cee2f5a1b7e0a4aa59951f8ad9eda5a956e9dc583c26df829d1ee27cad076fc8d613381859f706de3d9acb104a3064b1e8bbb5f122389d848db6cdbc3c55d9f76ee49f5afe754a58ef084fa2637c5cd532cd9de7481225fac328548cceb39b1916940e7c0c913144669f8597f454bc4ba80a236c6f7f795203c51896323b921fc863f4543be874e05644d0bd3a0c8d95369c68252c64c50f0ed6f628df163d0f86cf9f7a9ce1e33c150c0c3856607244f3d37a3f398e61ebe725c766f7e6bac4eed24c03a445eb4c612a42575501279e9707b8931f337b7ddb9048f751c2f4b179f874ea2938eb638e2f33bbccbf9f147f2724841064cdc8d0e9e2740811�x������������w����X�_%�
�������������wd�$g����������������wdxdvd�6.3ssl.gzBN_get_rfc3526_prime_6144.3ssl.gzBN_get_rfc3526_prime_8192.3ssl.gzBN_get_word.3ssl.gzBN_hex2bn.3ssl.gzBN_is_bit_set.3ssl.gzBN_is_odd.3ssl.gzBN_is_one.3ssl.gzBN_is_prime.3ssl.gzBN_is_prime_ex.3ssl.gzBN_is_prime_fasttest.3ssl.gzBN_is_prime_fasttest_ex.3ssl.gzBN_is_word.3ssl.gzBN_is_zero.3ssl.gzBN_lebin2bn.3ssl.gzBN_lshift.3ssl.gzBN_lshift1.3ssl.gzBN_mask_bits.3ssl.gzBN_mod.3ssl.gzBN_mod_add.3ssl.gzBN_mod_exp.3ssl.gzBN_mod_inverse.3ssl.gzBN_mod_mul.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_mod_mul_reciprocal.3ssl.gzBN_mod_sqr.3ssl.gzBN_mod_sqrt.3ssl.gzBN_mod_sub.3ssl.gzBN_mod_word.3ssl.gzBN_mpi2bn.3ssl.gzBN_mul.3ssl.gzBN_mul_word.3ssl.gzBN_new.3ssl.gzBN_nnmod.3ssl.gzBN_num_bits.3ssl.gzBN_num_bits_word.3ssl.gzBN_num_bytes.3ssl.gzBN_one.3ssl.gzBN_print.3ssl.gzBN_print_fp.3ssl.gzBN_priv_rand.3ssl.gzBN_priv_rand_range.3ssl.gzBN_pseudo_rand.3ssl.gzBN_pseudo_rand_range.3ssl.gzBN_rand.3ssl.gzBN_rand_range.3ssl.gzBN_rshift.3ssl.gzBN_rshift1.3ssl.gzBN_secure_new.3ssl.gzBN_security_bits.3ssl.gzBN_set_bit.3ssl.gzBN_set_word.3ssl.gzBN_sqr.3ssl.gzBN_sub.3ssl.gzBN_sub_word.3ssl.gzBN_swap.3ssl.gzBN_to_ASN1_ENUMERATED.3ssl.gzBN_to_ASN1_INTEGER.3ssl.gzBN_to_montgomery.3ssl.gzBN_ucmp.3ssl.gzBN_value_one.3ssl.gzBN_with_flags.3ssl.gzBN_zero.3ssl.gzBUF_MEM_free.3ssl.gzBUF_MEM_grow.3ssl.gzBUF_MEM_grow_clean.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new_ex.3ssl.gzBUF_reverse.3ssl.gzCERTIFICATEPOLICIES_free.3ssl.gzCERTIFICATEPOLICIES_new.3ssl.gzCMS_ContentInfo_free.3ssl.gzCMS_ContentInfo_new.3ssl.gzCMS_ContentInfo_print_ctx.3ssl.gzCMS_ReceiptRequest_create0.3ssl.gzCMS_ReceiptRequest_free.3ssl.gzCMS_ReceiptRequest_get0_values.3ssl.gzCMS_ReceiptRequest_new.3ssl.gzCMS_RecipientInfo_decrypt.3ssl.gzCMS_RecipientInfo_encrypt.3ssl.gzCMS_RecipientInfo_kekri_get0_id.3ssl.gzCMS_RecipientInfo_kekri_id_cmp.3ssl.gzCMS_RecipientInfo_ktri_cert_cmp.3ssl.gzCMS_RecipientInfo_ktri_get0_signer_id.3ssl.gzCMS_RecipientInfo_set0_key.3ssl.gzCMS_RecipientInfo_set0_pkey.3ssl.gzCMS_RecipientInfo_type.3ssl.gzCMS_SignerInfo_cert_cmp.3ssl.gzCMS_SignerInfo_get0_signature.3ssl.gzCMS_SignerInfo_get0_signer_id.3ssl.gzCMS_SignerInfo_set1_signer_cert.3ssl.gzCMS_SignerInfo_sign.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_crl.3ssl.gzCMS_add0_recipient_key.3ssl.gzCMS_add1_ReceiptRequest.3ssl.gzCMS_add1_cert.3ssl.gzCMS_add1_crl.3ssl.gzCMS_add1_recipient_cert.3ssl.gzCMS_add1_signer.3ssl.gzCMS_compress.3ssl.gzCMS_decrypt.3ssl.gzCMS_encrypt.3ssl.gzCMS_final.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_content.3ssl.gzCMS_get0_eContentType.3ssl.gzCMS_get0_signers.3ssl.gzCMS_get0_type.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzCMS_get1_certs.3ssl.gzCMS_get1_crls.3ssl.gzCMS_set1_eContentType.3ssl.gzCMS_sign.3ssl.gzCMS_sign_receipt.3ssl.gzCMS_uncompress.3ssl.gzCMS_verify.3ssl.gzCMS_verify_receipt.3ssl.gzCONF_modules_finish.3ssl.gzCONF_modules_free.3ssl.gzCONF_modules_load.3ssl.gzCONF_modules_load_file.3ssl.gzCONF_modules_unload.3ssl.gzCRL_DIST_POINTS_free.3ssl.gzCRL_DIST_POINTS_new.3ssl.gzCRYPTO_EX_dup.3ssl.gzCRYPTO_EX_free.3ssl.gzCRYPTO_EX_new.3ssl.gzCRYPTO_THREAD_lock_free.3ssl.gzCRYPTO_THREAD_lock_new.3ssl.gzCRYPTO_THREAD_read_lock.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_unlock.3ssl.gzCRYPTO_THREAD_write_lock.3ssl.gzCRYPTO_atomic_add.3ssl.gzCRYPTO_clear_free.3ssl.gzCRYPTO_clear_realloc.3ssl.gzCRYPTO_free.3ssl.gzCRYPTO_free_ex_data.3ssl.gzCRYPTO_free_ex_index.3ssl.gzCRYPTO_get_alloc_counts.3ssl.gzCRYPTO_get_ex_data.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_mem_functions.3ssl.gzCRYPTO_malloc.3ssl.gzCRYPTO_mem_ctrl.3ssl.gzCRYPTO_mem_debug_pop.3ssl.gzCRYPTO_mem_debug_push.3ssl.gzCRYPTO_mem_leaks.3ssl.gzCRYPTO_mem_leaks_cb.3ssl.gzCRYPTO_mem_leaks_fp.3ssl.gzCRYPTO_memcmp.3ssl.gzCRYPTO_new_ex_data.3ssl.gzCRYPTO_realloc.3ssl.gzCRYPTO_secure_allocated.3ssl.gzCRYPTO_secure_clear_free.3ssl.gzCRYPTO_secure_free.3ssl.gzCRYPTO_secure_malloc.3ssl.gzCRYPTO_secure_malloc_done.3ssl.gzCRYPTO_se�x��������������f����X��$�
�������������c�$s����������������cbd�h check to call make check- remove unused patches- remove floppy from util-linux- fix #948274 - interruption code 0x4003B in libmount.so.1.1.0- upgrade to the release 2.23-rc2- libblkid ntfs bugfix for build on s390- add upstream patches for to fix umount and mount.<type>- upgrade to the release 2.23-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.23/v2.23-ReleaseNotes
- add nsenter and blkdiscard
- remove tunelp- fix  #912778 - "runuser -l" doesn't register session to systemd- fix #902512 - Dependency failed for /home (and blkid fails to tell UUID)
- refresh old patches- improve convertion to mtab symlink in post script
- spec file cleanup (based on #894199)- fix #882305 - agetty: unstable /dev/tty* permissions
- fix #885314 - hexdump segfault
- fix #896447 - No newlines in piped "cal" command
- fix libblkid cache usage (upstream patch)
- fix #905008 - uuidd: /usr/sbin/uuidd has incorrect file permissions- fix #889888 - wipefs does not completely wipe btrfs volume- upgrade to upstream maintenance release 2.22.2- sources cleanup- fix #872787 - su: COMMAND not specified- backport upstream runuser(1)
- enable su(1)- apply pathes from upstream stable/v2.22 branch
- fix #865961 - wipefs -a should use O_EXCL- upgrade to the release 2.22.1- remove obsolete references to e2fsprogs- upgrade to the release 2.22
- enable eject(1) from util-linux, obsolete original eject package
- fix #853164 - setuid program should have full RELRO
- fix #851230 - probe_ntfs: /usr/sbin/blkid was killed by SIGSEGV- upgrade to the release 2.22-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.22/v2.22-ReleaseNotes
- add sulogin, utmpdump, lslocks, wdctl- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- replace udev dependenceis with systemd- upgrade to bugfix release 2.21.2
- fix #814699 - namei(1) incorrectly resolves relative symlinks
- fix #820707 - Impossible to unmount nfsv4/krb5 mounts after network disconnect
- fix #816877 - libmount does not close device fd before mount(2)
- fix #822705 - unable to login after installing- upgrade to bugfix release 2.21.1- upgrade to release 2.21- fix #788703 - /run/blkid does not exist- upgrade to the release 2.21-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.21/v2.21-ReleaseNotes
- add {fsck,mkfs}.minix
- add new command chcpu(8)
- add new command prlimit(1)
- enable raw(8) command
- move 60-raw.rules from /etc from /usr/lib/udev/rules.d
- move blkid cache from etc to /run/blkid- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix #748216 - util-linux requires pam >= 1.1.3-7
- remove ddate(1)- Rebuilt for glibc bug#747377- upgrade to the release 2.20.1
  ftp://ftp.infradead.org/pub/util-linux/v2.20/v2.20.1-ReleaseNotes- upgrade to the release 2.20- upgrade to the release 2.20-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-rc2-ChangeLog- upgrade to the release 2.20-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-ReleaseNotes- fix #716483 - /var/tmp --(BIND-mounted)--> /tmp disrupts/hangs bootup
- fix #709681 - failure to mount if a mount point ends with a slash in /etc/fstab
- fix #709319 - 'mount -a' mounts already mounted directories
- fix kernel version parsing- upgrade to the release 2.19.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-ReleaseNotes- upgrade to the release 2.19.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-rc1-ChangeLog- fix #682502 - Broken source URL to floppy tarball, new version available
- upgrade to floppy-0.18- upgrade to the release 2.19
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes
- remove /sbin/mount.tmpfs -- integrated to mount(8)- fix #665062 - add support for the postlogin PAM stack to util-linux-ng- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- upgrade to the release 2.19-rc3
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc3�x�����(�������U����XB)$�
����������$j�����������������������olves: rhbz#1896717- bootloader: do not hardcode device to initrd
  resolves: rhbz#2050246- openshift/atomic: increased nf_conntrack_hashsize
  resolves: rhbz#2052886- new release
  - rebased tuned to latest upstream
    related: rhbz#2003833
  - tuned-gui: fixed creation of new profile- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2003833
  - profiles: fix improper parsing of include directive
    resolves: rhbz#2017924
  - disk: added support for the nvme
    resolves: rhbz#1854816
  - cpu: extended cstate force_latency syntax to allow skipping zero latency
    resolves: rhbz#2002744
  - net: added support for the txqueuelen
    resolves: rhbz#2015044
  - bootloader: on s390(x) remove TuneD variables from the BLS
    resolves: rhbz#1978786
  - daemon: don't do full rollback on systemd failure
    resolves: rhbz#2011459- new release
  - rebased tuned to latest upstream
    related: rhbz#1936426- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1936426
  - realtime: "isolate_managed_irq=Y" should be mentioned in
    "/etc/tuned/realtime-virtual-*-variables.conf"
    resolves: rhbz#1817827
  - realtime: changed tuned default to "isolcpus=domain,managed_irq,X-Y"
    resolves: rhbz#1820626
  - applying a profile with multiple inheritance where parents include a common
    ancestor fails
    resolves: rhbz#1825882
  - failure in moving i40e IRQ threads to housekeeping CPUs from isolated CPUs
    resolves: rhbz#1933069
  - sort network devices before matching by regex
    resolves: rhbz#1939970
  - net: fixed traceback while adjusting the netdev queue count
    resolves: rhbz#1943291
  - net: fixed traceback if the first listed device returns netlink error
    resolves: rhbz#1944686
  - realtime: improve verification
    resolves: rhbz#1947858
  - bootloader: add support for the rpm-ostree
    resolves: rhbz#1950164
  - net: fixed traceback if a device channel contains n/a
    resolves: rhbz#1974071
  - mssql: updated the profile
    resolves: rhbz#1942733- updated mssql profile
  resolves: rhbz#1942733- realtime: added support for netdev_queue_count and extended plugin_net
  resolves: rhbz#1951992- new release
  - rebased tuned to latest upstream
    related: rhbz#1874052- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1874052
  - added plugin service for linux services control
    resolves: rhbz#1869991
  - scheduler: added default_irq_smp_affinity option
    resolves: rhbz#1896348
  - bootloader: skip boom managed BLS snippets
    resolves: rhbz#1901532
  - scheduler: added perf_process_fork option to enable processing of fork
    resolves: rhbz#1894610
  - scheduler: added perf_mmap_pages option to set perf buffer size
    resolves: rhbz#1890219
  - bootloader: fixed cmdline duplication with BLS and grub2-mkconfig
    resolves: rhbz#1777874- realtime-virtual-host: remove lapic advancement calculation and
  related qemu-kvm-tools-rhev requirement
  Resolves: rhbz#1845717- scheduler: fixed isolated_cores to work with cgroups
  related: rhbz#1784648- throughput-performance: fix performance regression on AMD platforms
  related: rhbz#1746957- new release
  - rebased tuned to latest upstream
    related: rhbz#1792264- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1792264
  - oracle: turned off NUMA balancing
    resolves: rhbz#1782233
  - man: documented the possibility to apply multiple profiles
    resolves: rhbz#1794337
  - cpu-partitioning: disabled kernel.timer_migration
    resolves: rhbz#1797629
  - profiles: new profile optimize-serial-console
    resolves: rhbz#1840689
  - added support for a post-loaded profile
    resolves: rhbz#1798183
  - plugins: new irqbalance plugin
    resolves: rhbz#1784645
  - throughput-performance: added architecture specific tuning for Marvell ThunderX
    resolves: rhbz#1746961
  - throughput-performance: added architecture specific tuning for AMD
    resolves: rhbz#1746957
  - scheduler: added support for cgroups
    resolves: rhbz#1784648- realtime: added condi�x��������������E����X��%�
����g���j!�$z����������������j!i!k!�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�0002a493355b43906837880a890423afeaa18d5160a17aee38b2a6875f6c84051217e58ecd8813258b91e0ce751512b2e801088f9f2de365deea30bbb6d982195e12cb83261b1211566f33ca6aea19c21af7bfc98e4fbe7ba3fac64b42b6cb0586566c442af0dbf737012cc0b216c1fce96a9b0715db645f38ee0853b84d263e65f304c5bf83cc76c1a77938634647ff424df4695aa96510a5b8374248a0b3ebd528e7debd6f73d7eebd396f77ad6da8590f37d842224dc4b5ad018e57795c548e6beb9ca0ffbc4b9c6550d56f622ecd33d5635ee8af9a8f269fd81f40fb6801d77d235e41d54594865151f4751e835c5a82322b0e87ace266567c3391a4b91299317729e6e86fb05b52a0f9b3718e218ce997047797b59904efd26b37857de210db59f88dbbb767a69296efd376988cfca1183b24b92cdbd7f787cc64d242be4bc371bb2990cbed47ba1c81070770c651d16ca1a7a2ddcbb14b0c07f592d6a82b18763bb5bb7a5b86b305b1fb80be3748bdfe55eaa31d4975451f197f040d2113e178e702e62cea402a4fd4ab55d95ed96b327ee00d7c295bd3bdf1d16f390293c4afdabb6672b0b10bdc5df0a60344b7ca526730be538e6302f787cf44447e035a7f9eb8a0f582d3aaa76f4bbdf06b9ddc64bec0d28cf3424720189d1719ffeb62cc3ee22a592bc673e07158927d1a6536075d33258fc67ff91e3f720cf46389a96f0a1a1ed78e0e9c525434b5779b2e2baa8f976dfa2f78771282fa08d88d612127d4889032e55d82522e4a0c19793bda8aa8da14ecb3c696d17c83e6be139b3aa6e1b8d37c0a4c5aa77b7e168662831a4645912e446ca399280c0eb63760c2ac59e73fb56a2c7c6cffdf9bc81b8aa674163f566a3dc31dd9e6e2f9164d2cd3f3ca4956db2c06118d64f3e1b9ff13a900251b996e7b36d258114ae70400a59759481802353cd19d999d3be7e6c09a9f60e8d9d558f1666bcd1c4f94303913c52e0d693e9205f1d4074370386fcc221497af51becc603fcaab4ce3524713b6009477f536f63016d901aeb1a4c820ad291e30e72ee9eb9ac1dfb6294a8a9bccdfc4f159c5c68328114ff17cd520451714a72ff48657287e5fe2f64344980695b8e6fbfd6daa6e5980cb2106874b57e9c0ee2c25cc661c5995eb4bd57107778f6b034da09260ed5ac6c7d5d7b2aa1bc7408033137a3772070fa454cba49150e6741f74341097cd0866cb1576f91090ce1c1c738ca1097f61fc5029bac250195a5de69f2de664c672fc31903346398ec7e17182c0bb7d53e30e8a53af820a0fa302bdcfb95c3fd5de9233a74cbae7b41f7a654f49a626b46a330a656abfa292739feab128f956084e0e39c41f2d96770d82c5a19406748c79abf94a1900a5130d56b5544a4c27576cc31221165bff58e1b5a561460fe8cdfc7024e0e9d9b6d0a2496bd121229abf81d9ae94cb00cfa5f3a762ead03b5b5e8420a76956416898e8cc2ff0a6df0f5e8fb03da6f9744e0c48ce53f192f0681919940c1c7653b436c6e253571cb0e37911b5297029ab15e84a5fbfeb0772808295b9fa494833517d8b8a5ae2668056d4a0929c0a5668ddd73e1db86b2f65d8e97d539f6e9252ae377a78fc7d45c877b14c66b70b3a6ad7f4b356c243b36d5336522685f4bb3c4a7a20eb52cb5d0c031df4b1f6d73e9458c6126fb0d32112095defdc7493ce9a93ff6056d845723c3d1d870aa76be71acf88adb6d787331e0acafbdc71b20d886fb18118edc06e9dd3c2caf54b4a69025d6fe4f9ddb9f641b1cd96d4e1afedd62eb13d1a66fb080fdda29c8bfd5284dea1adb53e54498fcaff3d155ce3bfa6d3ff22ae0527262dcf28dc58e5b5fee4eb3eeac2ef1e70591d53b8935c12ee526de09b3c9d11f4fdcc5dab9e321e6ca2e03ae785b87ea36b948248bc167445c1afd8edf627297a334cbeffc8b70bfeeea09c963c1d348807139ccc7e1c7e88c8e6213270dd4ab9bdb3af3022defba94d4500e994a271d961d87281122df30704b07c18f557e61215819a7310ba704e1cbbe4e76c0cb3f44bdf44a2edcc5b5a62a0e7f9118d929a7258addd91fe2faab7d72f5ddfa7e8a3412a3f07f2ea731eb084f752f6aefce375686ab5f386b61a08787b1d3ea1ec5ccd0e29814a223290540a041528c9d2145ffe337f280ce79705fd687869b2a4ab1cada3bb900a876093bd153e6ad752f3ec7273856d73fd172b25d0c4881caf38cf363221314ce2f245e60482d4678157b28f0228666b6601e8056b554ceabb7a34e0b5228c2ed37442c459ce917c03e3c2484b0e676dc47886be13794021447cebfc5ee2f3625068b368af06bcc5814c22b66d3ce0089b300c2ffa4f554685fe4d39e66b01ca7e14b990d54bd864b829987d9bdd5859e7226544e00695f2e7ee3c73611d9c1e4ec412ee408da6856d471d4cccb88cd9873344c03c8cbd7a769b328167810ca91d69ac59ed1052ed5f02565001b62651c31b22234be370291de6f23da36763f17acabf42e1a1442840e5ae6ff68e691f9f9aeeb5c0f4c67cc9cd572819b04841ed5c51461ad0a1c0a49455b43c11eef2e93bede22ab15c9f8b1aa57be20fe6f4e6dcc90102f4eb4abe1e66bf3f�x�������������H5����X��%�
��������������!�$�����������������!�!�!�ted
  automatically.- Provide perl(DB) by perl- Do not warn about missing site directories (bug #732799)- cleaned spec (thanks to Grigory Batalov)
-  Module-Metadata sub-package contained perl_privlib instead of privlib
-  %files parent section was repeated twice- Filter false perl(DynaLoader) provide from perl-ExtUtils-MakeMaker
  (bug #736714)
- Change Perl_repeatcpy() prototype to allow repeat count above 2^31
  (bug #720610)
- Do not own site directories located in /usr/local (bug #732799)- Fix CVE-2011-3597 (code injection in Digest) (bug #743010)
- Sub-package Digest and thus Digest::MD5 module (bug #743247)- add provide for perl(:MODULE_COMPAT_5.14.2)- 5.14.2 bump (see
  https://metacpan.org/module/FLORA/perl-5.14.2/pod/perldelta.pod for release
  notes).
- Fixes panics when processing regular expression with \b class and /aa
  modifier (bug #731062)
- Fixes CVE-2011-2728 (File::Glob bsd_glob() crash with certain glob flags)
  (bug #742987)- Enable GDBM support again to build against new gdbm 1.9.1- Disable NDBM support temporarily too as it's provided by gdbm package- Disable GDBM support temporarily to build new GDBM- Correct perl-CGI list of Provides
- Make tests optional
- Correct perl-ExtUtils-ParseXS Provides
- Correct perl-Locale-Codes Provides
- Correct perl-Module-CoreList version
- Automate perl-Test-Simple-tests Requires version- Make gdbm support optional to bootstrap with new gdbm
- Split Carp into standalone sub-package to dual-live with newer versions
  (bug #736768)- Split Locale::Codes into standalone sub-package to dual-live with newer
  versions (bug #717863)- perl needs to own vendorarch/auto directory- Move xsubpp to ExtUtils::ParseXS (#728393)- fix Compress-Raw-Bzip2 pacakging
- ensure that we never bundle bzip2 or zlib- remove from provides MODULE_COMPAT 5.12.*- Have perl-Module-Build explicitly require perl(CPAN::Meta) >= 2.110420,
  needed for creation of MYMETA files by Build.PL; the dual-life version of
  the package already has this dependency- Temporarily provide 5.12.* MODULE_COMPAT- fix escaping of the __provides_exclude_from macro- Parse-CPAN-Meta explicitly requires CPAN::Meta::YAML and JSON::PP
- Exclude CPAN::Meta* from CPAN sub-package
- Don't try to normalize CPAN-Meta, JSON-PP, and Parse-CPAN-Meta versions;
  their dual-life packages aren't and have much higher numbers already- update macros -> add %perl_bootstrap 1 and example for readability
- add into Module::Build dependency on perl-devel (contains macros.perl)
- create new sub-package macros, because we need macros in minimal buildroot- remove from macros BSD, because there exists BSD::Resources- remove old MODULE_COMPATs- move ptargrep to Archive-Tar sub-package
- fix version numbers in last two changelog entries- add provide for perl(:MODULE_COMPAT_5.14.1)- update to 5.14.1 - no new modules, just serious bugfixes and doc
- switch off fork test, which is failing only on koji- try to update to latest ExtUtils::MakeMaker, no luck -> rebuild with current 
  version, fix bug RT#67618 in modules- filter even Mac:: requires, polish filter again for correct installation
- add sub-package Compress-Raw-Bzip2, solve Bzip2 conflicts after install
- and add IO::Uncompress::Bunzip2 correctly into IO-Compress- Perl 5.14 mass rebuild, bump release, remove releases in subpackages- Perl 5.14 mass rebuild- Perl 5.14 mass rebuild- add new sub-packages, remove BR in them- arm can't do parallel builds
- add require EE::MM into IPC::Cmd 711486- test build of released 5.14.0
- remove Class::ISA from sub-packages
- patches 8+ are part of new release
- remove vendorarch/auto/Compress/Zlib- add provides UNIVERSAL and DB back into perl- Remove rpath-make patch because we use --enable-new-dtags linker option- 692900 - lc launders tainted flag, RT #87336- Cwd.so go to the PathTools sub-package- sub-package Path-Tools- sub-package Scalar-List-Utils- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Document ExtUtils::ParseXS upgrade in local patch tracking- update �x����������`$����X.o%�
xPE���gd�$w����������������gdhdfd�0_alpn_selected.3ssl.gzSSL_get0_chain_certs.3ssl.gzSSL_get0_dane_authority.3ssl.gzSSL_get0_dane_tlsa.3ssl.gzSSL_get0_next_proto_negotiated.3ssl.gzSSL_get0_param.3ssl.gzSSL_get0_peer_CA_list.3ssl.gzSSL_get0_peer_scts.3ssl.gzSSL_get0_peername.3ssl.gzSSL_get0_security_ex_data.3ssl.gzSSL_get0_session.3ssl.gzSSL_get0_verified_chain.3ssl.gzSSL_get1_curves.3ssl.gzSSL_get1_groups.3ssl.gzSSL_get1_session.3ssl.gzSSL_get1_supported_ciphers.3ssl.gzSSL_get_SSL_CTX.3ssl.gzSSL_get_all_async_fds.3ssl.gzSSL_get_changed_async_fds.3ssl.gzSSL_get_cipher.3ssl.gzSSL_get_cipher_bits.3ssl.gzSSL_get_cipher_list.3ssl.gzSSL_get_cipher_name.3ssl.gzSSL_get_cipher_version.3ssl.gzSSL_get_ciphers.3ssl.gzSSL_get_client_CA_list.3ssl.gzSSL_get_client_ciphers.3ssl.gzSSL_get_client_random.3ssl.gzSSL_get_current_cipher.3ssl.gzSSL_get_default_passwd_cb.3ssl.gzSSL_get_default_passwd_cb_userdata.3ssl.gzSSL_get_default_timeout.3ssl.gzSSL_get_early_data_status.3ssl.gzSSL_get_error.3ssl.gzSSL_get_ex_data.3ssl.gzSSL_get_ex_data_X509_STORE_CTX_idx.3ssl.gzSSL_get_extms_support.3ssl.gzSSL_get_fd.3ssl.gzSSL_get_info_callback.3ssl.gzSSL_get_key_update_type.3ssl.gzSSL_get_max_cert_list.3ssl.gzSSL_get_max_early_data.3ssl.gzSSL_get_max_proto_version.3ssl.gzSSL_get_min_proto_version.3ssl.gzSSL_get_mode.3ssl.gzSSL_get_num_tickets.3ssl.gzSSL_get_options.3ssl.gzSSL_get_peer_cert_chain.3ssl.gzSSL_get_peer_certificate.3ssl.gzSSL_get_peer_signature_nid.3ssl.gzSSL_get_peer_signature_type_nid.3ssl.gzSSL_get_peer_tmp_key.3ssl.gzSSL_get_pending_cipher.3ssl.gzSSL_get_psk_identity.3ssl.gzSSL_get_psk_identity_hint.3ssl.gzSSL_get_quiet_shutdown.3ssl.gzSSL_get_rbio.3ssl.gzSSL_get_read_ahead.3ssl.gzSSL_get_record_padding_callback_arg.3ssl.gzSSL_get_recv_max_early_data.3ssl.gzSSL_get_rfd.3ssl.gzSSL_get_secure_renegotiation_support.3ssl.gzSSL_get_security_callback.3ssl.gzSSL_get_security_level.3ssl.gzSSL_get_selected_srtp_profile.3ssl.gzSSL_get_server_random.3ssl.gzSSL_get_server_tmp_key.3ssl.gzSSL_get_servername.3ssl.gzSSL_get_servername_type.3ssl.gzSSL_get_session.3ssl.gzSSL_get_shared_ciphers.3ssl.gzSSL_get_shared_curve.3ssl.gzSSL_get_shared_group.3ssl.gzSSL_get_shared_sigalgs.3ssl.gzSSL_get_shutdown.3ssl.gzSSL_get_sigalgs.3ssl.gzSSL_get_signature_nid.3ssl.gzSSL_get_signature_type_nid.3ssl.gzSSL_get_srtp_profiles.3ssl.gzSSL_get_ssl_method.3ssl.gzSSL_get_state.3ssl.gzSSL_get_time.3ssl.gzSSL_get_timeout.3ssl.gzSSL_get_tlsext_status_ocsp_resp.3ssl.gzSSL_get_tlsext_status_type.3ssl.gzSSL_get_tmp_key.3ssl.gzSSL_get_verify_callback.3ssl.gzSSL_get_verify_depth.3ssl.gzSSL_get_verify_mode.3ssl.gzSSL_get_verify_result.3ssl.gzSSL_get_version.3ssl.gzSSL_get_wbio.3ssl.gzSSL_get_wfd.3ssl.gzSSL_has_matching_session_id.3ssl.gzSSL_has_pending.3ssl.gzSSL_in_accept_init.3ssl.gzSSL_in_before.3ssl.gzSSL_in_connect_init.3ssl.gzSSL_in_init.3ssl.gzSSL_is_dtls.3ssl.gzSSL_is_init_finished.3ssl.gzSSL_is_server.3ssl.gzSSL_key_update.3ssl.gzSSL_library_init.3ssl.gzSSL_load_client_CA_file.3ssl.gzSSL_load_error_strings.3ssl.gzSSL_new.3ssl.gzSSL_peek.3ssl.gzSSL_peek_ex.3ssl.gzSSL_pending.3ssl.gzSSL_psk_client_cb_func.3ssl.gzSSL_psk_find_session_cb_func.3ssl.gzSSL_psk_server_cb_func.3ssl.gzSSL_psk_use_session_cb_func.3ssl.gzSSL_read.3ssl.gzSSL_read_early_data.3ssl.gzSSL_read_ex.3ssl.gzSSL_renegotiate.3ssl.gzSSL_renegotiate_abbreviated.3ssl.gzSSL_renegotiate_pending.3ssl.gzSSL_rstate_string.3ssl.gzSSL_rstate_string_long.3ssl.gzSSL_select_current_cert.3ssl.gzSSL_select_next_proto.3ssl.gzSSL_session_reused.3ssl.gzSSL_set0_CA_list.3ssl.gzSSL_set0_chain.3ssl.gzSSL_set0_chain_cert_store.3ssl.gzSSL_set0_rbio.3ssl.gzSSL_set0_security_ex_data.3ssl.gzSSL_set0_verify_cert_store.3ssl.gzSSL_set0_wbio.3ssl.gzSSL_set1_chain.3ssl.gzSSL_set1_chain_cert_store.3ssl.gzSSL_set1_client_sigalgs.3ssl.gzSSL_set1_client_sigalgs_list.3ssl.gzSSL_set1_curves.3ssl.gzSSL_set1_curves_list.3ssl.gzSSL_set1_groups.3ssl.gzSSL_set1_groups_list.3ssl.gzSSL_set1_host.3ssl.gzSSL_set1_param.3ssl.gz�x�������������8����X��%�
���������%���"X�$2����������������"X#XJA gU�duce cpu_set_to_range() (#1734787)
- systemctl: present CPUAffinity mask as a list of CPU index ranges (#1734787)
- shared/cpu-set-util: only force range printing one time (#1734787)
- execute: dump CPUAffinity as a range string instead of a list of CPUs (#1734787)
- cpu-set-util: use %d-%d format in  cpu_set_to_range_string() only for actual ranges (#1734787)
- core: introduce NUMAPolicy and NUMAMask options (#1734787)
- core: disable CPUAccounting by default (#1734787)
- set kptr_restrict=1 (#1689346)
- cryptsetup: reduce the chance that we will be OOM killed (#1696602)
- core, job: fix breakage of ordering dependencies by systemctl reload command (#1766417)
- debug-generator: enable custom systemd.debug_shell tty (#1723722)- core: never propagate reload failure to service result (#1735787)
- man: document systemd-analyze security (#1750343)
- man: reorder and add examples to systemd-analyze(1) (#1750343)
- travis: move to CentOS 8 docker images (#1761519)
- travis: drop SCL remains (#1761519)
- syslog: fix segfault in syslog_parse_priority() (#1761519)
- sd-bus: make strict asan shut up (#1761519)
- travis: don't run slow tests under ASan/UBSan (#1761519)
- kernel-install: do not require non-empty kernel cmdline (#1701454)
- ask-password: prevent buffer overrow when reading from keyring (#1752050)
- core: try to reopen /dev/kmsg again right after mounting /dev (#1749212)
- buildsys: don't garbage collect sections while linking (#1748258)
- udev: introduce CONST key name (#1762679)
- Call getgroups() to know size of supplementary groups array to allocate (#1743230256 KB
- Consider smb3 as remote filesystem (#1757257)
- process-util: introduce pid_is_my_child() helper (#1744972)
- core: reduce the number of stalled PIDs from the watched processes list when possible (#1744972)
- core: only watch processes when it's really necessary (#1744972)
- core: implement per unit journal rate limiting (#1719577)
- path: stop watching path specs once we triggered the target unit (#1763161)
- journald: fixed assertion failure when system journal rotation fails (#9893) (#1763619)
- test: use PBKDF2 instead of Argon2 in cryptsetup... (#1761519)
- test: mask several unnecessary services (#1761519)
- test: bump the second partition's size to 50M (#1761519)
- shared/sleep-config: exclude zram devices from hibernation candidates (#1763617)
- selinux: don't log SELINUX_INFO and SELINUX_WARNING messages to audit (#1763612)
- sd-device: �x������������������X��$�
����������FX�$V����������������FXEXGX�
  * If there is no executable we don't want to print a part of STANDARD FILE CON
  * Add-manpages-for-typealiased-types
  * Make fixfiles_exclude_dirs working if there is a substituion for the given d- If there is no executable we don't want to print a part of STANDARD FILE CONTEXT- Update to upstream 
        * Add -P semodule option to man page from Dan Walsh.
        * selinux_current_policy_path will return none on a disabled SELinux system from Dan Walsh.
        * Add new icons for sepolicy gui from Dan Walsh.
        * Only return writeable files that are enabled from Dan Walsh.
        * Add domain to short list of domains, when -t and -d from Dan Walsh.
        * Fix up desktop files to match current standards from Dan Walsh.
        * Add support to return sensitivities and categories for python from Dan Walsh.
        * Cleanup whitespace from Dan Walsh.
        * Add message to tell user to install sandbox policy from Dan Walsh.
        * Add systemd unit file for mcstrans from Laurent Bigonville.
        * Improve restorecond systemd unit file from Laurent Bigonville.
        * Minor man pages improvements from Laurent Bigonville.- Apply patch to use setcon in seunshare from luto@mit.edu- Remove requirement for systemd-units- Fix previous Fix-STANDARD_FILE_CONTEXT patch to exclude if non_exec does not exist- Add policycoreutils-rhat-revert.patch to revert the last two commits to make build working
- Add 0001-Fix-STANDARD_FILE_CONTEXT-section-in-man-pages patch- Update Translations- Add support for Fedora21 html manpage structure
- Fix broken dependencies to require only usermode-gtk- mgrepl [PATCH] Deleteall user customization fails if there is a user used
- for the default login. We do not want to fail on it and continue to delete
- customizations for users which are not used for default login.- Update Translations
- Make selinux-policy build working also on another architectures related to s
- Miroslav grepl patch to fix the creation of man pages on different architectures.
- Add ability to list the actual active modules
- Fix spelling mistake on sesearch in generate man pages.- Allow manpages to be built on aarch64- Don't be verbose in fixfiles if there is not tty- Yum should only be required for policycoreutils-devel- Update translations- Add Miroslav patch to
- Fix previously_modified_initialize() to show modified changes properly for all selections- Do not require /usr/share/selinux/devel/Makefile to build permissive domains- Update to upstream 
        * Ignore selevel/serange if MLS is disabled from Sven Vermeulen.- Update Tranlations
- Patch from Yuri Chornoivan to fix typos- Fixes Customized booleans causing a crash of the sepolicy gui- Fix sepolicy gui selection for advanced screen
- Update Translations
- Move requires checkpolicy requirement into policycoreutils-python- Fix semanage man page description of import command
- Fix policy kit file to allow changing to permissive mode- Fix broken dependencies.- Break out python3 code into separate package- Add mgrepl patch
-   ptrace should be a part of deny_ptrace boolean in TEMPLATETYPE_admin- Update to upstream 
        * Revert automatic setting of serange and seuser in seobject; was breaking non-MLS systems.
- Add patches for sepolicy gui from mgrepl to
  Fix advanced_item_button_push() to allow to select an application in advanced search menu
  Fix previously_modified_initialize() to show modified changes properly for all selections- Update to upstream 
        * Apply polkit check on all dbus interfaces and restrict to active user from Dan Walsh.
        * Fix typo in sepolicy gui dbus.relabel_on_boot call from Dan Walsh.
- Apply Miroslav Grepl patch to fix TEMPLATETYPE_domtrans description in sepolicy generate- Fix selinux-polgengui, get_all_modules call- Speed up startup time of sepolicy gui
- Clean up ports screen to only show enabled ports.
- Update to upstream 
        * Remove import policycoreutils.default_encoding_utf8 from semanage from Dan Walsh.
        * Make yum/extract_rpms opt�x�������������(������X��%�
�������Xb��������$P��������������������52ef156dba2b38e6db3da04ccb371a2f38d05c189ecf078123269d5a2083ae2bc845e72a66568c542e6e9ad50f274a4ba9f9778b9a3884beab30ee8696b4e6e4878460c12b515fb87248e30a244dc7c50745eb749ed8391c806dcdbf03d5721650c13b2b6b43e788fbe3407076c243454d77dc1aad12d7664ffe29f7bd3abdc703f8877dbb08fdcbca85ce35f570620739b91c92bffd3e6c384fed3138bef283664abdb91e2a32911857a9ee24e27b41337a759fc5e9829199c7b329ec4ec15f2ded1bce85f87cf41d7160458cb6fb5b95e9a1ebbcfb1a5e1fc07d916de844cb6ba3e6efd063eecc3de86f6922424d9b0c5289d0859e5d75d8ee1efe5d18e258a11aca8d8b487185162119ed6719d44eae67087db2cc2515919656121d0891dbda42e9d2498e3f4ee5fab08c866666c1b1bd4e676b2ffa911de366375550e7cd60f399f4c8b5644421e6230e8d37669897b16fe318076e24377886f363ea8561d451e547054bb70c63ce6ee89cc985fdfd6d07bbe757cfa0cb7db86f30574ba6a5f0b8dfb8ee69bfe33aba5203d1979cf2ac3aca86f1f79437a3dea52855201617c576215c9e73b1c96fe1c78f92727098fa9eaec99fee492e07ab7b59a064ad89b33167502a5b9dd02a3ce3848082b8df5bbe02733d24e3dd8cf84f69a2c7adb0ae8e8459efe059ba5600aa5e587647d3d379e46b7ecdedba2e7245a216b90f544e847312f52cea48a82f518c1aa6edbdda2d91d9ba488cb916d80513c6b7eea1ca310ef1a6cb144fc8738863fc5e94aa33f254d45ffc3e74942d1d5424cff4b2edb71c8aeda0eef1b279e133555949b2144e66e5a433347e5cce8380fedad568995ddb82c42d9d397e29a47213f7aacd660c9c6ac13faa12a06a1e6f7b88669e30fa97e5031e43e0fba38e4b39a63b6be9880bcede610a080d7f0c174c15000699b3683afd9a6baa7e8832370791833f76fb8f328322aa46f8ac85b901ec672d85a8506f83f0a38342757b484dbbd95888b079a0f339a94393f5ae88c4c52bf7d65f6fc2abac8e3de90f303ae27c23a753b232d504333482b4c4a7cb8e1cc6f3766e89521f8a13884e023914d5ae7e4acd3c5afc2f7ba8e53a362b3958b26c066c8bca0010b203c16cd69cd21d95b39a1f0514a29e20a6b2edb622eeb345dd117f2a41524fbd533a3fa28b3891971160cdc887d948e1cfa5a1b3605da6d3b968da951437880cf4fa904b819d0c1d6aa5ca422e3b01ff14e5550a1a98fc0ccc9cfde179d7e2943ff7a883008d9319c1e3e70a5287ccfd12104a7d661e58f510ff5e993f5770b0dcc283ffaaff69c26bf92284a450027cf87fe4b4684d0de218de485e40dfdb47468c67724dd6718d517e8853b201c22abae10458f7899c0b063b11af21ed63dee750ce70867e919124244027d3059c02137e367f3ba784fc00872171bd948b9906fc8f943db5f6dd5d9ed93b8a20c7295bb17d69a942ab23ce73dff5ac0734daf9e0fa4a9c3ea2fef43a75dba9119b7095b9f378a245c63fd8830f86bf388c2bdb723b27c43ff2e7a2cc662b6788285750dc242e5effe7f2cc4ae98e2644d018c997618ab229ff608f12ebd0a953dbfb3f390157b8149c736720cc3fc23c5de1fee02a4ac68293fb89e191cdc2290632860baf0345b08536ca1b4d19a9857859d1e8f0238c26e93392080c65e25944787e085408f16c5c49b2df1103738de369cc98d879e2975ba78ac8f1715eb33787a2aae0468bc271bde3fce6ac4ed8491f061d0be9a587c4c08f4a5f233b82964d5f5051e1c33509411609982778a74d0862c6d54c49a655b21c8bc14cd529e305674b0ed1b4b8f4a3660ab7a7ac403dbb07d7e5d80688a1a842971e176b9b944b057f9fa92a3ed0d458e6d42f01790c741ff4869af851921cf71829d94f6845c5abdbafce59675a59be49625bf399e8721609ebc0880547f7f29a4fa43b2525b76357a2ff0dafa3ecf36cdf9d78f755479dbe5637a767755aa63393374ea549125e15833961c7fd505786b5f6ef2975fe2dd70d4c0306b0bc0ca55325bbc5a7287da72a4../../../../usr/bin/msgattrib../../../../usr/bin/recode-sr-latin../../../../usr/bin/msgexec../../../../usr/bin/msgunfmt../../../../usr/bin/msguniq../../../../usr/bin/msgen../../../../usr/bin/msgcomm../../../../usr/bin/msgcmp../../../../usr/bin/ngettext../../../../usr/bin/gettext../../../../usr/bin/msgfmt../../../../usr/lib64/gettext/urlget../../../../usr/lib64/gettext/hostname../../../../usr/bin/msgfilter../../../../usr/lib64/gettext/cldr-plurals../../../../usr/bin/msggrep../../../../usr/bin/envsubst../../../../usr/bin/msginit../../../../usr/bin/msgcat../../../../usr/bin/msgmerge../../../../usr/bin/msgconv../../../../usr/bin/xgettext�x��������������������X��$�
�:�>����W�$f�����������������W�W�I�L?�$d����	%�	<���������%�	Y�q�����0L`L	�L
�L�L�L
,L\L�LT�L��[(�8��9T�:K��>� G�(LH�XLI��LX�Y�\�@L]�pL^��b��d��e�f�l�	t�$Lu�TLv��w�PLx��Ly��I����������� �4�8������
���������L�@g�Dh�HCnet-tools2.00.52.20160912git.el8Basic networking toolsThe net-tools package contains basic networking tools,
including ifconfig, netstat, route, and others.
Most of them are obsolete. For replacement check iproute package._K�;build.cloudlinux.com�nCloudLinuxCloudLinuxGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>System Environment/Basehttp://sourceforge.net/projects/net-tools/linuxx86_64
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset arp-ethers.service &>/dev/null || : 
fiz��'�CpTde�T C�2���F���T����m�
6�t>����
��$	��
`�-��y�y
���	��
���A�A�A�A�A�A�A�A�A�A�A�A�A���������������A큤������������������������������������������������������������������������_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;^q�8_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;W���_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:58b684d5f7e86bc1b44a9834c405ae0cf33769bbc3973f130c8dd5d4a9c193fcb0540261fd06e9e2d8e3387c492eafe24cfb67e8897a1b12813ee27ca31df2becdac16c5241da49ae336c2a69bd5ae1032541714d883c7e4643c9c55f88017d437a4c43289d88c9f2fb2b729c239208329d6437847558739f12def64b9a464775ad0a5d085cc95e30810b010afa6698fe0e50d21b9d1ba9adee95f112848a8055481cfe73dfbc33ab67bc8bc757cce2314f84239abb0ae5c16b7ed44051f6a22c878b26dabefa2c5f10725d5404e447ed32fdd611515635bced4d1ddf32ed831ba380c50b1d85c584f8160ff3faab648058c2117ef0055274044aee5d9fbfd23750eded3cfa5590ca91c6cbc1bfa77853a17217954f4ba6cd63add6099200d86609deade7535388b64fd7f92f441925a9611fd0e70ce0a316fd42d740d3d70e96bf665d5d6bb694d4f6073ff9a9c40901b28f4e3d15c290b47af57eba54c47887680e84f7d0e1909f4f254de3a6834c944d9c679db9c98426d8269ee2cc8bfe4098e528b149de597b42e250f5bc5e4e8529f3013566a63e2339a6c42b5a430668177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643e19d5a958ceca429baffe6f4aa1386f4e3ec0c966a0df40c525f09c888826ac3414c7c1a501018a74711508210dc4f7a6ea202044307a713d73a5a6ff770cdb14759180e81476b93a88efa7010ade06a9dbe76d659de82e7ecfb1eb4a8278361c75c9ba77a424a5d8352470f80f94887421f7e937ee90e1df40a8fec5ef6db9e86511ff647c5630977e4cab90e40b1b11e34f168334b7326809cdce476648b402f6a7d2abbf371e94d542c877644e3dad4880883f5970233311a7f345cbce17a79858ddd873a07c1b38a9ea7430433ec7195ad5e11c322d010507608f9b76b453bf7e68e91890c1d1f11c6337a798f9�x�������������������X�&�
�p���p������$����������������f	ject.org/wiki/Fedora_23_Mass_Rebuild- Initial packaginglibgudev1	
�232-4.el8232-4.el8232-4.el8230.build-id52c849e12c494a8dac70606a8736615605e9811bGUdev-1.0.typeliblibgudev-1.0.so.0libgudev-1.0.so.0.2.0libgudevNEWSlibgudevCOPYING/usr/lib//usr/lib/.build-id//usr/lib/.build-id/52//usr/lib64/girepository-1.0//usr/lib64//usr/share/doc//usr/share/doc/libgudev//usr/share/licenses//usr/share/licenses/libgudev/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=52c849e12c494a8dac70606a8736615605e9811b, strippedASCII textPRRRRRRRRRRutf-8624e0113211666fbc69bfeb241c6cad7938b5328fc38c6be0a885a0958dbb750?���o��`�
	Q�d~���A��G��H �

�����5-��'��3ۭZ@p@��+���O�J��b70����2�Y$��j���i�!'̄��oʲ�:������n� r1
SB"�+�Cr���H�b[�oۧ��}��i�Z�W)�MF�G�S�������EQ�1�;4�Υ;��YJw�5�<{�<R��N�,��i�P��h����|y�S3�CH>��h���#l��W@������Ѷ�e���gu
FKĽT�"oY`*h�4�2"��[��+e��0��=x�g��ZIyBʄx�\g:n�b��o��cI(��Y��={��,��&�x9�6Nh� ��
i�Z%q�i��jwbY��X���~9F��U0�2Gt�T��H]F=�ZC�� �1���i���&J2�$�ˉ�`�
	Q�d~���w�_���������Mͽ;��Kv�Ț,�Rt��d[�]a;}��ɵ�V��V�������u���5��z�yQ�)�v�Q�u&�c�+y���ED���1��'N��|���3T�.	��I� |�qd�D�(x1�U.r;�%�I`���D��0)��S�皜j�C�㺔���"�ޝ� !��ו��`��y����Q*�Ӣ����
�qtHݷ�\��>��k�8�^ f�6Wf�*M�$[i|�<F�WE�d<�e1��?}3���v�W�w\5����::�C�2Ȟղ{����;��*lԧ¡.�^G�ܙC��dm��sh�� �%���MiCI�灎mVP
�S0����Y��D,��|���3b5802e28fd144f2a5c96e2ddcf5c45d42b17f3af6d7052d2e98ce4afc158800a2648725790b8bc117b6adaced3c013e6d9e75b7fX�0C�fX�bhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Matt Wilson <msw@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <jo�x��������������������X��$�
�F����b�������W�$n�����������������W�W�W�dated to netplug-1.2.6 for security update and fixes.- Updated netplugd to latest upstream version.
- Fixed execshield problem in main.c of netplugd.- Fixed several possible buffer overflows (#120343)- fixed compilation with gcc34- add chkconfig call in post and preun, fix init script (#116555)- Added netplug-1.2.1 to net-tools (FR #103419).- rebuilt-rebuilt- interface option now works as described in the man page (#61113).- rebuilt- Fixed trailing blank bug in hostname output (#101263).
- Remove -O2 fir alpha (#78955).
- Updated netstat statistic output, was still broken.- rebuilt- fix ether-wake.c build with gcc 3.3
- rebuilt- rebuilt- Bumped release and rebuilt- Fixed ether-wake usage output (#55801).- fix build with gcc 3.3- Fixed wrong manpage (#55473).- Added inet6-lookup patch from John van Krieken (#84108).
- Fixed outdated link in ifconfig manpage (#91287).- Fixed incorrect address display for ipx (#46434).
- Fixed wrongly installed manpage dirs (#50664).- Fixed nameif problem (#85748).- Fixed -s parameter.
- Fix /proc statistics for -nic operation.
- Fixed -i operation in general.- Disable smp build.- rebuilt- Rebuild
- Copyright -> License.- Rebuild- Added patch from Norm for a corrected output.- automated rebuild- automated rebuild- fix nstrcmp() to be correct in the case where there are many devices 
  of the same type, eg, "eth10" > "eth1"  (#61436)- do *not* use SIOCDEVPRIVATE for MII ioctls- include wake-on-lan wakeup utility, ether-wake by Donald Becker- itterate to 1.60- use find_lang macro
- less specific locale dirs for man pages- don't use this version of rarp, doesn't work with our 2.4.- fixed man page typo, closing bug #25921- applied twaugh's patch to close bug #25474
- which was a buffer length bug.- locales not initialized correctly (#20570).
- arp: document -e option (#22040).- update to 1.57.
- MTU (and other) option(s) not parsed correctly (#9215).
- allow more granularity iwth --numeric (#9129).- automatic rebuild- update to 1.56.
- FHS packaging.- update to 1.55.- rebuild for sparc baud rates > 38400.- fix description- fix "netstat -ci" (#6904).
- document more netstat options (#7429).- update to 1.54.
- enable "everything but DECnet" including IPv6.- update to 1.53.- plug "netstat -c" fd leak (#3620).- plug potential buffer overruns.- patch to recognize ESP and GRE protocols for VPN masquerade- update to 1.52.- update interface statistics continuously (#1323)- auto rebuild in the new build environment (release 2)- update to 1.51.
- strip binaries.- update to 1.50.
- added slattach/plipconfig/ipmaddr/iptunnel commands.
- enabled translated man pages.- update to 1.49.- update to 1.48.- update to 1.47.- update to 1.46- build root
- include ethers.5- upgraded to 1.45
- patched hostname.c to initialize buffer
- patched ax25.c to use kernel headers- translations modified for de, fr, tr- added config patch- changed to net-tools 1.432
- removed old glibc 2.1 patch- added extra patches for glibc 2.1- included complete set of network protocols (some were removed for
  initial glibc work)- updated glibc patch for glibc 2.0.5- built against glibc
- updated to 1.33/bin/sh	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLcsdeetfrptdededededededefrfrfrfrfrfrfrptptptpt2.0-0.52.20160912git.el82.0-0.52.20160912git.el8�x��������������������X��%�
�������������y!�$i����������������y!x!z!�:5.10.1-118Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-117Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-116Paul Howarth <paul@city-fan.org> - 4:5.10.1-115Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-114Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-112Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-111Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-110Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-109Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-107Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-106Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-105Stepan Kasal <skasal@redhat.com> - 4:5.10.1-104Stepan Kasal <skasal@redhat.com> - 4:5.10.1-103Stepan Kasal <skasal@redhat.com> - 4:5.10.1-102Stepan Kasal <skasal@redhat.com> - 4:5.10.1-101Stepan Kasal <skasal@redhat.com> - 4:5.10.1-100Stepan Kasal <skasal@redhat.com> - 4:5.10.0-87Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-86Stepan Kasal <skasal@redhat.com> - 4:5.10.0-85Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-84Stepan Kasal <skasal@redhat.com> - 4:5.10.0-83Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-82Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-81Stepan Kasal <skasal@redhat.com> - 4:5.10.0-80Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-79Stepan Kasal <skasal@redhat.com> - 4:5.10.0-78arcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-77Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-76Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.10.0-75Stepan Kasal <skasal@redhat.com> - 4:5.10.0-74Stepan Kasal <skasal@redhat.com> - 4:5.10.0-73Stepan Kasal <skasal@redhat.com> - 4:5.10.0-72Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-71Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-70Stepan Kasal <skasal@redhat.com> - 4:5.10.0-69Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-68Stepan Kasal <skasal@redhat.com> - 4:5.10.0-67Stepan Kasal <skasal@redhat.com> - 4:5.10.0-66Stepan Kasal <skasal@redhat.com> - 4:5.10.0-65Stepan Kasal <skasal@redhat.com> - 4:5.10.0-64Stepan Kasal <skasal@redhat.com> - 4:5.10.0-63Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-62Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-61Stepan Kasal <skasal@redhat.com> - 4:5.10.0-60Robert Scheck <robert@fedoraproject.org> - 4:5.10.0-59Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-58Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-57Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-56Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-55Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-54Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-53Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-52Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-51Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-50Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-49Lubomir Rintel <lkundrak@v3.sk> - 4:5.10.0-48Marcela Mašláňová <mmaslano@redhat.com> 4:5.10.0-47.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-46Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-45Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-44.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-43.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-42.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-41.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-40.fc10Stepan Kasal <skasal@redhat.com> 4:5.10.0-39.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-38Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-36Stepan Kasal <skasal@redhat.com> 4:5.10.0-35Stepan Kasal <skasal@redhat.com> 4:5.10.0-34Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-33Stepan Kasal <skasal@redhat.com> 4:5.10.0-32Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-28Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-27Stepan Kasal <skasal@redhat.com> 4:5.10.0-26Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-25Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-24Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-23Marcela Maslanova <mmaslano@redhat.com>�x�������������p������X�%�
�����������������d�$[�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������������X��%�
p����p�����B��$R����������������B�C�A��891f2a936c210ec05482aed17772483cd3fee2f9925b01662c49bfb46ab98306e188ea0604e21cb663c03ba84ff0cdb5b2939ae4f103ef1fbe7d571b699e0e7d5cfc47738dde9838c68df0e9f3e873fb1133ec758d1139fc6b2ef8ad6c4e33100a5f37fb8398f1b957a3b09d7bb6c3276dfef3fafd0fabb5c2d0df5db1d4e5df9a5fd4c3848d7bebaaa37b3da4380cb4fd7d1131721136b9e5301e559261a3caebca84850d7c62ad578e08a2e5532cc3f7f32ca3fffeb1fbbd175b17287e8ad1bbb36706a65df097012d4934f3ebb5290d9d60d825588d1ac1d46d5cdedbafd8e92be03614f6a4c537f8cd80ea616cdd15542c7dec171c78f5e0cc3b16e679a04204715bd1008699a3fd5e5d6ac408b223cf7da60f7c8bc06b5bc5ddc7a010d6fe4d3db0b49fd36e1118bfe8a9c34238ad5981addbe295a7b604b42c23a0e6a53eb32b1be6241338683a8ce6126eb7dea63fe097918bc92bc95ec34de5e198b4169b43d320d70bf61216571d4a0a37c6d9bbc62c0b9b71ead39ccc9b031ac9b44d8bed131f941a93a899b2535aa0cb0dcf13e4becaa9fd7ef2ae02bf732f7c5a5b09aa9fd66865e08ac72b90a8fc2a32146be3f2a9e2eb71d4ad61246355ad38b03e9f7f4d703a054e0bbe3c080a289997456b0ca041e2eb678043040dcf58d7aa49ee770ff1565b6b73773a33227ef0a251dcfa2c8f8834d4501d24f9125f4fe82ad965763f299df64aae7a087ac316480fae617870529536bb6aecf998a5d9366c1109b1818ea589950ad27416f98f713e43f952f8e1b5b3e23221b6801dc0f945fc27a1ee08a70acb349822a49f177d586849b98aebfc2610a7e058a2bd15857e2128f8a0f274fcc0a67105c2d78edeb3312ecabb5eddd798b89c8a1c90710961c1e65dc8a3b3e5364c51ff2b0082840a1efa7a7dbe0bb9c323cb34e707cc226e6b6a3cff96aa4ee0688a67c2be4a71a47124b0ce25ec34358642703ff05b546b2ac42b4f2081ab7610d8373dd94c6b78040cf4../../../../usr/lib64/perl5/auto/Unicode/Normalize/Normalize.so../../../../usr/lib64/perl5/auto/File/DosGlob/DosGlob.so../../../../usr/lib64/perl5/auto/Hash/Util/FieldHash/FieldHash.so../../../../usr/lib64/perl5/auto/DB_File/DB_File.so../../../../usr/lib64/perl5/auto/Hash/Util/Util.so../../../../usr/lib64/perl5/auto/Storable/Storable.so../../../../usr/lib64/perl5/auto/Compress/Raw/Bzip2/Bzip2.so../../../../usr/lib64/perl5/auto/Encode/KR/KR.so../../../../usr/lib64/perl5/auto/attributes/attributes.so../../../../usr/lib64/perl5/auto/GDBM_File/GDBM_File.so../../../../usr/lib64/perl5/auto/Fcntl/Fcntl.so../../../../usr/lib64/perl5/auto/Sys/Syslog/Syslog.so../../../../usr/lib64/perl5/auto/Data/Dumper/Dumper.so../../../../usr/lib64/perl5/auto/Sys/Hostname/Hostname.so../../../../usr/lib64/perl5/auto/Encode/EBCDIC/EBCDIC.so../../../../usr/lib64/perl5/auto/Math/BigInt/FastCalc/FastCalc.so../../../../usr/lib64/perl5/auto/Encode/Symbol/Symbol.so../../../../usr/lib64/perl5/auto/PerlIO/mmap/mmap.so../../../../usr/lib64/perl5/auto/mro/mro.so../../../../usr/lib64/perl5/auto/MIME/Base64/Base64.so../../../../usr/lib64/perl5/auto/Tie/Hash/NamedCapture/NamedCapture.so../../../../usr/lib64/perl5/auto/Encode/Unicode/Unicode.so../../../../usr/lib64/perl5/auto/threads/threads.so../../../../usr/lib64/perl5/auto/IPC/SysV/SysV.so../../../../usr/lib64/perl5/auto/B/B.so../../../../usr/lib64/perl5/auto/Encode/TW/TW.so../../../../usr/lib64/perl5/auto/Unicode/Collate/Collate.so../../../../usr/lib64/perl5/auto/SDBM_File/SDBM_File.so../../../../usr/lib64/perl5/auto/Encode/CN/CN.so../../../../usr/lib64/perl5/auto/Time/HiRes/HiRes.so../../../../usr/lib64/perl5/auto/File/Glob/Glob.so../../../../usr/lib64/perl5/auto/Time/Piece/Piece.so../../../../usr/lib64/perl5/auto/Encode/Encode.so../../../../usr/lib64/perl5/auto/threads/shared/shared.so../../../../usr/lib64/perl5/auto/I18N/Langinfo/Langinfo.so../../../../usr/lib64/perl5/auto/Cwd/Cwd.so../../../../usr/lib64/perl5/auto/Compress/Raw/Zlib/Zlib.so../../../../usr/lib64/perl5/auto/Devel/Peek/Peek.so../../../../usr/lib64/perl5/auto/NDBM_File/NDBM_File.so../../../../usr/lib64/perl5/auto/Socket/Socket.so../../../../usr/lib64/perl5/auto/re/re.so../../../../usr/lib64/perl5/auto/Encode/JP/JP.so../../../../usr/lib64/perl5/auto/ODBM_File/ODBM_File.so../../../../usr/lib64/perl5/auto/Opcode/Opcode.so../../../../usr/bin/perl../../../../usr/bin/perl5.26.3../../../../usr/lib64/perl5/auto/Digest/SHA/SHA.so../../../../usr/lib64/perl5/auto/Digest/MD5/MD5.so../..�x�������������`�����X��%�
��������Ș����F��$V����������������F�G�E��bf468a94106b2c8e384a11ae342979c3571ce9db8834861aa48569ebfa007ae5519b79f5714beb93d57795820e76375bd2199f1c75d43573fc99289e09b58c3fb5e2304de546e8edf4203153f3327ac83e18dea1c18f13b510e61e5340e754ef29011e137fdc6d282b8695fbfe65ee750e04e8415e8d14866b9c4ca02d8100008d3fdfc2c8de9635cd3f586b463cc3c17f727b01a7f6b247f4dab610e50c60be66d802d9ba9a562824d1a0fd976ae88298eb8ff24db76cf632abd4bff86b8bcb5dc3a8ccc215445a6c7791051ed7a8f608b32985e068a6d3169396353a0a916a57f21fc78f7b8498a7cf82d64b2664645c80ca890885c9c0921904510e47118dfba8a01583468de50cc8983c37922ebb3e12166dbcb9d38aa45219722a17917a10c4e243544a4deb246ff8c599540a82d32b1e835dc7b10e21bb9431bc8c41ed6c311e13392af57e99c4580d3ec867b3778e62fdd916acf49d3687d22a25ffd243de24326610c8ae3afb606f9758c33492d40531482f4a670b7a915b35e4595bd8d07881b94e18afaac95a5ecadbca4c38be38e2e2e5c994824efca2e9025c8ecefb4c11157c2a2015f6dfb4a2792214fa5e2bf3ac404c9a915001a649413535d656d4781c68c5ead9e1b838f025fec45288b25c97261113aee643b664feca2c9d14cfc90d3527fc0bf6931c75000cf941d1f8c914e83dfb21ba348d5d80248e1d0d8ba0dea782af869b4a87d7553436e4c3128790787bfa66a42971002221d7020a6c43f41efba9b68c497e04bef8b7cb1b9cef63e520635a2096d57d44e8096b1b9f5ef4c5bfb7ad1ac6c5da21c2324d980fa6ec042971774615e5a90a0d31555578a7f431518afb464756dd444f0fbf4d2f116c461fe15b77474f54a7792cd752f9226bebc8cc1dec441ba17cf8f071a6beb1a5e7981524d97a3643abdef1bba6bd7f41d47dec02402b5a0136b84f7c782de93ad9fc1fc0631e3a2b0e07f61fa1c4cc98590e6855154f1b44f76a73478fd97fbc7fa8de924cc073858ba7efbbb73f07b70ed14e38c667f24dfcfab9969d20815e73e3a53497ab5ea8fc6f36eb8d13e68896db391141028bae80feac3af524af64c50bd078e14649f2b75b50b551eaf5bd3b67b2df831644740e43ae32d8dde91517f1676f294b82191a38b945e4cb1012943b2b919fff04c30592ff83665735da4a223d2766fe75be79e03ad90ac24294ffd2639011c8611c30407ecac8d9d964df251b988af35060e3f14f51e58c62fe97252a5c1795da769dfefc6356793b083c9e449eb2df413b86ac2de3588f7b7c0355495ad4c54d3c330c69ad12090d0ca6628362e9b202fbf831d1b983a7d6041fddb681ca59b33fd008e9f80a8942d94a1203885110181cc5a9d6b0b1954be791e07036b89fc68cd45f6c540c5d4c6a63bf22006d61e0c2880f8db58e2f12efd1fad0184806bd112c6abed02539dfec0d5fdadfa63ff8142bd12cb6d132d4df87c5ecc7781fdd74541cfa55a5f3285d15aaa952f7aeece21d736b8b9345626c9bebfa1265a44edc86ccd1b694d16e97f13e79d9f9a9f5b5587954a107abe0490c7cdd562cb537a8b6af8f348527cba8d075ba747cf4afa9c5d2dc16bbcbfd1b45832647332c1132f6a75df5a0cebc45386075eb8c3969071819a488f8578038c6531de2a622f168e8b57c10140632972b997fdc9877ec60181f2efa625197c38b466b4819879672630bd849ed8acec502e6555e1913525f3f1d9b34fc94e634623e82414f72ed8fe613b82acfe800cb66ad80a816b951b99c894f701eac08b79265ff2ccbede0954f97a537d03fb78801ed645861219ec21cc059ecfeb3bc7c6e349734dd0344a06a724781a54c17811d69ed77da685153447312b3322627a7f28b432e1a9ab202bf89a0352309f274b039a4339eb0d7a98b14de828e10c92d697d1b7c7ab1870bc08f00569e2e5e66395de86ff7bd8e984ee828638d9d17515c406d093eb28723dfb6b0f12dc61926e59bf5ea4a0d97316fa237eede5fbd98ab28c7838229423df1a7adaf7ba3503fd8f5ad3d856fa6967cc7b2ad72eec3c2c627120e8396be9223522d733f57c9d1c5ad14a3cf820b437281f5592dea7f198797868b7206960af9124b51455cd92fd1929595f1d1a3234f91d7e4ba0e4018fb822bece4981c6baabe33846da19b179beace0f3fa15263f2fbaab6927932fbdf5dc7be936cc2e577120783a36a4992c15314f0aa12e565ea59a4a3a332d8fefa40a654f9482014c145f165bef3d065a59daee55a64d7bc642e1bdbcd01b125a860cfcc0f3f4700ef7a635655b0a7e2eae6cb78c55fab9bbf77aead9fb466b79a143dd37334541d900974380dd06eb8e2f924eb19d9bda096d077878654f000befe314c2890c3a4be204d7b8703b6a4dfcb40867ab4579d859f98e4fed714e0aa2dad96f28e9207a696f9f308a89a286a3b0958bbd3207217dce4917df140c21d3ed0f408882bf70d7bc8a49a2589e0f23d61d03c8795727c40beef761eb78c1d76d334c5c7e4d32bdf1a56c9213b061568d1fe2698e1dc6f8cea0074f746bb775fc9422c2b53279da9f23f9ecc4e932629fb8c401e44c71d66a4ee043692d225d9bbc01be51f0e5051b0cdc057cbfe3af4cfd2cc899d9399b809be16d0797decabe63cc647f7985a605ae60de860be1a439c30563d90f60be77f44dea803ca765001cbcbe92d7e0044c7ebbbd120893410ce7bd76a0455c3421938496dbb924cc00a8a562a42c8c69b0894067c6ce1a9403ba07bbd502edcaa7b047c864d9a83f566ec30488�x��������������n�����X��%�
�g���@�����&��$6����������������&�'�%��e.3pm.gzPOSIX.3pm.gzPerlIO.3pm.gzPerlIO::encoding.3pm.gzPerlIO::mmap.3pm.gzPerlIO::scalar.3pm.gzPerlIO::via.3pm.gzSDBM_File.3pm.gzSafe.3pm.gzSearch::Dict.3pm.gzSelectSaver.3pm.gzSymbol.3pm.gzSys::Hostname.3pm.gzTerm::Complete.3pm.gzTerm::ReadLine.3pm.gzText::Abbrev.3pm.gzThread.3pm.gzThread::Semaphore.3pm.gzTie::Array.3pm.gzTie::File.3pm.gzTie::Handle.3pm.gzTie::Hash.3pm.gzTie::Hash::NamedCapture.3pm.gzTie::Memoize.3pm.gzTie::RefHash.3pm.gzTie::Scalar.3pm.gzTie::StdHandle.3pm.gzTie::SubstrHash.3pm.gzTime::gmtime.3pm.gzTime::localtime.3pm.gzTime::tm.3pm.gzUNIVERSAL.3pm.gzUnicode::UCD.3pm.gzUser::grent.3pm.gzUser::pwent.3pm.gzarybase.3pm.gzattributes.3pm.gzautouse.3pm.gzbase.3pm.gzblib.3pm.gzbytes.3pm.gzcharnames.3pm.gzdeprecate.3pm.gzdiagnostics.3pm.gzencoding::warnings.3pm.gzfeature.3pm.gzfields.3pm.gzfiletest.3pm.gzif.3pm.gzless.3pm.gzlib.3pm.gzlocale.3pm.gzmro.3pm.gzops.3pm.gzoverload.3pm.gzoverloading.3pm.gzsigtrap.3pm.gzsort.3pm.gzsubs.3pm.gzvars.3pm.gzvmsish.3pm.gzwarnings::register.3pm.gzAnyDBM_File.pmAutoLoader.pmAutoSplit.pmBDeparse.pmOp_private.pmBenchmark.pmCORE.podClassStruct.pmConfigExtensions.pmDB.pmDBM_FilterDBM_Filter.pmcompress.pmencode.pmint32.pmnull.pmutf8.pmDirHandle.pmDumpvalue.pmEnglish.pmExtUtilsConstantConstant.pmBase.pmProxySubs.pmUtils.pmXS.pmtypemapFileBasename.pmCompare.pmCopy.pmFind.pmstat.pmFileCache.pmFileHandle.pmFindBin.pmGetoptStd.pmI18NCollate.pmLangTagsLangTags.pmDetect.pmList.pmIPCOpen2.pmOpen3.pmInternals.podNEXT.pmNethostent.pmnetent.pmprotoent.pmservent.pmPerlIO.pmPodFunctions.pmSafe.pmSearchDict.pmSelectSaver.pmSymbol.pmTermComplete.pmReadLine.pmTextAbbrev.pmThreadThread.pmSemaphore.pmTieArray.pmFile.pmHandle.pmHash.pmMemoize.pmRefHash.pmScalar.pmStdHandle.pmSubstrHash.pmTimegmtime.pmlocaltime.pmtm.pmUNIVERSAL.pmUnicodeUCD.pmUsergrent.pmpwent.pm_charnames.pmautouse.pmbase.pmblib.pmbytes.pmbytes_heavy.plcharnames.pmdeprecate.pmdiagnostics.pmdumpvar.plencodingwarnings.pmfeature.pmfields.pmfiletest.pmif.pmless.pmlocale.pmmeta_notation.pmoverloadoverload.pmnumbers.pmoverloading.pmperl5db.plpodperl.podperl5004delta.podperl5005delta.podperl5100delta.podperl5101delta.podperl5120delta.podperl5121delta.podperl5122delta.podperl5123delta.podperl5124delta.podperl5125delta.podperl5140delta.podperl5141delta.podperl5142delta.podperl5143delta.podperl5144delta.podperl5160delta.podperl5161delta.podperl5162delta.podperl5163delta.podperl5180delta.podperl5181delta.podperl5182delta.podperl5184delta.podperl5200delta.podperl5201delta.podperl5202delta.podperl5203delta.podperl5220delta.podperl5221delta.podperl5222delta.podperl5223delta.podperl5224delta.podperl5240delta.podperl5241delta.podperl5242delta.podperl5243delta.podperl5244delta.podperl5260delta.podperl5261delta.podperl5262delta.podperl5263delta.podperl5280delta.podperl561delta.podperl56delta.podperl581delta.podperl582delta.podperl583delta.podperl584delta.podperl585delta.podperl586delta.podperl587delta.podperl588delta.podperl589delta.podperl58delta.podperlaix.podperlamiga.podperlandroid.podperlapi.podperlapio.podperlartistic.podperlbook.podperlboot.podperlbot.podperlbs2000.podperlcall.podperlce.podperlcheat.podperlclib.podperlcn.podperlcommunity.podperlcygwin.podperldata.podperldbmfilter.podperldebguts.podperldebtut.podperldebug.podperldelta.podperldeprecation.podperldiag.podperldos.podperldsc.podperldtrace.podperlebcdic.podperlembed.podperlexperiment.podperlfork.podperlform.podperlfreebsd.podperlfunc.podperlgit.podperlgpl.podperlguts.podperlhack.podperlhacktips.podperlhacktut.podperlhaiku.podperlhist.podperlhpux.podperlhurd.podperlintern.podperlinterp.podperlintro.podperliol.podperlipc.podperlirix.podperljp.podperlko.podperllexwarn.podperllinux.podperllocale.podperllol.podperlmacos.podperlmacosx.podperlmod.podperlmodinstall.podperlm�x������'������^�����XJ&�
 �����i������$��������������������om> - 0.6.21-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.20-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.20-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.19-3Jaroslav Mracek <jmracek@redhat.com> - 0.6.19-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.19-1Peter Robinson <pbrobinson@fedoraproject.org> 0.6.15-6Vít Ondruch <vondruch@redhat.com> - 0.6.15-5Dan Horák <dan[at]danny.cz> - 0.6.15-4Jaroslav Mracek <jmracek@redhat.com> - 0.6.15-3Michal Luscon <mluscon@redhat.com> - 0.6.15-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.15-1Jaroslav Mracek <jmracek@redhat.com> - 0.6.14-7Adam Williamson <awilliam@redhat.com> - 0.6.14-6Adam Williamson <awilliam@redhat.com> - 0.6.14-5Adam Williamson <awilliam@redhat.com> - 0.6.14-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.14-3Michal Luscon <mluscon@redhat.com> - 0.6.14-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.14-1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.12-1Jan Silhan <jsilhan@redhat.com> - 0.6.11-3Adam Williamson <awilliam@redhat.com> - 0.6.11-2Jan Silhan <jsilhan@redhat.com> - 0.6.11-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.10-2Jan Silhan <jsilhan@redhat.com> - 0.6.10-1Jan Silhan <jsilhan@redhat.com> - 0.6.8-3Vít Ondruch <vondruch@redhat.com> - 0.6.8-2Richard Hughes <richard@hughsie.com> - 0.6.8-2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.4-3Jan Silhan <jsilhan@redhat.com> - 0.6.4-2Aleš Kozumplík <akozumpl@redhat.com> - 0.6.4-1Jan Silhan <jsilhan@redhat.com> - 0.6.4-0.git2a5c1c4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.1-2.git6d968f1Aleš Kozumplík <ales@redhat.com> - 0.6.1-1.git6d968f1Jan Silhan <jsilhan@redhat.com> - 0.6.1-0.gitf78f5deVít Ondruch <vondruch@redhat.com> - 0.6.0-0.git05baf54.1Jan Silhan <jsilhan@redhat.com> - 0.6.0-0.git05baf54Aleš Kozumplík <akozumpl@redhat.com> - 0.4.1-1.gitbcedc98Aleš Kozumplík <akozumpl@redhat.com> - 0.4.1-0.gita8e47f1Zdenek Pavlas <zpavlas@redhat.com> - 0.4.0-2.git4442b7fAleš Kozumplík <akozumpl@redhat.com> - 0.4.0-1.gitd49d319Petr Pisar <ppisar@redhat.com> - 0.3.0-9.gita59d11dAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-8.gita59d11dAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-7.git228d412Petr Pisar <ppisar@redhat.com> - 0.3.0-6.git228d412Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-5.git228d412Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-4.git209e9cbAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-3.git7399ad1Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-2.git7399ad1Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-1.gite372b78Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.2.3-2.gitf663ca2Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-17.git6c9d3ebAleš Kozumplík <akozumpl@redhat.com> - 0.0.0-16.git1617994Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-15.git1617994Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.0.0-14.git1617994Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-13.git1617994.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-12.git1617994.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-11.gitd39a42b.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-9.git8cf7650.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-7.gitaf1465a2.el8Karel Klíč <kklic@redhat.com> - 0.0.0-6.git80afaf7.el8Karel Klíč <kklic@redhat.com> - 0.0.0-5.git80afaf7.el8Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-4.git80afaf7.el8Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-3.git80afaf7.el8Karel Klíč <kklic@redhat.com> - 0.0.0-2.git857fe28.el8Karel Klíč <kklic@redhat.com> - 0.0.0-1.git857fe28- Backport Allow to break arch lock-step on erase operations (RhBug:2172288,2172292)- Backport Treat condition both as positive and negative literal in pool_add_pos_literals_complex_dep
  (RhBug:2185061,2190136)- Drop patch to fix pick of old build (RhBug:2150300,RhBug:2151551)- Allow accessing toolversion at runtime and increase it- Add support for storing user data in a solv file
- Improve choice rule generati�x�������������xM�����XE�$�
�����h���ZX�����$J����������������ZXYX[X� Yuichi Nakamura.
        * Merged restorecon -i and -o - support from Karl MacMillan.
        * Merged semanage/seobject fix from Dan Walsh.
        * Merged fixfiles -R and verify changes from Dan Walsh.- Separate out newrole into its own package- Update to upstream
        * Merged newrole auditing of failures due to user actions from
          Michael Thompson.- Pass -i qualifier to restorecon  for fixfiles -R
- Update translations- Remove recursion from fixfiles -R calls
- Fix semanage to verify prefix- More translations
- Compile with -pie- Add translations
- Fix audit2allow -l- Rebuild- Update to upstream
- Change -o to take "-" for stdout- Add -h support for genhomedircon- Fix fixfiles handling of -o- Make restorecon return the number of changes files if you use the -n flag- Change setfiles and restorecon to use stderr except for -o flag
- Also -o flag will now output files- Put back Erich's change- Remove recursive switch when using rpm- Fix fixfiles to handle multiple rpm and make -o work- Apply patch- Security fixes to run python in a more locked down manner
- More Translations
- Update to upstream
        * Merged fix for restorecon // handling from Erich Schubert.
        * Merged translations update and fixfiles fix from Dan Walsh.- Change scripts to use /usr/sbin/python- Add -i qualified to restorecon to tell it to ignore files that do not exist
- Fixfiles also modified for this change- Ignore sigpipe- Fix init script and add translations- Update to upstream
        * Merged fix for restorecon symlink handling from Erich Schubert.- Update to upstream
        * Merged semanage local file contexts patch from Chris PeBenito.
- Fix fixfiles log creation
- More translations- Update to upstream
        * Merged patch from Dan Walsh with:
                * audit2allow: process MAC_POLICY_LOAD events
                * newrole: run shell with - prefix to start a login shell
                * po: po file updates
                * restorecond: bail if SELinux not enabled
                * fixfiles: omit -q
                * genhomedircon:  fix exit code if non-root
                * semodule_deps:  install man page
        * Merged secon Makefile fix from Joshua Brindle.
        * Merged netfilter contexts support patch from Chris PeBenito.- Fix audit2allow to handle reload of policy- Stop restorecond init script when selinux is not enabled- Update to upstream
        * Merged restorecond size_t fix from Joshua Brindle.
        * Merged secon keycreate patch from Michael LeMay.
        * Merged restorecond fixes from Dan Walsh.
          Merged updated po files from Dan Walsh.
        * Merged python gettext patch from Stephen Bennett.
        * Merged semodule_deps from Karl MacMillan.- Change newrole to exec a login shell to prevent suspend.- Report error when selinux not enabled in restorecond- Fix handling of restorecond- Fix creation of restorecond pidfile- Update translations
- Update to new GCC- Add verbose flag to restorecond and update translations- Update to upstream
        * Lindent.
        * Merged patch from Dan Walsh with:
          * -p option (progress) for setfiles and restorecon.
          * disable context translation for setfiles and restorecon.
          * on/off values for setsebool.
        * Merged setfiles and semodule_link fixes from Joshua Brindle.- Add progress indicator on fixfiles/setfiles/restorecon- Don't use translations with matchpathcon- Prompt for selinux-policy-devel package in audit2allow- Allow setsebool to use on/off
- Update translations- Update to upstream
        * Merged fix for setsebool error path from Serge Hallyn.
        * Merged patch from Dan Walsh with:
        *    Updated po files.
        *    Fixes for genhomedircon and seobject.
        *    Audit message for mass relabel by setfiles.- Update audit mass relabel to only compile in when audit is installed.- Update to required versions
- Update translation- Fix shell selection- Add BuildRequires for gettext* Updated fixfiles script for new set�x�������������@=�����X�%�
���z�$j����������������zy�� �v�9̵��RK)��O����y���u;����s�	���{AL��ƹ�(��KT�z���S����A�Q�>g	�Ssl��شu�M>�Kn�B�g)5�Th�Á��������~ɔAq�6�K��]�%*פ�����ͥ7���ݝN�l�&��_fSז=#�+�#[ނI����]�ʲ��S~�,���KН��H�q}�"P�)�������O�����$%ـ·��T�]���"�[�Ͷ[�8*ZLC�ϭ�XB0��==����o�G�o��w��`ee��~Ȧ�5S/�|�,���x(씿�-�j�<�8H��H'�=L�'�~������-��pi�tƾ�i�v�9|UBl�a%��"
�|���A=��B�|+��
��wIu����Jo��X�����;h�A��w�!�V���!�|��ւ����$u~OYL�V�U���!w_`ªɂ끁Y�Ƌ"r��f��<��\\A�B66a2d28cdaa1ee01096f142b2104246cfcc15cb93ed1273b4b05c23611bff31d2d1ddcc3ceb815c2914fe657302790d1a164d6fefX�-��$fX�0@@�@@;�@�@@�@@�@@@@��@��@��@��?٭�?�\@?ĕ�?���?�C@?��?��?�q@?��@?��?��?�Y@?r�?q�@?q�@?hL�?Xz�?%@?%@?%@?�@?'@?�?	`�?�?�?&@>�v�>��@>G�@>.��=��=�K@=��=�=�=���=���=0@=Jt@=E.@=�@=r@=
�@<��<�@<�@<��<��<�@<�@<��@<m@<m@<t�@<c��<bl@<Y1�<N��;��;��@;�"@;�;֭@;�
@;��;��@;���;�O@;���;��@;�f@;��;�q�;� @;� @;�@;�e@;��;��@;�*�;���;w�@;s�;r{@;I��;DV�;A��;<m�;7'�;��:��@:�S�:�@:ͯ�:�^@:��:�:�:�F@:�@:��@:�t@:�"�:��@:���:�E@:���:�
�:�@:�!�:��@:�8�:~��:v��:mr@:l �:j�@:h,@:e�@:^�:\N�:Z�@:=�@:6@:&A@:$�:#�@:c�:@:�@9��@9�9�?@9�V@9ݾ�9��9�x�9��9�w�9�1�9�k@9�k@9��9��@9��@9�j@9}�@9|/�9y��9x;@9l]�9l]�9k@9`�@9N@9Gs�9;�@9;�@98�@96P@9�9�@8��8��8�m�8�y@8��@8p�@8@7�g�7�s@7�!�7�{�7{X@7w�7&@7�7�@7�@71�7=@7�@7H�6�k@6�v�6�%@6�<@6��6�@6��6�r�6zC�Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-33Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-32Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-31Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-30Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-27Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-26Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-25Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-24Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-22Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-21Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-20Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-19Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-18Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-17Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-16Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-15Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-14Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-13Peter Robinson <pbrobinson@redhat.com> - 1.3.1-12Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-11Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-10Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-9Tomáš Mráz <tmraz@redhat.com> 1.3.1-8Tomáš Mráz <tmraz@redhat.com> 1.3.1-6Tomáš Mráz <tmraz@redhat.com> 1.3.1-5Tomáš Mráz <tmraz@redhat.com> 1.3.1-4Tomáš Mráz <tmraz@redhat.com> 1.3.1-3Tomáš Mráz <tmraz@redhat.com> 1.3.1-1Tomáš Mráz <tmraz@redhat.com> 1.3.1-1Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-10Tomáš Mráz <tmraz@redhat.com> 1.3.0-9Björn Esser <besser82@fedoraproject.org> - 1.3.0-8Tomáš Mráz <tmraz@redhat.com> 1.3.0-7Tomáš Mráz <tmraz@redhat.com> 1.3.0-6Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-5Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-4Tomáš Mráz <tmraz@redhat.com> 1.3.0-3Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-2Tomáš Mráz <tmraz@redhat.com> 1.3.0-1Tomáš Mráz <tmraz@redhat.com> 1.2.1-8Tomáš Mráz <tmraz@redhat.com> 1.2.1-7Tomáš Mráz <tmraz@redhat.com> 1.2.1-6Tomáš Mráz <tmraz@redhat.com> 1.2.1-5Fedora Release Engineering <releng@fedoraproject.org> - 1.2.1-4Tomáš Mráz <tmraz@redhat.com> 1.2.1-3Tomáš�x��������������,�����X�b%�
�R�������td�$d����������������tdudsd�EC_KEY_get0_group.3ssl.gzEC_KEY_get0_private_key.3ssl.gzEC_KEY_get0_public_key.3ssl.gzEC_KEY_get_conv_form.3ssl.gzEC_KEY_get_enc_flags.3ssl.gzEC_KEY_get_ex_data.3ssl.gzEC_KEY_get_ex_new_index.3ssl.gzEC_KEY_get_flags.3ssl.gzEC_KEY_get_method.3ssl.gzEC_KEY_key2buf.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new_by_curve_name.3ssl.gzEC_KEY_oct2key.3ssl.gzEC_KEY_oct2priv.3ssl.gzEC_KEY_precompute_mult.3ssl.gzEC_KEY_priv2buf.3ssl.gzEC_KEY_priv2oct.3ssl.gzEC_KEY_set_asn1_flag.3ssl.gzEC_KEY_set_conv_form.3ssl.gzEC_KEY_set_enc_flags.3ssl.gzEC_KEY_set_ex_data.3ssl.gzEC_KEY_set_flags.3ssl.gzEC_KEY_set_group.3ssl.gzEC_KEY_set_method.3ssl.gzEC_KEY_set_private_key.3ssl.gzEC_KEY_set_public_key.3ssl.gzEC_KEY_set_public_key_affine_coordinates.3ssl.gzEC_KEY_up_ref.3ssl.gzEC_METHOD_get_field_type.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_bn2point.3ssl.gzEC_POINT_clear_free.3ssl.gzEC_POINT_cmp.3ssl.gzEC_POINT_copy.3ssl.gzEC_POINT_dbl.3ssl.gzEC_POINT_dup.3ssl.gzEC_POINT_free.3ssl.gzEC_POINT_get_Jprojective_coordinates_GFp.3ssl.gzEC_POINT_get_affine_coordinates.3ssl.gzEC_POINT_get_affine_coordinates_GF2m.3ssl.gzEC_POINT_get_affine_coordinates_GFp.3ssl.gzEC_POINT_hex2point.3ssl.gzEC_POINT_invert.3ssl.gzEC_POINT_is_at_infinity.3ssl.gzEC_POINT_is_on_curve.3ssl.gzEC_POINT_make_affine.3ssl.gzEC_POINT_method_of.3ssl.gzEC_POINT_mul.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_oct2point.3ssl.gzEC_POINT_point2bn.3ssl.gzEC_POINT_point2buf.3ssl.gzEC_POINT_point2hex.3ssl.gzEC_POINT_point2oct.3ssl.gzEC_POINT_set_Jprojective_coordinates_GFp.3ssl.gzEC_POINT_set_affine_coordinates.3ssl.gzEC_POINT_set_affine_coordinates_GF2m.3ssl.gzEC_POINT_set_affine_coordinates_GFp.3ssl.gzEC_POINT_set_compressed_coordinates.3ssl.gzEC_POINT_set_compressed_coordinates_GF2m.3ssl.gzEC_POINT_set_compressed_coordinates_GFp.3ssl.gzEC_POINT_set_to_infinity.3ssl.gzEC_POINTs_make_affine.3ssl.gzEC_POINTs_mul.3ssl.gzEC_get_builtin_curves.3ssl.gzEDIPARTYNAME_free.3ssl.gzEDIPARTYNAME_new.3ssl.gzENGINE_add.3ssl.gzENGINE_add_conf_module.3ssl.gzENGINE_by_id.3ssl.gzENGINE_cleanup.3ssl.gzENGINE_cmd_is_executable.3ssl.gzENGINE_ctrl.3ssl.gzENGINE_ctrl_cmd.3ssl.gzENGINE_ctrl_cmd_string.3ssl.gzENGINE_finish.3ssl.gzENGINE_free.3ssl.gzENGINE_get_DH.3ssl.gzENGINE_get_DSA.3ssl.gzENGINE_get_RAND.3ssl.gzENGINE_get_RSA.3ssl.gzENGINE_get_cipher.3ssl.gzENGINE_get_cipher_engine.3ssl.gzENGINE_get_ciphers.3ssl.gzENGINE_get_cmd_defns.3ssl.gzENGINE_get_ctrl_function.3ssl.gzENGINE_get_default_DH.3ssl.gzENGINE_get_default_DSA.3ssl.gzENGINE_get_default_RAND.3ssl.gzENGINE_get_default_RSA.3ssl.gzENGINE_get_destroy_function.3ssl.gzENGINE_get_digest.3ssl.gzENGINE_get_digest_engine.3ssl.gzENGINE_get_digests.3ssl.gzENGINE_get_ex_data.3ssl.gzENGINE_get_ex_new_index.3ssl.gzENGINE_get_finish_function.3ssl.gzENGINE_get_first.3ssl.gzENGINE_get_flags.3ssl.gzENGINE_get_id.3ssl.gzENGINE_get_init_function.3ssl.gzENGINE_get_last.3ssl.gzENGINE_get_load_privkey_function.3ssl.gzENGINE_get_load_pubkey_function.3ssl.gzENGINE_get_name.3ssl.gzENGINE_get_next.3ssl.gzENGINE_get_prev.3ssl.gzENGINE_get_table_flags.3ssl.gzENGINE_init.3ssl.gzENGINE_load_builtin_engines.3ssl.gzENGINE_load_private_key.3ssl.gzENGINE_load_public_key.3ssl.gzENGINE_new.3ssl.gzENGINE_register_DH.3ssl.gzENGINE_register_DSA.3ssl.gzENGINE_register_RAND.3ssl.gzENGINE_register_RSA.3ssl.gzENGINE_register_all_DH.3ssl.gzENGINE_register_all_DSA.3ssl.gzENGINE_register_all_RAND.3ssl.gzENGINE_register_all_RSA.3ssl.gzENGINE_register_all_ciphers.3ssl.gzENGINE_register_all_complete.3ssl.gzENGINE_register_all_digests.3ssl.gzENGINE_register_ciphers.3ssl.gzENGINE_register_complete.3ssl.gzENGINE_register_digests.3ssl.gzENGINE_remove.3ssl.gzENGINE_set_DH.3ssl.gzENGINE_set_DSA.3ssl.gzENGINE_set_RAND.3ssl.gzENGINE_set_RSA.3ssl.gzENGINE_set_ciphers.3ssl.gzENGINE_set_cmd_defns.3ssl.gzENGINE_set_ctrl_function.3ssl.gzENGINE_set_default.3ssl.gzENGINE_set_default_DH.3ssl.gzENGINE_set_default_DSA.3ssl.gzENGINE_set_default_RAND.3ssl.gzENGINE_set_default_RSA.�x�������������0�����X�&�
��������������)U�$9����������������)U:�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>andling (rh #543088) (rh #560742)
- core: better handling of /etc/hosts if hostname was already added by the user
- applet: crash less on D-Bus property errors (rh #557007)
- applet: fix crash entering wired 802.1x connection details (rh #556763)- core: validate the autostart .desktop file
- build: fix nmcli for the stricter ld (fixes FTBFS)
- build: fix nm-connection-editor for the stricter ld (fixes FTBFS)
- applet: don't autostart in KDE on F13+ (#541353)- core: add Bluetooth Dial-Up Networking (DUN) support (rh #136663)
- core: start DHCPv6 on receipt of RA 'otherconf'/'managed' bits
- nmcli: allow enable/disable of WiFi and WWAN- ifcfg-rh: read and wri��L���L���L���L���L���L����(X�����g��o�Q�,-���p�6��o�h!�1��������d�(���N(�����1X�F���h.���W���A&�L]�����3�Aj���w�
ҐJ����A!����fW��
Ґ����A�=����U@���rEWi�
Ґu����A�d����r�V�>��A�������d���r�V,�����r���r������r�����,�&�����r�^�����<�P���%���,������P��� �����r0��X3��6���r'(9�M�������P��X3�n�����r�|��M�d������x�4��X3�����r���M�ŹH����a����X3�v0��T''�V��"����(y���X$��X3w�����?��X3��L9�����+��X3ԩt�����$��&ߢ`�����,L�p8�ˢ���P�Q2���p8�6��,�T''HU< ��P�%W����ed�Dn�T''1UT0���3����T''U������h#~T''�T�}���W|���T("y����x���T�*u��_,or���T��qjU|P��o�mts#X2n��=��n���D�@m���T<Dm�mt%#��j��$}j�ЖH�h�mt�"x�f��%f�Ж4 9d����$bBIx���a�ЖGH `����?^BIW�L�]���H��]���H3ZC�X����6VC$)Tn��gX4R���H<Rt��H7QC�.P���03Nt݄���IC�%�0H��T�>Ft�7�uEC�=�D�u���C�܋.�@RB��CT'BC�V�@�u,��-?�܋T:2>��*�;>t�%y(�=C�th <�܋*:�=:��`*:t�c���9��
()9C�}�8���?6t�(��5C�A4���|2t��4h1C��0�u*;</tݐ`-C`',��d��)C���&(��Q4%�(���$��t|G"��8 U!��c�H�W?
@��%���z�x�X�>� ������pQ���h��[���Y�t�
���G���h	��Hx��� ]��wx+�c�e�\;�͎B`8��ق�d*�x�������������������X��%�
������P���s!�$c����������������s!r!t!�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x����� �������������X)�$�
�������������b�$r����������������bac�util-linux/v2.28/v2.28.1-ReleaseNotes- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- fix #1234317 - CD / DVD are rarely automounted- refresh login-lastlog-create.patch- upgrade to stable v2.28- fix libblkid- upgrade to v2.28-rc2- upgrade to v2.28-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28-ReleaseNotes
- add patch to fix broken swapon
- add subpackage util-linux-user (utils with dependence on libuser)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- fix #1299255 - boot.iso (from 20160117 Rawhide compose) incorrectly detected as minix FS- fix #1259745 - Can't start installation in Rawhide or F23 recent development images- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- upgrade to v2.27.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27.1-ReleaseNotes- upgrade to v2.27- upgrade to v2.27-rc2- improve version usage in source url- fix #1251320 - rfe: please change login to not add /bin:/sbin to $PATH
- apply patches from Lokesh Mandvekar to make spec file more portable- upgrade to v2.27-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27-ReleaseNotes
- add lsipc- fix dates in the spec file- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- upgrade to stable release 2.26.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.26/v2.26.2-ReleaseNotes- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- upgrade to stable release 2.26- fix setarch build on PPC- upgrade to 2.26-rc2- fix 1182778 - remount causes ro / and /home on boot- upgrade to 2.26-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.26/v2.26-ReleaseNotes
- build with -pie for uuidd
- new command zramctl- fix #1168490 - CVE-2014-9114 util-linux: command injection flaw in blkid- upgrade to stable 2.25.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.2-ReleaseNotes- upgrade to stable 2.25.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.1-ReleaseNotes- upgrade to release 2.25.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.1-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- remove fstrim unit files from uuidd subpackage- upgrade to stable release 2.25- upgrade to release 2.25-rc2- Fix libblkid's squashfs probe return checking.
  Related: rhbz#1112315- upgrade to release 2.25-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Changes/Python_3.4- fix #1094935 - script and/or trigger should not directly enable systemd units- fix #1090638 - remove pam_securetty.so from .pamd files- use systemd macroized scriptlets (#850355)- upgrade to stable release 2.24.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.24/v2.24.2-ReleaseNotes- use rpm autosetup- upgrade to stable release 2.24.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.24/v2.24.1-ReleaseNotes- fix #1031262 - lsblk -D segfault- upgrade to upstream release v2.24
- remove nologin (merged upstream)
- fix #1022217 - fdisk mishandles GPT corruption- upgrade to upstream release v2.24-rc1
- add python3 libmount binding- fix #1005566 - recount_geometry: Process /usr/sbin/fdisk was killed by signal 8 (SIGFPE)
- fix #1005194 - su generates incorrect log entries- refresh and rename patches
- fix #987787 - Remove lastlogin from su
- fix #950497 - problem umounting loop device
- fix #921498 - multiple internal testsuite failures- fix 990083 - su doesn't work with pam_ecryptfs- upgrade to stable release 2.23.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.23/v2.23.2-ReleaseNotes- fix #972457 - agetty idle I/O polling causes elevated CPU usage- fix #962145 - in.telnetd immediately closes connection- upgrade to 2.23.1
- backport agetty --local-line path- upgrade to 2.23
- add --wit�x��������������������X��%�
hW��������x!�$h����������������x!w!y!�sar <ppisar@redhat.com> - 4:5.14.2-198Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-197Petr Pisar <ppisar@redhat.com> - 4:5.14.2-196Petr Pisar <ppisar@redhat.com> - 4:5.14.2-195Iain Arnell <iarnell@gmail.com> 4:5.14.2-194Petr Pisar <ppisar@redhat.com> - 4:5.14.2-193Petr Pisar <ppisar@redhat.com> - 4:5.14.1-192Petr Pisar <ppisar@redhat.com> - 4:5.14.1-191Petr Pisar <ppisar@redhat.com> - 4:5.14.1-190Petr Pisar <ppisar@redhat.com> - 4:5.14.1-189Petr Pisar <ppisar@redhat.com> - 4:5.14.1-188Petr Pisar <ppisar@redhat.com> - 4:5.14.1-187Iain Arnell <iarnell@gmail.com> 4:5.14.1-186Petr Sabata <contyk@redhat.com> - 4:5.14.1-185Iain Arnell <iarnell@gmail.com> 4:5.14.1-184Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-183Paul Howarth <paul@city-fan.org> - 4:5.14.1-182Petr Sabata <contyk@redhat.com> - 4:5.14.1-181Iain Arnell <iarnell@gmail.com> 4:5.14.1-180Iain Arnell <iarnell@gmail.com> 4:5.14.1-179Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-178Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-175Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-174Iain Arnell <iarnell@gmail.com> 4:5.14.1-173Paul Howarth <paul@city-fan.org> - 4:5.14.1-172Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-171Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-170Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-169Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-167Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-165Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-163Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-162Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-160Petr Pisar <ppisar@redhat.com> - 4:5.12.3-159Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-158Robin Lee <cheeselee@fedoraproject.org> - 4:5.12.3-157Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-156Iain Arnell <iarnell@gmail.com> 4:5.12.3-154Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.12.3-153Petr Pisar <ppisar@redhat.com> - 4:5.12.3-152Tom Callaway <spot@fedoraproject.org> - 4:5.12.3-151Petr Pisar <ppisar@redhat.com> - 4:5.12.3-150Lukas Berk <lberk@redhat.com> - 4:5.12.3-149Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-148Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-146Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-145Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-144Petr Pisar <ppisar@redhat.com> - 4:5.12.2-143Petr Pisar <ppisar@redhat.com> - 4:5.12.2-142Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-141Petr Pisar <ppisar@redhat.com> - 4:5.12.2-140Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-139Petr Pisar <ppisar@redhat.com> - 4:5.12.2-138Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-137Petr Pisar <ppisar@redhat.com> - 4:5.12.2-136Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-135Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-134Petr Pisar <ppisar@redhat.com> - 4:5.12.2-133Petr Sabata <psabata@redhat.com> - 5:5.12.2-132Petr Sabata <psabata@redhat.com> - 4:5.12.2-1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-131Petr Pisar <ppisar@redhat.com> - 4:5.12.1-130Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-129Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-128Dan Horák <dan[at]danny.cz> - 4:5.12.1-127Petr Pisar <ppisar@redhat.com> - 4:5.12.1-126Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-125Ralf Corsépius <corsepiu@fedoraproject.org> -  4:5.12.1-124Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-123Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-122Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-121Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-120-testMarcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119.1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119Marcela Mašláňová <mmaslano@redhat.com> - 4�x�������������������X��$�
������p�������t�$d����������������tsu�interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f515c57028e1014b65f84fb1409d7aece221d5a6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d5d8db2ff8938bfbbf163e6e6c7eaa5174f21e58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9902196839a9d210b6a543f5972ab391b412a244, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b4b4681e4929d5303888ee1615db98ef9828764d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e82124a0700ec5ece3d81ba6c675b598ef23c71, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=782d434196eecba659bcb616010a65ad2fd6e913, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=530df3fecc75965786f1fbc7aa64e4d87e05258a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1b57d0c25d77b2e6cfd52a2aad1b74c56ecb46a9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5f1e784fd38990fcea1cb886a6e2c99972edfb22, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b7609384d36cb0303a98f49a56a965714f5fae6e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dafd9825e1f4ce945d76d3b46af79a3f162e9da1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b5fe79f64199bda21d529cda0cffbe878329f82f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ddd3d00de96d6ab28e8db6587bbc803d3f6b39f6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6d73e2035e046c2bbe3b4caad35387ed1c7550dc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4ffbec8ad9ffda8daccb0e7a3adef656d847ebd2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2d99a6ed0176c1ffbe9de63047f7e4400a7ac931, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=01bd476ab709c516470e74fd08f54074d31c19b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e1b6d36dcac415e99a02207c507582313b3b57ea, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3541638a6871762059904627fb8fde808eb8f3b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=af85288e7b3f9d0ea77c9a06ce208b5a3f4c91cd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically link�x��������������������X�e$�
������������������$L�������������������Ur8?l�d����	!�	E�t�x�����������	������m�P4P	�P
	tP
�PDP
P\P�P|�P� 9 �9%�9(&9)&@*)�+)�,*-*8*8�91h�:��>T?T"@T*BT2DTZGTtPHU�PIV�PXWDYWPZW�[W�\W�P]X�P^^: b`�db'eb,fb/lb1tbLPuc�Pvd�wh�Pxj$PykdJ�l��l��l��l�l�l�6o&o66
qlq��q�q�Pr,gr0hr4Ckexec-tools2.0.2614.el8_10.2The kexec/kdump userspace componentkexec-tools provides /usr/sbin/kexec binary that facilitates a new
kernel to boot using the kernel's kexec feature either on a
normal or a panic reboot. This package contains the /usr/sbin/kexec
binary and ancillary utilities that together form the userspace
component of the kernel's kexec feature.f�y�x64-builder01.almalinux.org/mAlmaLinuxAlmaLinuxGPLv2AlmaLinux Packaging Team <packager@almalinux.org>Applications/Systemlinuxx86_64# Initial installation

if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset kdump.service &>/dev/null || : 
fi 


touch /etc/kdump.conf



# This portion of the script is temporary.  Its only here
# to fix up broken boxes that require special settings 
# in /etc/sysconfig/kdump.  It will be removed when 
# These systems are fixed.

if [ -d /proc/bus/mckinley ]
then
	# This is for HP zx1 machines
	# They require machvec=dig on the kernel command line
	sed -e's/\(^KDUMP_COMMANDLINE_APPEND.*\)\("$\)/\1 machvec=dig"/' \
	/etc/sysconfig/kdump > /etc/sysconfig/kdump.new
	mv /etc/sysconfig/kdump.new /etc/sysconfig/kdump
elif [ -d /proc/sgi_sn ]
then
	# This is for SGI SN boxes
	# They require the --noio option to kexec 
	# since they don't support legacy io
	sed -e's/\(^KEXEC_ARGS.*\)\("$\)/\1 --noio"/' \
	/etc/sysconfig/kdump > /etc/sysconfig/kdump.new
	mv /etc/sysconfig/kdump.new /etc/sysconfig/kdump
fi# Package removal, not upgrade

if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now kdump.service &>/dev/null || : 
fi
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart kdump.service &>/dev/null || : 
fi!f	���!+!z����������{y&d���2x���2��rP
�<��W�[FX%���K*6��4	^����
��lNA큤A�A큤����A�A�A�A�A�A���A큤���������큤A큤����큤��A큤�������A큤��������������A�A큤A�A큤��������������������������������������A�A�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�cw��cw��f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�cw��f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�y�f�x�������������������X��$�
���������f�$v����������������feg�2.13-pre7)
- more than 70 Fedora/RHEL patches have been merged to upstream code- fix #150493 - hwclock --systohc sets clock 0.5 seconds slow
- fix #220873 - starting RPC idmapd: Error: RPC MTAB does not exist.
		(added rpc_pipefs to util-linux-2.13-umount-sysfs.patch)
- fix #227903 - mount -f does not work with NFS-mounted- include ConsoleKit session module by default (#229172)- fix #222293 - undocumented partx,addpart, delpart- fix paths in po/Makefile.in.in- fix #217240 - namei ignores non-directory components instead of saying "Not a directory"
- fix #217241 - namei enforces symlink limits inconsistently- fix leaking file descriptor in the more command (patch by Steve Grubb)- use ncurses only
- fix #218915 - fdisk -b 4K
- upgrade to -pre7 release
- fix building problem with raw0 patch
- fix #217186 - /bin/sh: @MKINSTALLDIRS@: No such file or directory 
  (port po/Makefile.in.in from gettext-0.16)
- sync with FC6 and RHEL5:
- fix #216489 - SCHED_BATCH option missing in chrt
- fix #216712 - issues with raw device support ("raw0" is wrong device name)
- fix #216760 - mount with context or fscontext option fails
  (temporarily disabled the support for additional contexts -- not supported by kernel yet)
- fix #211827 - Can't mount with additional contexts
- fix #213127 - mount --make-unbindable does not work
- fix #211749 - add -r option to losetup to create a read-only loop- fix #209911 - losetup.8 updated (use dm-crypt rather than deprecated cryptoloop)
- fix #210338 - spurious error from '/bin/login -h $PHONENUMBER' (bug in IPv6 patch)
- fix #208634 - mkswap "works" without warning on a mounted device- rebuilt for unwind info generation, broken in gcc-4.1.1-21- remove obsolete NFS code and patches (we use /sbin/mount.nfs
  and /sbin/umount.nfs from nfs-utils now)
- move nfs.5 to nfs-utils- fix #205038 - mount not allowing sloppy option (exports "-s"
  to external /sbin/mount.nfs(4) calls) 
- fix minor bug in util-linux-2.13-mount-twiceloop.patch
- fix #188193- util-linux should provide plugin infrastructure for HAL- fix Makefile.am in util-linux-2.13-mount-context.patch
- fix #201343 - pam_securetty requires known user to work
		(split PAM login configuration to two files)
- fix #203358 - change location of taskset binary to allow for early affinity work- fix #199745 - non-existant simpleinit(8) mentioned in ctrlaltdel(8)- Change keycreate line to happen after pam_selinux open call so it gets correct context- fix #176494 - last -i returns strange IP addresses (patch by Bill Nottingham)- fix #198300, #199557 - util-linux "post" scriptlet failure- Added the -o fsc flag to nfsmount.- rebuild- add Requires(post): libselinux- add IPv6 support to the login command (patch by Milan Zazrivec)
- fix #198626 - add keyinit instructions to the login PAM script 
  (patch by David Howells)- rebuild- cleanup dependences for post and preun scriptlets- silence install in minimal buildroot without /var/log- include the raw command for RHELs- move install-info parts from postun to preun- Only execute chcon on machines with selinux enabled- Remove unneeded header files from nfsmount.c- fix #187014 - umount segfaults for normal user
- fix #183446 - cal not UTF-8-aware
- fix #186915 - mount does not translate SELIinux context options though libselinux
- fix #185500 - Need man page entry for -o context= mount option
- fix #152579 - missing info about /etc/mtab and /proc/mounts mismatch
- fix #183890 - missing info about possible ioctl() and fcntl() problems on NFS filesystem
- fix #191230 - using mount --move results in wrong data in /etc/mtab
- added mount subtrees support
- fdisk: wrong number of sectors for large disks (suse#160822)
- merge fdisk-xvd (#182553) with new fdisk-isfull (#188981) patch 
- fix #181549 - raw(8) manpage has old information about dd
- remove asm/page.h usage- Remove requirement on restorecon, since we can do the same thing
- with chcon/matchpathcon, and not add requirement on policycoreutils- Fixed bug in patch for bz183713 which cause nfs4 mounts to fail.- Ad�x�������������x������X��%�
�������������V�$�����������������V%�V�//usr/share/perl5/Pod//usr/share/perl5/Search//usr/share/perl5/Term//usr/share/perl5/Text//usr/share/perl5/Thread//usr/share/perl5/Tie//usr/share/perl5/Time//usr/share/perl5/Unicode//usr/share/perl5/User//usr/share/perl5/encoding//usr/share/perl5/overload//usr/share/perl5/pod//usr/share/perl5/warnings/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������������X�%�
��������`#�����d�$)�����������������d�d�d�BN_bn2bin.3ssl.gzBN_add.3ssl.gzBN_mod_mul_reciprocal.3ssl.gzBN_add_word.3ssl.gzBN_copy.3ssl.gzBN_add.3ssl.gzBN_new.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_add.3ssl.gzBN_generate_prime.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzBN_zero.3ssl.gzBN_bn2bin.3ssl.gzBN_set_bit.3ssl.gzBN_cmp.3ssl.gzBN_cmp.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_cmp.3ssl.gzBN_cmp.3ssl.gzBN_bn2bin.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_bn2bin.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_add.3ssl.gzBN_num_bytes.3ssl.gzBN_num_bytes.3ssl.gzBN_zero.3ssl.gzBN_bn2bin.3ssl.gzBN_bn2bin.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_new.3ssl.gzBN_zero.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_cmp.3ssl.gzBN_zero.3ssl.gzBN_copy.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzX509_dup.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzX509_dup.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_add1_signer.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add1_recipient_cert.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_cert.3ssl.gzCMS_get0_type.3ssl.gzCMS_get0_type.3ssl.gzCMS_verify.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_cert.3ssl.gzCMS_get0_type.3ssl.gzCONF_modules_free.3ssl.gzCONF_modules_load_file.3ssl.gzCONF_modules_free.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_�x�������������h������X��%�
�������������'��$7����������������'�(�&��delta.1.gzperl5101delta.1.gzperl5120delta.1.gzperl5121delta.1.gzperl5122delta.1.gzperl5123delta.1.gzperl5124delta.1.gzperl5125delta.1.gzperl5140delta.1.gzperl5141delta.1.gzperl5142delta.1.gzperl5143delta.1.gzperl5144delta.1.gzperl5160delta.1.gzperl5161delta.1.gzperl5162delta.1.gzperl5163delta.1.gzperl5180delta.1.gzperl5181delta.1.gzperl5182delta.1.gzperl5184delta.1.gzperl5200delta.1.gzperl5201delta.1.gzperl5202delta.1.gzperl5203delta.1.gzperl5220delta.1.gzperl5221delta.1.gzperl5222delta.1.gzperl5223delta.1.gzperl5224delta.1.gzperl5240delta.1.gzperl5241delta.1.gzperl5242delta.1.gzperl5243delta.1.gzperl5244delta.1.gzperl5260delta.1.gzperl5261delta.1.gzperl5262delta.1.gzperl5263delta.1.gzperl5280delta.1.gzperl561delta.1.gzperl56delta.1.gzperl581delta.1.gzperl582delta.1.gzperl583delta.1.gzperl584delta.1.gzperl585delta.1.gzperl586delta.1.gzperl587delta.1.gzperl588delta.1.gzperl589delta.1.gzperl58delta.1.gzperlaix.1.gzperlamiga.1.gzperlandroid.1.gzperlapi.1.gzperlapio.1.gzperlartistic.1.gzperlbook.1.gzperlboot.1.gzperlbot.1.gzperlbs2000.1.gzperlcall.1.gzperlce.1.gzperlcheat.1.gzperlclib.1.gzperlcn.1.gzperlcommunity.1.gzperlcygwin.1.gzperldata.1.gzperldbmfilter.1.gzperldebguts.1.gzperldebtut.1.gzperldebug.1.gzperldelta.1.gzperldeprecation.1.gzperldiag.1.gzperldos.1.gzperldsc.1.gzperldtrace.1.gzperlebcdic.1.gzperlembed.1.gzperlexperiment.1.gzperlfork.1.gzperlform.1.gzperlfreebsd.1.gzperlfunc.1.gzperlgit.1.gzperlgpl.1.gzperlguts.1.gzperlhack.1.gzperlhacktips.1.gzperlhacktut.1.gzperlhaiku.1.gzperlhist.1.gzperlhpux.1.gzperlhurd.1.gzperlintern.1.gzperlinterp.1.gzperlintro.1.gzperliol.1.gzperlipc.1.gzperlirix.1.gzperljp.1.gzperlko.1.gzperllexwarn.1.gzperllinux.1.gzperllocale.1.gzperllol.1.gzperlmacos.1.gzperlmacosx.1.gzperlmod.1.gzperlmodinstall.1.gzperlmodlib.1.gzperlmodstyle.1.gzperlmroapi.1.gzperlnetware.1.gzperlnewmod.1.gzperlnumber.1.gzperlobj.1.gzperlootut.1.gzperlop.1.gzperlopenbsd.1.gzperlopentut.1.gzperlos2.1.gzperlos390.1.gzperlos400.1.gzperlpacktut.1.gzperlperf.1.gzperlplan9.1.gzperlpod.1.gzperlpodspec.1.gzperlpolicy.1.gzperlport.1.gzperlpragma.1.gzperlqnx.1.gzperlre.1.gzperlreapi.1.gzperlrebackslash.1.gzperlrecharclass.1.gzperlref.1.gzperlreftut.1.gzperlreguts.1.gzperlrepository.1.gzperlrequick.1.gzperlreref.1.gzperlretut.1.gzperlriscos.1.gzperlrun.1.gzperlsec.1.gzperlsolaris.1.gzperlsource.1.gzperlstyle.1.gzperlsub.1.gzperlsymbian.1.gzperlsyn.1.gzperlsynology.1.gzperlthrtut.1.gzperltie.1.gzperltoc.1.gzperltodo.1.gzperltooc.1.gzperltoot.1.gzperltrap.1.gzperltru64.1.gzperltw.1.gzperlunicode.1.gzperlunicook.1.gzperlunifaq.1.gzperluniintro.1.gzperluniprops.1.gzperlunitut.1.gzperlvar.1.gzperlvms.1.gzperlvos.1.gzperlwin32.1.gzAnyDBM_File.3pm.gzAutoLoader.3pm.gzAutoSplit.3pm.gzB.3pm.gzB::Concise.3pm.gzB::Deparse.3pm.gzB::Op_private.3pm.gzB::Showlex.3pm.gzB::Terse.3pm.gzB::Xref.3pm.gzBenchmark.3pm.gzCORE.3pm.gzClass::Struct.3pm.gzConfig.3pm.gzConfig::Extensions.3pm.gzDB.3pm.gzDBM_Filter.3pm.gzDBM_Filter::compress.3pm.gzDBM_Filter::encode.3pm.gzDBM_Filter::int32.3pm.gzDBM_Filter::null.3pm.gzDBM_Filter::utf8.3pm.gzDirHandle.3pm.gzDumpvalue.3pm.gzDynaLoader.3pm.gzEnglish.3pm.gzExtUtils::Constant.3pm.gzExtUtils::Constant::Base.3pm.gzExtUtils::Constant::Utils.3pm.gzExtUtils::Constant::XS.3pm.gzExtUtils::XSSymSet.3pm.gzFcntl.3pm.gzFile::Basename.3pm.gzFile::Compare.3pm.gzFile::Copy.3pm.gzFile::DosGlob.3pm.gzFile::Find.3pm.gzFile::Glob.3pm.gzFile::stat.3pm.gzFileCache.3pm.gzFileHandle.3pm.gzFindBin.3pm.gzGDBM_File.3pm.gzGetopt::Std.3pm.gzHash::Util.3pm.gzHash::Util::FieldHash.3pm.gzI18N::Collate.3pm.gzI18N::LangTags.3pm.gzI18N::LangTags::Detect.3pm.gzI18N::LangTags::List.3pm.gzI18N::Langinfo.3pm.gzIPC::Open2.3pm.gzIPC::Open3.3pm.gzInternals.3pm.gzNDBM_File.3pm.gzNEXT.3pm.gzNet::hostent.3pm.gzNet::netent.3pm.gzNet::protoent.3pm.gzNet::servent.3pm.gzO.3pm.gzODBM_File.3pm.gzOpcod�x��������������v�����X��%�
 ����q!�$a����������������q!p!r!�6d05021728409993b141eade75d6d02a96226aa9cbb06d14d7ad06ba55987e26b390146c1a59a182ad05e5a0fc70dc2a8c984f2ab3e3bec15256e9c0a4807286954eeff4ced69b2e1580261317115b496598fe61973976d4d8fc0b0a6e33bd5052bf80b70c8f98f19c9af4231542d17b707537cdf3fd5a2d72ea70fc3b0d2d46d5a7350a948020bb317647b4470db34b22f1bc0b995b4c220d0e2a2044c51937dabc84bf5f9db9a7b95b94042d0bdfc6f7208c7e0e1810c95042b3bb63a5fccd7a36403e3511d4d119eba127e2be07162aa158728284b2fae066cfbbf938b5a05e81fb439aea68fcd96b4f80f0a9f9fc2e9c6cbb8be42a1d9badddf33e5ece41b9718b02c2f07ed25ad35eeab077e5a771818f031dc607f619d4efc3e300eb140c8f015ee0a59498a3c278f001b656056d141d638f907cef6aed553ea72654884be3d2e5b39e487ad91f9aa68c452dcf2815575cd042366f735824dcdd65e12a9c353aab9f7aa03c978a0df1720704fa679c9229b32248a9a9525f028bda3975237ca5e51992901c649e6b6309ba86c742cb348c3f812195b8044af1034ba7ecf4b8d211c1193fae8d5b3fb27d4475775b654eb987e7ca2042289ef5716fb6be102156f073e9e5c450e0a229be35aefd3f3979526525280ae0021646fb82d8db36a7850069593414c453cf35df0c3e9d30258e89b2e6a1f22a4d34b160ba079444fdea3fd3818d6d187c3b2b3448bddeae475d76158d94caeae9dc4eeacc0b1140d3259d7296c67cc0e980ecebde086714474cd3610707fdd00214a0f5e7860d07f637a2982ed0b10e2c3b6645a8d12be71c8c2525bb73346461bacacc17e85e9241f0bd878bed6310fbfec96c72564f66ac8e0bbdcbfa8e2eb891e5d125d1c26b110df9e7801a5d657d7a521f6c04cad41e0b127fc6cb52f06ef493c32dbacc8ba5da94026a3fa1d74ca71021daeb6cdcadf4bf468ddbee767049f325428c26a3e2dd4edcbf9e1dc07077762876044361495adfc6b8819596b79cb1f9d550eae437ab39cb7bca1a92d13ae3e657fd18d5773ae99278634c84ce301cc9d1d57076c44c539b2147c28dce700cc14df70965366a5add1e17180b1ce017a0aa449705cf01beef73d686329b3e7d009f909f4345155ececd18b9fde4baf3b927b5d254038cc327a5b5b7836f298e3732f98bc8653b9ff6928b1df37a517386d428412b71418d2c123fca9850b8cb0dd38338aae03d67e1888b507f6dbd78b9d757f3519b724e8e875234f4d4a14fb1265533f10310030667be9dfafd40d2e92950c3b03b90e1199412011188cb0395e83afa506932201fc29ef0e536d2ecfd86faecd8731a7e03d8c0ce7baed29deaffc5608bb3d527dfe075713b97691ab8f42fef7e54b38a0175ca06dfa5e437e74cc40d1f30996a4e20c8136521fb0768a32a4145909d010fd37310aac7d82ea6df74d78333f78c26c0ed52ecc4c43ebee318bf2b7a55a8ea5d90de144a9e5a1019dd7987d6cfbfc9ac2a913d6d772031eb8eb3e95013533903d4e802d849168ff4d3fa119370a6a7eee533283476606ad12ff5a03f1185ac56a31502691c057770baaf409a8426ae04fe81b917aa6b7b2da8cbdbc9c3398320f3d3966654416860478789b69f0f5020c951c7ede84f1bd89377ee0f4301e0f1959583a968c890435ed16c98d4ebc18c03132cc3b3e4c709792f60e3ea7bf1e5c0592a725135722ed6c3cfe83c11612bc70ba10dcb2c43f872da1c9169fa8ae9fcbba0fb9abc676aba46049031a2a4543910a6cbe2a7aecf4a35fb9c4b383669bf88b446ae2f4e3f32f38a15b268bd84734d262e3c9dd7306a7699794c0c40d40a870fa25d78d375996b0ee2c1a70ee4e6ff737d7aef385393deab9d176895534f9b4301de2e5bef324f73205b45748adca4fecbe3559889aeb81281cc1126f3133f60e899e0c67db920d3a1dbd0cf5d0b68c3f7f1da3bed163866b3f90a24ef7a49c11b2de30d46428acf09b37be651e02982612e11bb399aace7699b9272497421cfc13a1c61bf68cba4686ddc1e687a1ec138fcc39001cb9249a6838920874b01ffbb7b5341c0aa3f7b15277eef1c8149316343c29370ed4a262906d6d80f4af0cf7cc57730701ba545150c50172b499fea107b2790607d634d25f71c5fcb8859ed0b4b44a9fe5a2e0282cee3fedd660307f58e90728f9d5c2f5434da8de36a84d949dff19e774d24ac1c43d33c71d3f78f29ba55a2d8fd37327ec915921ea3f07c7d264c49aa649b050d966aba376747bce949e600a6667bc41bd4077d59a248fc87843c81dbb762d0069b84d79e5d3d25ba03924790be7da4598e81c65a26734579092788b02c5acb566d288c1fcf0ceb4c3372280a4e906513fccf6379a40501f7e07a033a4ee96e2fff215b3f2c7c9d373914d53e227ecb449ed80cc1c75de84c6571196b9653a9615ec71f0ed907cfe2dee25e01c0338011ab5001e46d8ef9a927c46b59756a75a5943b2e860ed90a17ec5dcf27dfe2e6e40ed8dbbf18ce1fc3892e51e09fc97ea7ed67e65c616588f8f1bc6ba257cecdecb300baad839a6f62791229f551a4fa33f3cbdca08e378dc976466354e778970528b8ffb8f9b46fa640dbc6873602641d9044bafe5621d7644b106c99d483dd1cea927bfb0cd3ddc6020ee822aac3745aa7723ccfbd4beb1d70a652224a4bde7cd087850c1bb5870c6074a6922203361207454caa020b2c0e8ee061504328../../../../usr/lib64/perl5/auto/re/re.so../../../../usr/lib64/libperl.so.5.26.3libperl.so.5.2�x�������������Xf�����X�[%�
 B�p���{d�$k����������������{d|dzd��x��������������U�����X�F%�
��������h\�����d�$�����������������d�d�d�hyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>- Backport fix SSL_select_next proto from OpenSSL 3.2
  Fix CVE-2024-5535 
  Resolves: RHEL-45654- Backport implicit rejection mechanism for RSA PKCS#1 v1.5 to RHEL-8 series
  (a proper fix for CVE-2020-25659)
  Resolves: RHEL-17694- Fix CVE-2023-5678: Generating excessively long X9.42 DH keys or checking
  excessively long X9.42 DH keys or parameters may be very slow
  Resolves: RHEL-16536- Fix CVE-2023-3446: Excessive time spent checking DH keys and parameters
  Resolves: RHEL-14243
- Fix CVE-2023-3817: Excessive time spent checking DH q parameter value
  Resolves: RHEL-14237- Fixed Timing Oracle in RSA Decryption
  Resolves: CVE-2022-4304
- Fixed Double free after calling PEM_read_bio_ex
  Resolves: CVE-2022-4450
- Fixed Use-after-free following BIO_new_NDEF
  Resolves: CVE-2023-0215- Fixed X.400 address type confusion in X.509 GeneralName
  Resolves: CVE-2023-0286- Fix CVE-2022-2097: AES OCB fails to encrypt some bytes on 32-bit x86
  Resolves: CVE-2022-2097
- Update expired certificates used in the testsuite
  Resolves: rhbz#2100554
- Fix CVE-2022-1292: openssl: c_rehash script allows command injection
  Resolves: rhbz#2090371
- Fix CVE-2022-2068: the c_rehash script allows command injection
  Resolves: rhbz#2098278- Fixes CVE-2022-0778 openssl: Infinite loop in BN_mod_sqrt() reachable when parsing certificates
- Resolves: rhbz#2067145- Fixes CVE-2021-3712 openssl: Read buffer overruns processing ASN.1 strings
- Resolves: rhbz#2005402- Fixes bugs in s390x AES code.
- Uses the first detected address family if IPv6 is not available
- Reverts the changes in https://github.com/openssl/openssl/pull/13305
  as it introduces a regression if server has a DSA key pair, the handshake fails
  when the protocol is not explicitly set to TLS 1.2. However, if the patch is reverted,
  it has an effect on the "ssl_reject_handshake" feature in nginx. Although, this feature
  will continue to work, TLS 1.3 protocol becomes unavailable/disabled. This is already
  known - https://trac.nginx.org/nginx/ticket/2071#comment:1
  As per https://github.com/openssl/openssl/issues/16075#issuecomment-879939938, nginx
  could early callback instead of servername callback.
- Resolves: rhbz#1978214
- Related: rhbz#1934534- Cleansup the peer point formats on renegotiation
- Resolves rhbz#1965362- Fixes FIPS_selftest to work in FIPS mode. Resolves: rhbz#1940085
- Using safe primes for FIPS DH self-test- Update to version 1.1.1k- Use AI_ADDRCONFIG only when explicit host name is given
- Allow only curves defined in RFC 8446 in TLS 1.3- Remove 2-key 3DES test from FIPS_selftest- Fix CVE-2021-3450 openssl: CA certificate check bypass with
  X509_V_FLAG_X509_STRICT
- Fix CVE-2021-3449 NULL pointer deref in signature_algorithms processing- Fix CVE-2020-1971 ediparty null pointer dereference- Implemented new FIPS requirements in regards to KDF and DH selftests
- Disallow certificates with explicit EC parameters- Further changes for SP 800-56A rev3 requirements- Rewire FIPS_drbg API to use the RAND_DRBG
- Use the well known DH groups in TLS even for 2048 and 1024 bit parameters- Disallow dropping Extended Master Secret extension
  on renegotiation
- Return alert from s_server if ALPN protocol does not match
- SHA1 is allowed in @SECLEVEL=2 only if allowed by
  TLS SigAlgs configuration- Add FIPS selftest for PBKDF2 and KBKDF- Allow only well known DH groups in the FIPS mode- update to the 1.1.1g release
- FIPS module installed state definition is modified- add selftest of the RAND_DRBG implementation- fix incorrect error return value from FIPS_selftest_dsa
- S390x: properly restore SIGILL signal h�x�������������HE�����X��$�
��������(�����i�$y����������������ihj� separate- remove selinux code from login and use pam_selinux- turn on selinux- Add BuildRequires: texinfo (from a bug# I don't remember)
- Fix #90588 with mountman patch142.- turn off selinux- turn on selinux
- remove context selection- Add patch140 (alldevs) to fix #101772. Printing the total size of
  all devices was deemed a lower priority than having all devices
  (e.g. /dev/ida/c0d9) displayed.- turn off selinux- turn on selinux- Fix #103004, #103954- turn off selinux- build with selinux- Use urandom instead for mkcramfs- add SELINUX 2.5 support- #100433 patch- #97381 patch- rebuilt- Change patch128 to improve ipcs -l- Fix #85407- Change patch128 to util-linux-2.11f-ipcs-84243-86285.patch to get all
ipcs fixes- fix last login date display on AMD64 (#88574)- include sfdisk on ppc- add patch from msw to change mkcramfs blocksize with a command line option- Fix segfault on s390x due to wrong usage of BLKGETSIZE.- Really apply the ipcs patch. Doh.- rebuilt- ipcs-84243.patch to fix #84243- Update moremisc patch to fix swprintf()'s minimum field (bug #83361).- Fix mcookie segfault on many 64-bit architectures (bug #83345).- Fix underlined multibyte characters (bug #83376).- rebuild to have again a s390 rpm
- disable some more apps for mainframe- util-linux-2.11y-umask-82552.patch- rebuilt- Fix #81069, #75421- Update to 2.11y
- Fix #80953
- Update patch0, patch107, patch117, patch120 for 2.11y
- Remove patch60, patch61, patch207, patch211, patch212, patch119, patch121
- Remove patch122, patch200- Remove some crack/unnecessary patches while submitting stuff upstream.
- Build with -D_FILE_OFFSET_BITS=64- Update to 2.11w, resolve patch conflicts- Extended util-linux-2.11b-s390x patch to work again.- Add patch122 for hwclock on x86_64- Fixed pam config files- Port to hammer- Patch120 (hwclock) to fix #72140
- Include isosize util- Patch120 (skipraid2) to fix #70353, because the original patch was 
totally useless.- Patch119 (fdisk-add-primary) from #67898- Really add the gptsize patch, instead of what I think the patch says.
(+1)- Add the sp[n].size part of the patch from #69603- adjust mainframe patches- only require usermode if we're shipping kbdrate here- Port the large swap patch to new util-linux... the off_t changes 
  now in main aren't sufficient- Remove swapondetect (patch301) until it avoids possible false positives.- Update to 2.11r, wheeee
- Remove unused patches- Make a note here that this package was the source of the single change 
contained in util-linux-2.11f-18 (in 7.2/Alpha), and also contains the 
rawman patch from util-linux-2.11f-17.1 (in 2.1AS).
- Package has no runtime deps on slang, so remove the BuildRequires: 
slang-devel.- automated rebuild- Fix teg's swapondetect patch to not print out the usage message when 
'swapon -a -e' is run. (#66690) (edit existing patch)
- Apply hjl's utmp handling patch (#66950) (patch116)
- Fix fdisk man page notes on IDE disk partition limit (#64013) (patch117)
- Fix mount.8 man page notes on vfat shortname option (#65628) (patch117)
- Fix possible cal overflow with widechars (#67090) (patch117)- support large swap partitions
- add '-d' option to autodetect available swap partitions- automated rebuild- Remove kbdrate (again).- adjust mainframe patches to apply to current rpm
- do not include fdisk until it is fixed to work on mainframe- Don't strip binaries - rpm does it for us.- Apply patch115 from ejb@ql.org for bug #61868- Finish fixing #60675 (ipcrm man page), updated the patch.
- Fix #61203 (patch114 - dumboctal.patch).- Update ctty3 patch to ignore SIGHUP while dropping controlling terminal- Update ctty3 patch to drop controlling terminal before forking.Fix various bugs:
- Add patch110 (skipraid) to properly skip devices that are part of a RAID array.
- Add patch111 (mkfsman) to update the mkfs man page's "SEE ALSO" section.
- remove README.cfdisk
- Include partx
- Fix 54741 and related bugs for good(hah!) with patch113 (ctty3)- Put kbdrate in, add usermode dep.- Fix #60363 �x��������������4�����X�%�
 1��������������d�$V�����������������d�d�d���g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g���x�������������8$�����X�$�
00���������������W�$k�����������������W�W�W�ns@usemail.com>Jason Spangler <jasons@usemail.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Resolves: #1711119 - netstat says "packetes" instead of "packets"
- Resolves: #1670355 - Exit code on wrong parameter is zero for many net-tools binaries
- Resolves: #1807989 - The output of `route -A inet6` does not display properly when the 'Use' column output is over 6 digits- Resolves: #1607010 - Please review important issues found by covscan- Resolves: 1557470 - netstat -i cut's interface names
- Resolves: 1566084 - netstat -agn only shows 10 character interface name for IPv4 addressing- Escape macros in %changelog- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Link mii-diag with $RPM_LD_FLAGS- removing dependencies on systemd-units from spec file- Resolves: #1478868 - netstat(8) portion on Timer needs writing- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Resolves: #1414765 - ifconfig inaccurately rounds exabytes- fix build on linux-4.8- latest upstream snapshot- just few nitpicks :)- latest upstream snapshot
- adding HAVE_PLIP_TOOLS=1, HAVE_SERIAL_TOOLS=1, HAVE_ARP_TOOLS=1 into net-tools-config.h and net-tools-config.make
- commenting out "%{buildroot}%{_mandir}/man8/rarp.8*" and its language alternatives in spec
- adding "rm -rf %{buildroot}%{_mandir}/pt/man5" in spec- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- ether-wake: add interface into message (#1149502)
- latest upstream snapshot (ipx.patch & sctp-statistics.patch merged)- latest upstream snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- latest upstream snapshot- latest upstream snapshot (#1162284)- ether-wake: apply Debian's hardening patch- latest upstream snapshot (#1149405)- Enable bluetooth- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- latest upstream snapshot- __global_ldflags -> RPM_LD_FLAGS, optflags -> RPM_OPT_FLAGS- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- output sctp endpoints without -a parameter (#1063913)- remake sctp-quiet.patch (#1063906#c7)- make sctp quiet on systems without sctp (#1063906)- move ifconfig and route back to sbin (#1045445)- make mii-diag compile with -Werror=format-security (#1037218)- latest snapshot (#1021109)- use different compiler/linker flags macros- install binaries into /usr/bin and /usr/sbin (#1016674)- latest snapshot- remove %ifarch alpha condition from %prep
- improve sctp-statistics.patch (#982638#c10)- latest snapshot- amend ether-wake-interfaces.patch- use all interfaces instead of default (#1003875)
- reverted all changes on ether-wake.c and put original file- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- latest snapshot- latest snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- latest snapshot (#579855)- fix URL- match actual license- few man page fixes- the git snapshot we ship is actually much more a
  2.0 pre-release then 1.60 post-release- compile without STRIP (Metricom radio) support- upstream git snapshot- Sparc and s390 arches need to use -fPIE- compile with PIE and full RELRO flags (#853193)- fixed building with kernel-3.6- use new systemd-rpm macros (#850225)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- fixes for #834110 and #836258 merged upstream- compile without Token ring support (http://lwn.net/Articles/497397/)- better SCTP support (#826676)- don't require hostname package- Do not show interface metric in 'ifconfig', 'ifconfig -s' and 'netstat -i'.
  Spare place is used for interface name so trim_iface.patch is no longer needed.
- No need to convert man pages to utf-8 as upstream ship them in utf-8 now.- SELinux patch merged upstream
- several page fixes merged upstr�x�������������`�����X@%%�
���������������d�����$!�����������������d�d�d�ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzPKCS5_PBKDF2_HMAC.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_digest.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzPKCS7_verify.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzRAND_DRBG_generate.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_get0_master.3ssl.gzRAND_DRBG_get0_master.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_set_ex_data.3ssl.gzRAND_DRBG_set_ex_data.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_reseed.3ssl.gzRAND_DRBG_reseed.3ssl.gzRAND_DRBG_reseed.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_set_rand_method.3ssl.gzRAND_egd.3ssl.gzRAND_add.3ssl.gzRAND_load_file.3ssl.gzRAND_set_rand_method.3ssl.gzRAND_add.3ssl.gzRAND_add.3ssl.gzRAND_bytes.3ssl.gzRAND_bytes.3ssl.gzRAND_egd.3ssl.gzRAND_add.3ssl.gzRAND_add.3ssl.gzRAND_add.3ssl.gzRAND_load_file.3ssl.gzRC4_set_key.3ssl.gzRIPEMD160_Init.3ssl.gzRIPEMD160_Init.3ssl.gzRIPEMD160_Init.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.g�x�����������������X!($�
����������������$i�����������������������vad@redhat.com> - 2.3.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.3.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.2.2-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.2.1-1Jan Vcelak <jvcelak@redhat.com> 2.2.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.1.2-1Jan Vcelak <jvcelak@redhat.com> 2.1.1-1Jan Vcelak <jvcelak@redhat.com> 2.1.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.1-3Jan Kaluza <jkaluza@redhat.com> - 2.0.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.1-1Jan Vcelak <jvcelak@redhat.com> 2.0-1- Make hdparm device checks lazy
  Resolves: RHEL-71457
- Disable the amd.scheduler plug-in instance in the postgresql profile
  Resolves: RHEL-70470- Added sanity checks for API methods parameters, (CVE-2024-52337)
  Resolves: RHEL-66614- sap-netweaver: increase vm.max_map_count
  resolves: RHEL-32124- release bump due to broken c8s
  related: RHEL-27528- release bump
  related: RHEL-27528- profiles: added epyc-eda profile
  resolves: RHEL-27528- new release
  - rebased tuned to latest upstream
    related: RHEL-17119
  - renamed intel_uncore plugin to uncore
  - network-throughput: increased net.ipv4.tcp_rmem default value- new release
  - rebased tuned to latest upstream
    related: RHEL-17119
  - lower CPU usage by using runtime=0 in profiles using scheduler plugin
    resolves: RHEL-6869- new release
  - rebased tuned to latest upstream
    resolves: RHEL-17119
  - print all arguments of failing commands in error messages
  - plugin_sysctl: added support for sysctl names with slash
  - tuned-adm: added support for moving devices between plugin instances
  - api: added methods for retrieval of plugin instances and devices
  - plugin_cpu: amd-pstate mentioned instead of just intel_pstate
  - hotplug: do not report ENOENT errors on device remove
  - plugin_sysctl: expand variables when reporting overrides
  - plugin_acpi: new plugin which handles ACPI platform_profile
  - plugin_bootloader: skip calling rpm-ostree kargs in no-op case
  - plugin_cpu: support cstate settings of pm_qos_resume_latency_us
  - scheduler: add option for ignoring IRQs affinity
  - plugin_intel_uncore: new plugin for uncore setting- new release
  - api: fixed stop method not to require any parameter
    resolves: rhbz#2235638- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2182119
  - sap-hana: new profile sap-hana-kvm-guest
    resolves: rhbz#2173740
  - serialized SIGHUP handler to prevent possible bootcmdline corruption
    resolves: rhbz#2215298- new release
  - rebased tuned to latest upstream
    related: rhbz#2133814- post RC.1 fixes
  related: rhbz#2133814
- fixed possible traceback on SIGHUP- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2133814
  - systemd: relax polkit requirement
    resolves: rhbz#2065591
  - sysvinit: fixed path
  - plugin_cpu: added support for pm_qos_resume_latency_us
  - do not exit on duplicate config lines
    resolves: rhbz#2071418
  - profiles: new cpu-partitioning-powersave profile
  - profiles: new profile for AWS EC2
  - API: add support for moving devices between instances
  - D-Bus: send tracebacks through D-Bus only in debug mode
  - Makefile: added fix for python-3.12
  - throughput-performance: set net.core.somaxconn to at least 2048
    resolves: rhbz#1998310
  - plugin_scheduler: do not leak FDs from the perf
    resolves: rhbz#2080227
  - plugin_cpu: added support for intel_pstate scaling driver
  - added support for the API access through the Unix Domain Socket- new release
  - rebased tuned to latest upstream
    related: rhbz#2057602- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2057602
  - fixed parsing of inline comments
    resolves: rhbz#2060138
  - added support for quotes in isolated_cores specification
    resolves: rhbz#1891036
  - recommend: preset balanced profile for notebook, laptop or portable if
    syspurpose is not defined
    res�x��������������������X�%�
0���������=��$-����������������=�>�<������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������perl(AnyDBM_File)perl(AutoLoader)perl(AutoSplit)perl(B)perl(B::Concise)perl(B::Deparse)perl(B::OBJECT)perl(B::Op_private)perl(B::Showlex)perl(B::Terse)perl(B::Xref)perl(Benchmark)perl(Class::Struct)perl(Class::Struct::Tie_ISA)perl(Config)perl(Config::Extensions)perl(DB)perl(DBM_Filter)perl(DBM_Filter::compress)perl(DBM_Filter::encode)perl(DBM_Filter::int32)perl(DBM_Filter::null)perl(DBM_Filter::utf8)perl(DirHandle)perl(Dumpvalue)perl(DynaLoader)perl(EVERY::LAST)perl(English)perl(ExtUtils::Constant)perl(ExtUtils::Constant::Base)perl(ExtUtils::Constant::ProxySubs)perl(ExtUtils::Constant::Utils)perl(ExtUtils::Constant::XS)perl(Fcntl)perl(File::Basename)perl(File::Compare)perl(File::Copy)perl(File::DosGlob)perl(File::Find)perl(File::Glob)perl(File::stat)perl(FileCache)perl(FileHandle)perl(FindBin)perl(GDBM_File)perl(Getopt::Std)perl(Hash::Util)perl(Hash::Util::FieldHash)perl(I18N::Collate)perl(I18N::LangTags)perl(I18N::LangTags::Detect)perl(I18N::LangTags::List)perl(I18N::Langinfo)perl(IPC::Open2)perl(IPC::Open3)perl(NDBM_File)perl(NEXT)perl(NEXT::ACTUAL)perl(NEXT::ACTUAL::DISTINCT)perl(NEXT::ACTUAL::UNSEEN)perl(NEXT::DISTINCT)perl(NEXT::DISTINCT::ACTUAL)perl(NEXT::UNSEEN)perl(NEXT::UNSEEN::ACTUAL)perl(Net::hostent)perl(Net::netent)perl(Net::protoent)perl(Net::servent)perl(O)perl(ODBM_File)perl(Opcode)perl(POSIX)perl(POSIX::SigAction)perl(POSIX::SigRt)perl(POSIX::SigSet)perl(PerlIO)perl(PerlIO::encoding)perl(PerlIO::mmap)perl(PerlIO::scalar)perl(PerlIO::via)perl(Pod::Functions)perl(SDBM_File)perl(Safe)perl(Search::Dict)perl(SelectSaver)perl(Symbol)perl(Sys::Hostname)perl(Term::Complete)perl(Term::ReadLine)perl(Term::ReadLine::Stub)perl(Term::ReadLine::TermCap)perl(Term::ReadLine::Tk)perl(Text::Abbrev)perl(Thread)perl(Thread::Semaphore)perl(Tie::Array)perl(Tie::ExtraHash)perl(Tie::File)perl(Tie::File::Cache)perl(Tie::File::Heap)perl(Tie::Handle)perl(Tie::Hash)perl(Tie::Hash)perl(Tie::Hash::NamedCapture)perl(Tie::Memoize)perl(Tie::RefHash)perl(Tie::RefHash::Nestable)perl(Tie::Scalar)perl(Tie::StdA�x�������������������X�%�
P������z!�$j����������������z!y!{!�Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-21Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-20Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-19Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-18Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-17Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-16Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-15Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-14Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-13Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-12Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-11Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-10Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-9Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-8Stepan Kasal <skasal@redhat.com> - 4:5.10.0-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 4:5.10.0-6Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-5Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-4Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-3Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-2Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-1Robin Norwood <rnorwood@redhat.com> - 4:5.10.0_RC2-0.1- Fix CVE-2025-40909 - Clone dirhandles without fchdir
- Fix test broken by update in zlib on s390x- Add definition of OPTIMIZE to .ph files, if optimizing is used
  (bug#2152012)- Fix a memory leak when compiling a regular expression with a non-word
  class (bug #2014981)- Fix _resolv return value in Net-Ping (bug #1973030)- Fix CVE-2020-10543 (bug #1839273)
- Fix CVE-2020-10878 (bug #1839276)
- Fix a file mode of a perl-example.stp example (bug #1913693)- Fix CVE-2020-12723 (bug #1839279)- Fix Time-Local tests to pass after year 2019 (bug #1807120)
- Run-require perl(Encode) by perl-libs (bug #1903503)- 5.26.3 bump (bug #1655526)
- Fix CVE-2018-18311 (integer overflow leading to buffer overflow) (bug #1654920)
- Fix CVE-2018-18312 (heap buffer overflow in regcomp.c) (bug #1654922)
- Fix CVE-2018-18313 (heap buffer overflow read in regcomp.c) (bug #1654924)
- Fix CVE-2018-18314 (heap based buffer overflow) (bug #1654925)- Install Encode developmental files when installing complete Perl
  (bug #1645225)- Fix annocheck failure by passing CFLAGS to dtrace (bug #1630617)- Adjust tests to gdbm-1.15 (RT#133295)
- Fix an integer wrap when allocating memory for an environment variable
  (RT#133204)
- Fix printing a warning about a wide character when matching a regular
  expression while ISO-8859-1 locale is in effect
- Fix invoking a check for wide characters while ISO-8859-1 locale is in effect- perl-devel requires redhat-rpm-config because of hardened compiler profiles
  (bug #1557667)
- Do not clobber file bytes in :encoding layer (RT#132833)
- Fix line numbers in multi-line s/// (RT#131930)
- Fix parsing extended bracketed character classes (RT#132167)
- Fix a possibly unitialized memory read in the Perl parser (RT#133074)
- Fix an infinite loop in the regular expression compiler (RT#133185)- Correct license tags of perl-libs (bug #1579524)- 5.26.2 bump
- Fix CVE-2018-6913 (heap buffer overflow in pp_pack.c) (bug #1567776)
- Fix CVE-2018-6798 (heap read overflow in regexec.c) (bug #1567777)
- Fix CVE-2018-6797 (heap write overflow in regcomp.c) (bug #1567778)- Rebuild to pick up new build flags from redhat-rpm-config- Escape macros in %changelog- Fix parsing braced subscript after parentheses (RT#8045)
- Fix a heap use after free when moving a stack (RT#131954)
- Call ldconfig scriptlets using a macro- Correct shell bangs in tests- Link XS modules to pthread library to fix linking with -z defs- Add patch to conditionalize a fix for an old and long fixed bug
  in libcrypt / glibc (rhbz#1536752)- Rebuild against glibc without nsl library- Remove invalid macro definitions from macros.perl (bug #1532539)
- Fix an overflow in the lexer when reading a new line (RT#131793)
- Fix Term::ReadLine not to create spurious &STDERR files (RT#132008)
- Fix a crash when a match for inversely repeated group fails (RT#13201�x��������������������X�%�
����������3��$#����������������3�4�2��Pod-Html- Disable hardening due to some run-time failures (bug #1238804)- Sub-package bignum
- Sub-package Math-BigRat
- Sub-package Math-BigInt-FastCalc
- Sub-package Math-Complex
- Remove bundled perl-Config-Perl-V (bug #1238203)
- Remove bundled perl-MIME-Base64 (bug #1238222)
- Remove bundled perl-PerlIO-via-QuotedPrint (bug #1238229)
- Remove bundled perl-Pod-Escapes (bug #1238237)
- Remove bundled perl-Term-Cap (bug #1238248)
- Remove bundled perl-Text-Balanced (bug #1238269)
- Remove bundled perl-libnet (bug #1238689)
- Remove bundled perl-perlfaq (bug #1238703)
- Remove bundled perl-Unicode-Normalize (bug #1238730)
- Remove bundled perl-Unicode-Collate (bug #1238760)- Store distribution's linker and compiler flags to more Config's options
  in order to apply them when linking executable programs (bug #1238804)
- Sub-package Config-Perl-V (bug #1238203)
- Sub-package MIME-Base64 (bug #1238222)
- Sub-package PerlIO-via-QuotedPrint (bug #1238229)
- Update Pod-Escapes metadata (bug #1238237)
- Sub-package Term-Cap (bug #1238248)
- Sub-package Text-Balanced (bug #1238269)
- Sub-package libnet (bug #1238689)
- Sub-package perlfaq (bug #1238703)
- Sub-package Unicode-Normalize (bug #1238730)
- Sub-package Unicode-Collate (bug #1238760)
- Sub-package Math-BigInt
- Do not provide Net/libnet.cfg (bug #1238689)
- Revert downstream change in Net::Config default configuration
- Move libnetcfg tool from perl-devel into perl-libnetcfg sub-package- Subpackage "open" module in order to keep deprecated "encoding" module
  optional (bug #1228378)
- Control building dual-lived sub-packages by perl_bootstrap macro
- Make PadlistNAMES() lvalue again (bug #1231165)
- Make magic vtable writable as a work-around for Coro (bug #1231165)
- Explain file break-down into RPM packages in perl package description- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.20.*)- Move ok and Test::Use::ok to perl-Test-Simple- Move bin/encguess to perl-Encode- 5.22.0 bump (see <http://search.cpan.org/dist/perl-5.22.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages and erase the removed modules from the core
- Clean patches, not needed with new version
- Update patches to work with new version- Sub-package perl-CGI-Fast and perl-Module-Build-Deprecated
- Add missing dual-life modules to perl-core- Bump to make koji happy- Correct license tags of the main package, CGI, Compress-Raw-Zlib,
  Digest-MD5, Test-Simple and Time-Piece
- Package a Pod-Html license clarification email- Sub-package Text-Tabs+Wrap (bug #910798)- Add systemtap probes for new dtrace markers- Move perl(:MODULE_COMPAT_*) symbol and include directories to perl-libs
  package (bug #1174951)- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Provide 5.20.2 MODULE_COMPAT
- Clean list of provided files
- Update names of changed patches- 5.20.2 bump (see <http://search.cpan.org/dist/perl-5.20.2/pod/perldelta.pod>
  for release notes)
- Regenerate a2p.c (BZ#1177672)- Improve h2ph fix for GCC 5.0- Fix regressions with GCC 5.0- Sub-package inc-latest module- Delete dual-living programs clashing on debuginfo files (bug #878863)- Report inaccesible file on failed require (bug #1166504)
- Use stronger algorithm needed for FIPS in t/op/taint.t (bug #1128032)- Consider Filter::Util::Call dependency as mandatory (bug #1165183)
- Sub-package encoding module
- Own upper directories by each package that installs a file there and
  remove empty directories (bug #1165013)- Freeze epoch at perl-Pod-Checker and perl-Pod-Usage (bug #1163490)
- Remove bundled perl-ExtUtils-Command (bug #1158536)
- Remove bundled perl-Filter-Simple (bug #1158542)- Do not double-own perl-Pod-Usage' and perl-Pod-Checker' files by
  perl-Pod-Parser on bootstrap
- Sub-package ExtUtils-Command (bug #1158536)
- Sub-package Filter-Simple (bug #1158542)
- Build-require groff-base instead of big groff- Remove bundled perl-Devel-PPPort (bug #11439�x��������������������X�$�
p�������U�$E����������������UTV�03750eb7b0b43570c3fb49f01129b0232a0bb741e436882a498321cf4fb435aa2e4ca95b16dc448a331d7801191de5249b9bbbdca42f410e4b81461e89b77b592f2e84657091a3160fd83234228e8a94922b2ea588b5669bf6638206f2cab2e271bbc08cbb9b64def1818ff313b1d3614d78096c49b6e1853d050c234211df4f21744cace3877729788d744f6f2f3ea8920bd084469f4ca72826ef493e38022a1f4b3c4d33ebf2a635f2e50dee551df2df277472b3e39d5ab204d1b850a00a7e477d31300be20eb13b07ebe2d4152f3e807c77dc40241850011024bbf625c8b09b5647d714cbcc1dbdbf45dc932387b99adb60db0b1b6a8f8c8fc7d276f9ac8cb560f9b2c7738ce8c3da1f328c449b3df4db2a918f66ee5aff42ba17e3a9303d3753fe82149cc736e8ded4747e03bf7dc5c02500708e97ee1082420d9039e3585f42c7b18c043541aebd5fd3c02ced1be2caea94254a80f526ba0e191f234072b695d9d737273622eed959390617743e804fb90839b62f6410f0cb7fecf7e3cd8b378247734abffdc6047bb1cf7d56752b23b01f853aa02e97f5c258a603b97f628e5b4c440ee25b139f351217cfd396b90c8580b903a8061bbbcb3b02f68bb9b43472eb66c07a2f82f4c9fd0367454b5d0c648a4ac4d3b373838972c8753db33f50e1f9d5afe4c986208814db6ed27b747145347e6715060ab84c27416dc37ba638fb463465e2481cd630b72775fb075498d4f8a7aecd3378c6c5cfa7201ca9164b490c1c9feec1a00208f1014f8cba51ab9908ce83971fcaff61cdd8c6645d6a27d38e349a3b0f1d4a0cc0a4ccc58f2091b58ffe301576aae3464e4664360201ee37bfff43ad350d522ced2a9a17183c5d44fd80228b72974feacfa7201ca9164b490c1c9feec1a00208f1014f8cba51ab9908ce83971fcaff61cfa7201ca9164b490c1c9feec1a00208f1014f8cba51ab9908ce83971fcaff61c71f68c3fbf83ff032d5d49597ec2c201330eef6da9bdc4954b70e7b820327f16aa8375c2a6723f938a29d99b5caeff51cc1e9ecdc7032e1442f1e33ad93c2bab0c6c48e712879b5ce717eaf3ec3b92a565e9afc4a80b0cb69f04eeda290d9fd0f9c0b423fc9582496d41603774baeebaf05531f970b6ab3301a7dbadef73de6d85b1c76e9009fe2162297c8a6a902ea38fdab368c05ced734a0f8736693eb33d53bf64a158491b30c491c51ba595e58eede9ba7ad5607d50cc337519a57ed134cf8d19120107a55933378c10cf189738dce9a1344d637d5619f575d7fa3a2a70bde178cd5199784014816f8066303277ca828b55f490dbc19e5bcff2320bd995b34c7235700314b453c03a5fc70cc4ad42d241bb3984c2c695a21858f1f905e1e7d9172c8b854ceaa375236c88b6e476b17e4cfec9df0f94e864c9627172b50d83577ddc88231eb6e379d3eb36061e1923f443b23ef99f4cbcc8d9bdd07e1f6b2f3d0c2b56284c9b7698042a6286addf1c67b12b45fbbe279365f965162d0775658a62cac4aed0df6696c7299883671d4414c6286cb09f4465dfd1f840643336e616f9e0c23839eb6fde886d9d1284f08c05ad69e5b65aa70dcf2236f18430c052b59ef0067590e41f1febaaeef1bd6ceabde537a0b77b2acb849bb1de96459599f3210cf9935377086e5b3b391ebf2375aa6a6ed6c5e2d94daba0c10b10b81fcb64bf115f4b63cb1d508929f8cbf9f93bd3de61dd5b9e28c40a87ae06e2ae902002a5c8609f41d7b5207e35eec0187830527f0dfe51afefe792e97738c3ffee6c0a75325ef7283810427255448f12339727b2a87a8e5271ca79d4fba36f7d4a3574b0f46382bf1e585ad4855746d1ec1c274fc0ce7fa4181fe6703f9f8437b6f9e96abb01365d4d4c68d443e0580ce366abc363762e2e41ea27403a25e0f2715d608026f08827eaa7ca87ff557144b1d194713756c0aa65de4fd26f0bc2b26e299c0c7fbe3b6f574ed47c2ac644d45bcf07d752a69b0625f9f27724c1409658225e2110bf28dfc065b4ba303de8f8e1e2cf8b17e854064427b7abc41079e6b9dde6f9e8a3de7c74de7ba0ce1d71216e2da4fffb2c438bea6b636b938878470b47f4393469fc363b7782cf8e57394041afd18854ab91bb4916129420a7e78ddcfa7201ca9164b490c1c9feec1a00208f1014f8cba51ab9908ce83971fcaff61788a51e1dbef86c6e1ca3af17168e6f6175bcd76904a8279f88caed634ae13996373f33db3fcbf6a27e4c3076efc102875b7f86c7ff1d500bd2de12cb759d0a9cfa7201ca9164b490c1c9feec1a00208f1014f8cba51ab9908ce83971fcaff61310579ac969e9a733e66af8419f8fd300501c866933f01a7d3528730b6344b3e../proc/self/mountssetarchlastsetarchsetarchsetarchsetarch../../../../usr/sbin/fsfreeze../../../../usr/sbin/readprofile../../../../usr/bin/setsid../../../../usr/bin/logger../../../../usr/bin/prlimit../../../../usr/bin/wdctl../../../../usr/bin/colrm../../../../usr/bin/ipcmk../../../../usr/bin/ul../../../../usr/bin/hexdump../../../../usr/sbin/partx../../../../usr/bin/umount../../../../usr/bin/setpriv../../../../usr/bin/lsns../../../../usr/sbin/wipefs../../../../usr/bin/su../../../../usr/sbin/losetup../../../../usr/bin/dmes�x�������������p������X�%�
�N���X�����(��$8����������������(�)�'��b84e20310f142338ea72aa6d8b75688681ea0d4b45aa0e8f87644855f734112d8ff9b4e42fc4287d5bb6b018a2d4576a7383cb0ff03607febebb22ed85e20c8cd934e7946ef9fdbb1d0007de52cd226f40296e03e535036906a748b622a828c8f41a639395cd88c5d56571619f9a81cd070ea08b12a4166ebd5dba938a05ccdfb42df1eb4a8eac8895d25667f73eff1ebeb5fa00da94e7663f0066012bb0b9522f2ce363ed66348c2486233cf8e50702aea59b737f7d32ac68864433946252d4001c6e8db25afc790fb0dc1caa06663c9885480e63708fdc806064e39d41432fe06c529abd1c3eb4d79a84be19a9d2be6f892f49478b936ad13c6f6b3dbd5cecb23e10c81aac312857af59307dbfcf2ff67d1c0ca671ead462a91152e7f855b53e57aba52c5572d9fe81a2a129fcf1f2a8049781c3dc56cfbb5373b270e134ff7d865c06382ff5a67f362d3a1b805710abe4667f3110413ce8480e525003f1de86ce1edc3891e8b6fee8f3029873bc4d23ab94b4f545cca420fece9674e3956a68e081089cd53a39e2a1ea0aeba50f148939b35db95bfc87482d6416fe8a93b3518174af42fc2643796cbfaf7fd0ee26de99d9a58f059b30b73e64f86983e0d728a343d4a89e31820e554b1f0aaa64842a156c0486f77b2bc9263fd8d2eb31b49b892e685a2622685f0db1f52fc83bfea6f0f78f27bafb41ea9816b06f0e9c3b5bb94ae02bd491e54b0b5d068afce3a4dbeaafaec2475b32e35d4ad37974526ccb2295248594e0a59c9b04789c86a4ea61450db28b49d222b6badb99e2485f43943117291c1c3d9af9d222b6badb99e2485f43943117291c1c3d9af.1b519d28e64cd72c01be2bab8ef34af59aa31be0eb72c551263ed75c3592bf6ee97b7193cd0b803b4c2a9c27a61d461d7d8abc060374f3d0cd93cbec3c95699abb089d63ec4395b9814f1d88b592740ddccb6c005d0465d0d07b495285a1f5a68c16aa864ce57a59ae7dbfafafd594375b1769e14da5d4fe8d032ab4c9b18c194418c0a964fa2c48ca1860859da99d3c3d0d6171f840e14fb6a4f38b490a627dee0b12d7ea2fd7cae12140a00da756abe0c14597fee4534ed175175d26b182e4de505564a26f85767ef3dbbac3ef6f3ff8d5fe2e8cb3050eb1fc1623dffc49ed5166a3a16af22eab118ab777a9455a009BB.pmConcise.pmShowlex.pmTerse.pmXref.pmConfig.pmConfig.podConfig_git.plConfig_heavy.plDynaLoader.pmFcntl.pmFileDosGlob.pmGlob.pmGDBM_File.pmHashUtilUtil.pmFieldHash.pmI18NLanginfo.pmIPCNDBM_File.pmO.pmODBM_File.pmOpcode.pmPOSIX.pmPOSIX.podPerlIOencoding.pmmmap.pmscalar.pmvia.pmSDBM_File.pmSysHostname.pmTieHashNamedCapture.pm_h2ph_pre.pharybase.pmasmasm-genericbitsperlong.phioctl.phioctls.phposix_types.phsocket.phsockios.phtermbits.phtermios.phbitsperlong.phioctl.phioctls.phposix_types.phposix_types_32.phposix_types_64.phposix_types_x32.phsocket.phsockios.phtermbits.phtermios.phunistd.phunistd_32.phunistd_64.phunistd_x32.phattributes.pmBB.soFcntlFcntl.soFileDosGlobDosGlob.soGlobGlob.soGDBM_FileGDBM_File.soHashUtilFieldHashFieldHash.soUtil.soI18NLanginfoLanginfo.soNDBM_FileNDBM_File.soODBM_FileODBM_File.soOpcodeOpcode.soPOSIXPOSIX.soPerlIOencodingencoding.sommapmmap.soscalarscalar.soviavia.soSDBM_FileSDBM_File.soSysHostnameHostname.soTieHashNamedCaptureNamedCapture.soarybasearybase.soattributesattributes.somromro.sobitsbyteswap.phendian.phioctl-types.phioctls.phlong-double.phpthreadtypes-arch.phpthreadtypes.phselect.phselect2.phsigaction.phsigcontext.phsigevent-consts.phsiginfo-arch.phsiginfo-consts-arch.phsiginfo-consts.phsignum-generic.phsignum.phsigstack.phsigthread.phsockaddr.phsocket.phsocket2.phsocket_type.phss_flags.phstdint-intn.phsyscall.phsyslog-ldbl.phsyslog-path.phsyslog.phthread-shared-types.phtypestypes.ph__sigset_t.ph__sigval_t.phclock_t.phclockid_t.phsig_atomic_t.phsigevent_t.phsiginfo_t.phsigset_t.phsigval_t.phstack_t.phstruct_iovec.phstruct_osockaddr.phstruct_rusage.phstruct_sigstack.phstruct_timespec.phstruct_timeval.phtime_t.phtimer_t.phtypesizes.phuintn-identity.phwaitflags.phwaitstatus.phwordsize.phendian.phfeatures.phgnustubs-64.phstubs.phlib.pmlinuxioctl.phposix_types.phstddef.phmachinemro.pmops.pmsignal.phstdarg.phstdc-predef.phstddef.phsyscdefs.phioctl.phselect.phsocket.phsyscall.phsyslog.phtime.phttydefaults.phtypes.phucontext.phwait.phsyscall.phsyslimits.phsyslog.phwait.phperl.1.gzperl5004delta.1.gzperl5005delta.1.gzperl5100�x�������������������X
&�
�������������$<��������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcronie-1.5.2-10.el8.src.rpm����������������������������������������������������������������������������������������������������������������config(cronie)croniecronie(x86-64)	@@@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/sh/bin/shconfig(cronie)coreutilsdailyjobslibaudit.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libdl.so.2()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libselinuxlibselinux.so.1()(64bit)pamrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)sedsystemdsystemdsystemd1.5.2-10.el82.0.641.0.13.0.4-14.6.0-14.0-15.2-14.14.3# empty /etc/crontab in case there are only old regular jobs
cp -a /etc/crontab /etc/crontab.rpmsave
sed -e '/^01 \* \* \* \* root run-parts \/etc\/cron\.hourly/d'\
  -e '/^02 4 \* \* \* root run-parts \/etc\/cron\.daily/d'\
  -e '/^22 4 \* \* 0 root run-parts \/etc\/cron\.weekly/d'\
  -e '/^42 4 1 \* \* root run-parts \/etc\/cron\.monthly/d' /etc/crontab.rpmsave > /etc/crontab
exit 0# Save the current service runlevel info
# User must manually run systemd-sysv-convert --apply crond
# to migrate them to systemd targets
/usr/bin/systemd-sysv-convert --save crond

# The package is allowed to autostart:
/bin/systemctl enable crond.service >/dev/null 2>&1

/sbin/chkconfig --del crond >/dev/null 2>&1 || :
/bin/systemctl try-restart crond.service >/dev/null 2>&1 || :
/bin/systemctl daemon-reload >/dev/null 2>&1 || :# changes in pam, glibc or libselinux can make crond crash
# when it calls pam
/bin/systemctl try-restart crond.service >/dev/null 2>&1 || :croniecronie-anacronglibclibselinuxpam1.4.7-21.4.1ehy@ehy@b��bo�aHw�a2@]�@\�[�h@Z�Zz�@Y���Yx�@Y�X��@Xk�@W�^@W�:�Wk�@V��U��@U�a@Ug@U6;�Tи@T��@T}��TX��Tw�S�G�S��S���S`�R��RB�@Q��Q��Q��Q�@Q�@P�!@P��@P��PG>�P��O�N��@N���N��N/��N(�N(�Ne@N�N�N	�@M��@M‘@MT�MQ0@M4/@M	�@M��M@L��@L��@L��@L�|�Le3�L_�LV�@K~}@Ky7@J�@J��@J�T�J�@J��@J�Q�J�Q�Jyt@Ji�@Jd\@J:,@I��@I�I��I��@IP�I��H�}@H�B�Hc��HW�@HF��H=I@H2�@G��@G��@G�O�G�f�G�e�Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-10Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-9Jan Staněk <jstanek@redhat.com> - 1.5.2-8Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-7Jan Staněk <jstanek@redhat.com> - 1.5.2-6Jan Staněk <jstanek@redhat.com> - 1.5.2-5Marcel Plch <mplch@redhat.com> - 1.5.2-4Marcel Plch <mplch@redhat.com> - 1.5.2-3Marcel Plch <mplch@redhat.com> - 1.5.2-2Tomáš Mráz <tmraz@redhat.com> - 1.5.2-1Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-9Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-8Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-7Tomáš Mráz <tmraz@redhat.com> - 1.5.1-6Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-5Tomáš Mráz <tmraz@redhat.com> - 1.5.1-4Tomáš Mráz <tmraz@redhat.com> - 1.5.1-3Tomáš Mráz <tmraz@redhat.com> - 1.5.1-2Tomáš Mráz <tmraz@redhat.com> - 1.5.1-1Fedora Release Engineering <releng@fedoraproject.org> - 1.5.0-4Tomáš Mráz <tmraz@redhat.com> - 1.5.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.5.0-2Tomáš Mráz <tmraz@redhat.com> - 1.5.0-1Tomáš Mráz <tmraz@redhat.com> - 1.4.12-6Tomáš Mráz <tmraz@redhat.com> - 1.4.12-5Tomáš Mráz <tmraz@redhat.com> - 1.4.12-4Tomáš Mráz <tmraz@redhat.c�x�������������`������X	�$�
��������8BVX�$F����������������VXUXWX�leans from Dan Walsh.
  * Add further error checking to seobject.py for setting booleans.- Uninvasive (ie no string or widget changes) HIG approximations
  in selinux-polgenui- Move s-c-selinux to the right menu- Fix boolean descriptions
- Fix semanage man page- Don't use prefix in gui- Update to upstream
        * Update audit2allow to report dontaudit cases from Dan Walsh.
        * Fix semanage port to use --proto from Caleb Case.- Update to upstream
        * Fix for segfault when conf file parse error occurs.- Don't show tabs on polgengui- Update to upstream
        * Merged fix fixfiles option processing from Vaclav Ovsik.
- Added existing users, staff and user_t users to polgengui- Add messages for audit2allow DONTAUDIT- Add ability to transition to roles via polgengui- Update to upstream
        * Make semodule_expand use sepol_set_expand_consume_base to reduce
          peak memory usage.- Update to upstream
        * Merged audit2why fix and semanage boolean --on/--off/-1/-0 support from Dan Walsh.
        * Merged a second fixfiles -C fix from Marshall Miller.- Don't initialize audit2allow for audit2why call.  Use default
- Update to upstream
        * Merged fixfiles -C fix from Marshall Miller.- Update to upstream
  * Merged audit2allow cleanups and boolean descriptions from Dan Walsh.
  * Merged setfiles -0 support by Benny Amorsen via Dan Walsh.
  * Merged fixfiles fixes and support for ext4 and gfs2 from Dan Walsh.- Update to upstream
  * Merged replacement for audit2why from Dan Walsh.- Cleanup fixfiles -f message in man page- Update to upstream
        * Merged update to chcat, fixfiles, and semanage scripts from Dan Walsh.
        * Merged sepolgen fixes from Dan Walsh.- handle files with spaces on upgrades- Add support in fixfiles for ext4 ext4dev and gfs2- Allow files with spaces to be used by setfiles- Add descriptions of booleans to audit2allow- Update to upstream
        * Merged support for non-interactive newrole command invocation from Tim Reed.- Change to use selinux bindings to audit2why- Fix fixfiles to handle no args- Fix roles output when creating a module- Handle files with spaces in fixfiles- Catch SELINUX_ERR with audit2allow and generate policy- Make sepolgen set error exit code when partial failure
- audit2why now checks booleans for avc diagnosis- Update to upstream
        * Update Makefile to not build restorecond if
          /usr/include/sys/inotify.h is not present- Fix sepolgen to be able to parse Fedora 9 policy
      Handle ifelse statements
      Handle refpolicywarn inside of define
      Add init.if and inetd.if into parse
      Add parse_file to syntax error message- Add scroll bar to fcontext gui page- Add Russion Man pages- Upgrade from NSA
        * Drop verbose output on fixfiles -C from Dan Walsh.
        * Fix argument handling in fixfiles from Dan Walsh.
        * Enhance boolean support in semanage, including using the .xml description when available, from Dan Walsh.
- Fix handling of final screen in polgengui- Fix handling of disable selinux button in gui- Upgrade from NSA
        * load_policy initial load option from Chad Sellers.- Don't show error on missing policy.xml- GUI Enhancements
  - Fix cgi generation
  - Use more patterns- Remove codec hacking, which seems to be fixed in python- Fix typo
- Change to upstream minimal privledge interfaces- Fix fixfiles argument parsing- Fix File Labeling add- Fix semanage to handle state where policy.xml is not installed- Remove -v from restorecon in fixfiles- Fix filter and search capabilities, add wait cursor- Translate booleans via policy.xml
- Allow booleans to be set via semanage- Require use of selinux-policy-devel- Validate semanage fcontext input
- Fix template names for log files in gui- Fix template to generate correct content- Fix consolekit link to selinux-polgengui- Fix the generation templates- Fix enable/disable audit messages- Add booleans page- Lots of updates to gui- Remove no.po
- Update to upstream
        * Fix semodule �x��������������~�����X
�%�
�p���p6�����$T��������������������teg@redhat.com> 0.10.38-7Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-6Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Matt Wilson <msw@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Ported CI gating tests to Python 3.6- add CI gating tests- fix CVE-2018-18751: double-free in xgettext (rhbz#1647049)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- xgettext --its segfault fix (rhbz#1531476)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Depend on the exact version of the library sub package- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- really remove Requires: git from gettext-devel (rhbz#1161284)
- make the BuildRequires unconditional (rhbz#1416691)- disable test-lock for 'gettext-tool' subdir too (rhbz#1406031)- Rebuild for Python 3.6- Subpackage msghack so that gettext doesn't depend on python
- name the new sub-package 'msghack'- devel subpackage to Require 'xz' (rhbz#1399270)- utilize %autosetup
- apply patch to fix po-send-mail when used with Emacs 25 (#1356642)- update to 0.19.8.1 release- update to 0.19.8 release- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- own .../gettext/its for third-party *.its files
- add a work around for test-isinf failure on ppc64le (#1297387)- apply patch to recognize .glade extension for GtkBuilder files (#1296653)- update to 0.19.7 release- update to 0.19.6 release- work around version conflict between gettextize and autopoint- update to 0.19.5.1 release- drop -el subpackage (#1234583)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Rebuilt for GCC 5 C++11 ABI change- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- port msghack.py to Python 3 (#1192086)- remove git dependency from -devel subpackage (#1161284)- update to 0.19.4 release- Disable the test_lock test as it often hangs on a number of arches- update to 0.19.3 release
- remove patches included in 0.19.3
- remove autoconf/automake/libtool/bison from BR, as we don't do bootstrap- apply patch to fix infloop in autopoint (Closes: #1151238)
- apply patch to support newer ncurses in F-22- apply patch to fix C octal character escape handling (Closes: #1147535)- rebuild for libunistring soname bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- update to 0.19.2 release- apply patch to msghack.py, for Python 3 compatibility (Closes: #1113425,
  thanks to Bohuslav "Slavek" Kabrda)- update to 0.19.1 release
- switch to xz-compressed archive- Rebuilt for h�x�������������Pn�����Xg$�
����������������$N���������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkexec-tools-2.0.26-14.el8_10.2.src.rpm�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������config(kexec-tools)kexec-toolskexec-tools(x86-64)@	@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@



@/bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/usr/bin/bashconfig(kexec-tools)coreutilsdracutdracut-networkdracut-squashethtoollibbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libdw.so.1()(64bit)libdw.so.1(ELFUTILS_0.122)(64bit)libdw.so.1(ELFUTILS_0.126)(64bit)libdw.so.1(ELFUTILS_0.143)(64bit)libelf.so.1()(64bit)libelf.so.1(ELFUTILS_1.0)(64bit)libelf.so.1(ELFUTILS_1.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)liblzma.so.5()(64bit)liblzma.so.5(XZ_5.0)(64bit)liblzo2.so.2()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libsnappy.so.1()(64bit)libtinfo.so.6()(64bit)libz.so.1()(64bit)libz.so.1(ZLIB_1.2.0)(64bit)libz.so.1(ZLIB_1.2.2.3)(64bit)libzstd.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)sedsystemd-unitssystemd-unitssystemd-unitszlib2.0.26-14.el8_10.2049-1290490493.0.4-14.6.0-14.0-15.2-14.14.3# Save the current service runlevel info
# User must manually run systemd-sysv-convert --apply kdump
# to migrate them to systemd targets
/usr/bin/systemd-sysv-convert --save kdump >/dev/null 2>&1 ||:

# Run these because the SysV package being removed won't do them
/usr/sbin/chkconfig --del kdump >/dev/null 2>&1 || :
/bin/systemctl try-restart kdump.service >/dev/null 2>&1 || :touch /etc/kdump.conf# List out the initrds here, strip out version nubmers
# and search for corresponding kernel installs, if a kernel
# is not found, remove the corresponding kdump initrd


IMGDIR=/boot
for i in `ls $IMGDIR/initramfs*kdump.img 2>/dev/null`
do
	KDVER=`echo $i | sed -e's/^.*initramfs-//' -e's/kdump.*$//'`
	if [ ! -e $IMGDIR/vmlinuz-$KDVER ]
	then
		# We have found an initrd with no corresponding kernel
		# so we should be able to remove it
		rm -f $i
	fi
donekernelkernel-PAEkernel-debugkernel-kdumpkernel-kdumpkernel-xenkexec-tools2.0.2-3f��fqv�e��e��@e]�@eL�e�e	�@dԈx��������������]�����Xe%�
����������qd�$a����������������qdrdpd�_set_ec_param_enc.3ssl.gzEVP_PKEY_CTX_set_ec_paramgen_curve_nid.3ssl.gzEVP_PKEY_CTX_set_ecdh_cofactor_mode.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_md.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_type.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_set_mac_key.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_bits.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_primes.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_pubexp.3ssl.gzEVP_PKEY_CTX_set_rsa_mgf1_md.3ssl.gzEVP_PKEY_CTX_set_rsa_oaep_md.3ssl.gzEVP_PKEY_CTX_set_rsa_padding.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_md.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_mgf1_md.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_saltlen.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_saltlen.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_set_scrypt_maxmem_bytes.3ssl.gzEVP_PKEY_CTX_set_scrypt_p.3ssl.gzEVP_PKEY_CTX_set_scrypt_r.3ssl.gzEVP_PKEY_CTX_set_signature_md.3ssl.gzEVP_PKEY_CTX_set_tls1_prf_md.3ssl.gzEVP_PKEY_METHOD.3ssl.gzEVP_PKEY_asn1_add0.3ssl.gzEVP_PKEY_asn1_add_alias.3ssl.gzEVP_PKEY_asn1_copy.3ssl.gzEVP_PKEY_asn1_find.3ssl.gzEVP_PKEY_asn1_find_str.3ssl.gzEVP_PKEY_asn1_free.3ssl.gzEVP_PKEY_asn1_get0.3ssl.gzEVP_PKEY_asn1_get0_info.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_asn1_new.3ssl.gzEVP_PKEY_asn1_set_check.3ssl.gzEVP_PKEY_asn1_set_ctrl.3ssl.gzEVP_PKEY_asn1_set_free.3ssl.gzEVP_PKEY_asn1_set_get_priv_key.3ssl.gzEVP_PKEY_asn1_set_get_pub_key.3ssl.gzEVP_PKEY_asn1_set_item.3ssl.gzEVP_PKEY_asn1_set_param.3ssl.gzEVP_PKEY_asn1_set_param_check.3ssl.gzEVP_PKEY_asn1_set_private.3ssl.gzEVP_PKEY_asn1_set_public.3ssl.gzEVP_PKEY_asn1_set_public_check.3ssl.gzEVP_PKEY_asn1_set_security_bits.3ssl.gzEVP_PKEY_asn1_set_set_priv_key.3ssl.gzEVP_PKEY_asn1_set_set_pub_key.3ssl.gzEVP_PKEY_asn1_set_siginf.3ssl.gzEVP_PKEY_assign_DH.3ssl.gzEVP_PKEY_assign_DSA.3ssl.gzEVP_PKEY_assign_EC_KEY.3ssl.gzEVP_PKEY_assign_POLY1305.3ssl.gzEVP_PKEY_assign_RSA.3ssl.gzEVP_PKEY_assign_SIPHASH.3ssl.gzEVP_PKEY_base_id.3ssl.gzEVP_PKEY_bits.3ssl.gzEVP_PKEY_check.3ssl.gzEVP_PKEY_cmp.3ssl.gzEVP_PKEY_cmp_parameters.3ssl.gzEVP_PKEY_copy_parameters.3ssl.gzEVP_PKEY_decrypt.3ssl.gzEVP_PKEY_decrypt_init.3ssl.gzEVP_PKEY_derive.3ssl.gzEVP_PKEY_derive_init.3ssl.gzEVP_PKEY_derive_set_peer.3ssl.gzEVP_PKEY_encrypt.3ssl.gzEVP_PKEY_encrypt_init.3ssl.gzEVP_PKEY_free.3ssl.gzEVP_PKEY_gen_cb.3ssl.gzEVP_PKEY_get0_DH.3ssl.gzEVP_PKEY_get0_DSA.3ssl.gzEVP_PKEY_get0_EC_KEY.3ssl.gzEVP_PKEY_get0_RSA.3ssl.gzEVP_PKEY_get0_asn1.3ssl.gzEVP_PKEY_get0_engine.3ssl.gzEVP_PKEY_get0_hmac.3ssl.gzEVP_PKEY_get0_poly1305.3ssl.gzEVP_PKEY_get0_siphash.3ssl.gzEVP_PKEY_get1_DH.3ssl.gzEVP_PKEY_get1_DSA.3ssl.gzEVP_PKEY_get1_EC_KEY.3ssl.gzEVP_PKEY_get1_RSA.3ssl.gzEVP_PKEY_get_default_digest_nid.3ssl.gzEVP_PKEY_get_raw_private_key.3ssl.gzEVP_PKEY_get_raw_public_key.3ssl.gzEVP_PKEY_id.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen_init.3ssl.gzEVP_PKEY_meth_add0.3ssl.gzEVP_PKEY_meth_copy.3ssl.gzEVP_PKEY_meth_find.3ssl.gzEVP_PKEY_meth_free.3ssl.gzEVP_PKEY_meth_get0.3ssl.gzEVP_PKEY_meth_get0_info.3ssl.gzEVP_PKEY_meth_get_check.3ssl.gzEVP_PKEY_meth_get_cleanup.3ssl.gzEVP_PKEY_meth_get_copy.3ssl.gzEVP_PKEY_meth_get_count.3ssl.gzEVP_PKEY_meth_get_ctrl.3ssl.gzEVP_PKEY_meth_get_decrypt.3ssl.gzEVP_PKEY_meth_get_derive.3ssl.gzEVP_PKEY_meth_get_digest_custom.3ssl.gzEVP_PKEY_meth_get_digestsign.3ssl.gzEVP_PKEY_meth_get_digestverify.3ssl.gzEVP_PKEY_meth_get_encrypt.3ssl.gzEVP_PKEY_meth_get_init.3ssl.gzEVP_PKEY_meth_get_keygen.3ssl.gzEVP_PKEY_meth_get_param_check.3ssl.gzEVP_PKEY_meth_get_paramgen.3ssl.gzEVP_PKEY_meth_get_public_check.3ssl.gzEVP_PKEY_meth_get_sign.3ssl.gzEVP_PKEY_meth_get_signctx.3ssl.gzEVP_PKEY_meth_get_verify.3ssl.gzEVP_PKEY_meth_get_verify_recover.3ssl.gzEVP_PKEY_meth_get_verifyctx.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_remove.3ssl.gzEVP_PKEY_meth_set_check.3ssl.gzEVP_PKEY_meth_set_cleanup.3ssl.gzEVP_PKEY_meth_set_copy.3ssl.gzEVP_PKEY_meth_set_ctrl.3ssl.gzEVP_PKEY_meth_set_decrypt.3ssl.gzEVP_PKEY_meth_set_derive.3ssl.gzEVP_PKEY_meth_set_digest_c�x����������M�����XI�$�
������8c����V�$F����������������VUW�g../../../../usr/bin/ipcs../../../../usr/sbin/fstrim../../../../usr/bin/mountpoint../../../../usr/sbin/agetty../../../../usr/sbin/delpart../../../../usr/bin/look../../../../usr/bin/setarch../../../../usr/bin/nsenter../../../../usr/sbin/swaplabel../../../../usr/bin/chmem../../../../usr/bin/isosize../../../../usr/sbin/addpart../../../../usr/sbin/blockdev../../../../usr/sbin/swapoff../../../../usr/bin/uuidgen../../../../usr/bin/raw../../../../usr/bin/utmpdump../../../../usr/bin/scriptreplay../../../../usr/bin/login../../../../usr/sbin/sfdisk../../../../usr/sbin/sulogin../../../../usr/bin/namei../../../../usr/bin/cal../../../../usr/bin/findmnt../../../../usr/sbin/runuser../../../../usr/sbin/blkdiscard../../../../usr/bin/getopt../../../../usr/sbin/fsck.minix../../../../usr/sbin/fsck.cramfs../../../../usr/sbin/mkswap../../../../usr/sbin/fdisk../../../../usr/bin/lslogins../../../../usr/bin/more../../../../usr/bin/lsmem../../../../usr/bin/fallocate../../../../usr/sbin/mkfs.cramfs../../../../usr/bin/ipcrm../../../../usr/sbin/switch_root../../../../usr/bin/lsblk../../../../usr/bin/last../../../../usr/sbin/chcpu../../../../usr/sbin/rfkill../../../../usr/bin/taskset../../../../usr/sbin/swapon../../../../usr/sbin/rtcwake../../../../usr/bin/mount../../../../usr/bin/rev../../../../usr/bin/rename../../../../usr/sbin/mkfs.minix../../../../usr/bin/colcrt../../../../usr/sbin/ctrlaltdel../../../../usr/sbin/cfdisk../../../../usr/sbin/blkzone../../../../usr/bin/whereis../../../../usr/sbin/ldattach../../../../usr/bin/write../../../../usr/sbin/mkfs../../../../usr/bin/chrt../../../../usr/bin/lsipc../../../../usr/bin/eject../../../../usr/bin/flock../../../../usr/bin/unshare../../../../usr/sbin/pivot_root../../../../usr/bin/lscpu../../../../usr/bin/lslocks../../../../usr/bin/wall../../../../usr/bin/mesg../../../../usr/bin/fincore../../../../usr/bin/renice../../../../usr/bin/uuidparse../../../../usr/bin/column../../../../usr/bin/script../../../../usr/bin/col../../../../usr/sbin/nologin../../../../usr/sbin/fsck../../../../usr/sbin/fdformat../../../../usr/bin/setterm../../../../usr/bin/kill../../../../usr/sbin/findfs../../../../usr/bin/mcookie../../../../usr/sbin/resizepart../../../../usr/bin/ionice../../../../usr/sbin/hwclock../../../../usr/sbin/zramctl../../../../usr/sbin/blkidhwclocksuY�x��������������<�����X\%�
���������Z������zd�$j����������������zd{dyd�opensslaes.hasn1.hasn1_mac.hasn1err.hasn1t.hasync.hasyncerr.hbio.hbioerr.hblowfish.hbn.hbnerr.hbuffer.hbuffererr.hcamellia.hcast.hcmac.hcms.hcmserr.hcomp.hcomperr.hconf.hconf_api.hconferr.hcrypto.hcryptoerr.hct.hcterr.hdes.hdh.hdherr.hdsa.hdsaerr.hdtls1.he_os2.hebcdic.hec.hecdh.hecdsa.hecerr.hengine.hengineerr.herr.hevp.hevperr.hfips.hfips_rand.hhmac.hidea.hkdf.hkdferr.hlhash.hmd2.hmd4.hmd5.hmdc2.hmodes.hobj_mac.hobjects.hobjectserr.hocsp.hocsperr.hopensslconf-x86_64.hopensslconf.hopensslv.hossl_typ.hpem.hpem2.hpemerr.hpkcs12.hpkcs12err.hpkcs7.hpkcs7err.hrand.hrand_drbg.hranderr.hrc2.hrc4.hrc5.hripemd.hrsa.hrsaerr.hsafestack.hseed.hsha.hsrp.hsrtp.hssl.hssl2.hssl3.hsslerr.hstack.hstore.hstoreerr.hsymhacks.htls1.hts.htserr.htxt_db.hui.huierr.hwhrlpool.hx509.hx509_vfy.hx509err.hx509v3.hx509v3err.hlibcrypto.solibssl.solibcrypto.pclibssl.pcopenssl.pcopenssl-develCHANGESdir-locals.example.elopenssl-c-indent.elACCESS_DESCRIPTION_free.3ssl.gzACCESS_DESCRIPTION_new.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS_free.3ssl.gzADMISSIONS_get0_admissionAuthority.3ssl.gzADMISSIONS_get0_namingAuthority.3ssl.gzADMISSIONS_get0_professionInfos.3ssl.gzADMISSIONS_new.3ssl.gzADMISSIONS_set0_admissionAuthority.3ssl.gzADMISSIONS_set0_namingAuthority.3ssl.gzADMISSIONS_set0_professionInfos.3ssl.gzADMISSION_SYNTAX.3ssl.gzADMISSION_SYNTAX_free.3ssl.gzADMISSION_SYNTAX_get0_admissionAuthority.3ssl.gzADMISSION_SYNTAX_get0_contentsOfAdmissions.3ssl.gzADMISSION_SYNTAX_new.3ssl.gzADMISSION_SYNTAX_set0_admissionAuthority.3ssl.gzADMISSION_SYNTAX_set0_contentsOfAdmissions.3ssl.gzASIdOrRange_free.3ssl.gzASIdOrRange_new.3ssl.gzASIdentifierChoice_free.3ssl.gzASIdentifierChoice_new.3ssl.gzASIdentifiers_free.3ssl.gzASIdentifiers_new.3ssl.gzASN1_ENUMERATED_get.3ssl.gzASN1_ENUMERATED_get_int64.3ssl.gzASN1_ENUMERATED_set.3ssl.gzASN1_ENUMERATED_set_int64.3ssl.gzASN1_ENUMERATED_to_BN.3ssl.gzASN1_GENERALIZEDTIME_adj.3ssl.gzASN1_GENERALIZEDTIME_check.3ssl.gzASN1_GENERALIZEDTIME_print.3ssl.gzASN1_GENERALIZEDTIME_set.3ssl.gzASN1_GENERALIZEDTIME_set_string.3ssl.gzASN1_INTEGER_get.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_uint64.3ssl.gzASN1_INTEGER_set.3ssl.gzASN1_INTEGER_set_int64.3ssl.gzASN1_INTEGER_set_uint64.3ssl.gzASN1_INTEGER_to_BN.3ssl.gzASN1_ITEM.3ssl.gzASN1_ITEM_get.3ssl.gzASN1_ITEM_lookup.3ssl.gzASN1_OBJECT_free.3ssl.gzASN1_OBJECT_new.3ssl.gzASN1_STRING_TABLE.3ssl.gzASN1_STRING_TABLE_add.3ssl.gzASN1_STRING_TABLE_cleanup.3ssl.gzASN1_STRING_TABLE_get.3ssl.gzASN1_STRING_cmp.3ssl.gzASN1_STRING_data.3ssl.gzASN1_STRING_dup.3ssl.gzASN1_STRING_free.3ssl.gzASN1_STRING_get0_data.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_new.3ssl.gzASN1_STRING_print.3ssl.gzASN1_STRING_print_ex.3ssl.gzASN1_STRING_print_ex_fp.3ssl.gzASN1_STRING_set.3ssl.gzASN1_STRING_to_UTF8.3ssl.gzASN1_STRING_type.3ssl.gzASN1_STRING_type_new.3ssl.gzASN1_TIME_adj.3ssl.gzASN1_TIME_check.3ssl.gzASN1_TIME_cmp_time_t.3ssl.gzASN1_TIME_compare.3ssl.gzASN1_TIME_diff.3ssl.gzASN1_TIME_normalize.3ssl.gzASN1_TIME_print.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set_string.3ssl.gzASN1_TIME_set_string_X509.3ssl.gzASN1_TIME_to_generalizedtime.3ssl.gzASN1_�x�������������0,�����X&�
�����������������$����������������a	�����`@уqэh^'U�x�������������������X�%�
@��7����r�$b����������������rqs�Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Add patch for OpenSSL 1.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Split libtspi to a trousers-lib subpackage (#1225062)
- Fix FTBFS with current gcc (drop inline keyword when bogus)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- New upstream bug fix release- Fix crash when linking libgnutls and libmysqlclient (#1069079)
- Don't order tcsd after syslog.target (#1055198)- Minor spec cleanups- New upstream bug fix and license change release- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Remove +x bit from service file (#963916)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- New upstream bug fix release- Make daemon full RELRO- bz #836476 - Provide native systemd service- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- New upstream bug fix release- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- New upstream bug fix release- Fix paths in man pages, mark them as %doc -- fix BZ#676394- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fix init script to conform to Fedora guidelines
- Do not overuse macros- Fix issue freeing a data structure- New upstream bug fix release
- Upstream requested the tpm-emulator patch be dropped- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Do not overuse macros.
- Removed unnecessary file requirements on chkconfig, ldconfig and service,
  now requiring the initscripts and chkconfig packages.- Fix a typo in groupadd causing the %pre scriptlet to fail (resolves BZ#486155).- Fix FTBFS: added trousers-0.3.1-gcc44.patch- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild with new openssl- Bump release to avoid wrong tag in rawhide- Work around SELinux namespace pollution (#464037)
- Use SO_REUSEADDR
- Use TPM emulator if it's available and no hardware is- Use the uid/gid pair assigned to trousers from BZ#457593- Incorporated changes from the RHEL package which were done by Steve Grubb- Fix cast issue preventing successful build on ppc64 and x86_64- Fix for BZ #434267 and #440733. Patch authored by Debora Velarde- Autorebuild for GCC 4.3- Updated static rpm's comment line (too long)- Updated specfile for RHBZ#323441 comment #28- Updated specfile for RHBZ#323441 comment #22- Updated to include the include dirs in the devel package;
added the no-install-hooks patch- Updated specfile for RHBZ#323441 comment #13- Updated specfile for comments in RHBZ#323441- Updated build section to use smp_mflags
- Removed .la file from installed dest and files section- Initial add of changelog tag for trousers CVS/bin/sh/bin/sh/bin/sh/bin/sh	
0.3.15-2.el80.3.15-2.el80.3.15-2.el8	
tcsd.conf.build-id0dbc815834d8966763d592edfdca1306117b0277tcsd.servicetcsdtrousersChangeLogREADMEtcsd.conf.5.gztcsd.8.gztpm/etc//usr/lib//usr/lib/.build-id//usr/lib/.build-id/0d//usr/lib/systemd/system//usr/sbin//usr/share/doc//usr/share/doc/trousers//usr/share/man/man5//usr/share/man/man8//var/lib/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically link�x������������� �����X
%�
���������y�������d�$\�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������X������XG%�
���������������d�����$'�����������������d�d�d�.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzECPKParameters_print.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_POINT_add.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_POINT_add.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_copy.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_get_enc_flags.3ssl.gzBIO_get_ex_new_index.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_add.3ssl.gzEC_GROUP_new.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzOPENSSL_load_builtin_modules.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGINE_add.3ssl.gzENGIN�x����������������X2&�
�C����H�������$>��������������������es: RHEL-2609- Set 'missingok' for /etc/cron.deny to not recreate it on update- Add support for "~" ("random within range") 
  Resolves: rhbz#1832510- Use system-auth for PAM authentication
  Resolves: rhbz#2005526- Create PID files even when crond does not fork
  Resolves: rhbz#1926300- Make crond restart on failure
- Resolves: rhbz#1715137- use role from the current context for system crontabs
- Resolves: rhbz#1708557- Covscan issues review
- Fix potential memory leaks
- Fix unsafe code
- Resolves: rhbz#1602467- new upstream release 1.5.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- fix Y2038 problems in cron and anacron (#1445136)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- make failure of creation of the ghost files in /var non-fatal- on some machines the power supply is named ADP0- query power status directly from kernel- new upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- the temp file name used by crontab needs to be ignored by crond- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- new upstream release- mark the 0hourly and dailyjobs crontabs as config
- do not add already existing orphan on reload- correct the permissions of the anacron timestamp files- check for NULL pamh on two more places (#1176215)- call PAM only for non-root user or non-system crontabs (#956157)
- bypass the PAM check in crontab for root (#1169175)- refresh user entries when jobs are run- new release 1.4.12
- remove gpl2 license, because it's part of upstream COPYING now- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- unwanted fd could make trouble to SElinux 1075106- Drop INSTALL from docs, fix rpmlint tabs vs spaces warning.- some jobs are not executed because not all environment variables are set 995590
- cronie's systemd script use "KillMode=process" 919290- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- scriptlets are not created correctly if systemd is not in BR 986698
- remove sub-package sysvinit, which is not needed anymore
- update license, anacron is under GPLv2+- new release 1.4.11 (contains previous bug fixes from 1.4.10-5)- add support for RANDOM_DELAY - delaying job startups
- pass some environment variables to processes (LANG, etc.) (#969761)
- do not use putenv() with string literals (#971516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- change configuration files to 644
- change 6755 to 4755 for crontab binary- New release 1.4.10- New release 1.4.9- Scriptlets replaced with new systemd macros (#850070)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for glibc bug#747377- make crond run a little bit later in the boot process (#747759)- change triggerun to fix 735802 during upgrade- rebuild again, ppc still had the broken rpm in the buildroots- rebuild (broken rpm in buildroot)- fix permission of init.d/crond- drop the without systemd build condition
- add the chkconfig readding trigger to the sysvinit subpackage- start crond after auditd- fix inotify support to not leak fds (#717505)- update to 1.4.8
- create sub-package sysvinit for initscript- missing requirement on systemd-sysv for scriptlets- use only systemd units with systemd
- add trigger for restart on glibc, libselinux or pam upgrades (#699189)- new release 1.4.7- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- enable crond even with systemctl- 663193 rewritten selinux support- apply selinux patch from dwalsh- do not lock jobs that fall out of allowed range - 661966- fix post (thanks plautrba for review)- systemd init script 617320- fix typos in man pages- update to 1.4.�x�������������x������X�$�
���������������UX�$E����������������UXTXVX�- fix audit2allow man page- Fix Japanese translations- Change md5 to hashlib.md5 in sepolgen- Rebuild for Python 2.6- Fix error checking in restorecond, for inotify_add_watch- Update to upstream
        * semanage: use semanage_mls_enabled() from Stephen Smalley.- Rebuild for Python 2.6- Update to upstream
        * fcontext add checked local records twice, fix from Dan Walsh.- Update to upstream
        * Allow local file context entries to override policy entries in
        semanage from Dan Walsh.
        * Newrole error message corrections from Dan Walsh.
        * Add exception to audit2why call in audit2allow from Dan Walsh.- add compression- Move the usermode-gtk requires to the -gui subpackage.- Fix traceback in audit2why- Make GUI use translations- Fix typo in man page- Handle selinux disabled correctly
- Handle manipulation of fcontext file correctly- Add usermode-gtk requires- Allow addition of local modifications of fcontext policy.- Fix system-config-selinux booleanspage throwing and exception
- Update po files- Fix text in newrole
- Fix revertbutton on booleans page in system-config-selinux- Change semodule calls for libsemanage- Update to upstream
        * Update po files from Dan Walsh.- Fix semanage help display
- Update to upstream
        * fixfiles will now remove all files in /tmp and will check for
          unlabeled_t in /tmp and /var/tmp from Dan Walsh.
        * add glob support to restorecond from Dan Walsh.
        * allow semanage to handle multi-line commands in a single transaction
          from Dan Walsh.- Only call gen_requires once in sepolgen- Change Requires line to gnome-python2-gnome
- Fix spelling mistakes
- Require libselinux-utils- Add node support to semanage- Fix fixfiles to correct unlabeled_t files and remove .? files- Add glob support to restorecond so it can check every file in the homedir- Update to upstream
        * Merged semanage node support from Christian Kuester.- Add require libsemanage-python- Add missing html_util.py file- Fixes for multiple transactions- Allow multiple transactions in one semanage command- Update to upstream
        * Add support for boolean files and group support for seusers from Dan Walsh.
        * Ensure that setfiles -p output is newline terminated from Russell Coker.- Allow semanage user to add group lists % groupname- Fix help- Update to upstream
        * Change setfiles to validate all file_contexts files when using -c from Stephen Smalley.- Fix boolean handling
- Upgrade to latest sepolgen
- Update po patch- Additial cleanup of boolean handling for semanage- Handle ranges of ports in gui- Fix indent problems in seobject- Add lockdown wizard
- Allow semanage booleans to take an input file an process lots of booleans at once.- Default prefix to "user"- Remove semodule use within semanage
- Fix launching of polgengui from toolbar- Update to upstream
        * Fix audit2allow generation of role-type rules from Karl MacMillan.- Fix spelling of enforcement- Fix sepolgen/audit2allow handling of roles- Fix sepolgen-ifgen processing- Add deleteall to semanage permissive, cleanup error handling- Complete removal of rhpl requirement- Add semanage permissive *- Fix fixfiles to cleanup /tmp and /var/tmp- Fix listing of types in gui- Update to upstream
        * Remove security_check_context calls for prefix validation from semanage.
        * Change setfiles and restorecon to not relabel if the file already has the correct context value even if -F/force is specified.- Remove /usr/share/locale/sr@Latn/LC_MESSAGES/policycoreutils.mo- Add rm -rf /tmp/gconfd-* /tmp/pulse-* /tmp/orbit-* to fixfiles restore
- So that mislabeled files will get removed on full relabel- Make restorecond not start by default
- Fix polgengui to allow defining of confined roles.
- Add patches from Lubomir Rintel <lkundrak@v3.sk>
  * Add necessary runtime dependencies on setools-console for -gui
  * separate stderr when run seinfo commands
- Update to upstream
  * Update semanage man page for boo�x��������������������X�%�
���������p����!�$�����������������!�!�!�Na.plW.plExtY.plGCBCN.plEB.plEX.plLV.plLVT.plPP.plSM.plXX.plGcC.plCf.plCn.plL.plLC.plLl.plLm.plLo.plLu.plM.plMc.plMe.plMn.plN.plNd.plNl.plNo.plP.plPc.plPd.plPe.plPf.plPi.plPo.plPs.plS.plSc.plSk.plSm.plSo.plZ.plZs.plGrBaseY.plHexY.plHstNA.plHyphenT.plIDCY.plIDSY.plIdeoY.plIn2_0.pl2_1.pl3_0.pl3_1.pl3_2.pl4_0.pl4_1.pl5_0.pl5_1.pl5_2.pl6_0.pl6_1.pl6_2.pl6_3.pl7_0.pl8_0.pl9_0.plInPCBottom.plLeft.plLeftAndR.plNA.plOverstru.plRight.plTop.plTopAndBo.plTopAndL2.plTopAndLe.plTopAndRi.plVisualOr.plInSCAvagraha.plBindu.plCantilla.plConsona2.plConsona3.plConsona4.plConsona5.plConsona6.plConsonan.plInvisibl.plNukta.plNumber.plOther.plPureKill.plSyllable.plToneMark.plVirama.plVisarga.plVowel.plVowelDep.plVowelInd.plJgAin.plAlef.plBeh.plDal.plFarsiYeh.plFeh.plGaf.plHah.plKaf.plLam.plNoJoinin.plQaf.plReh.plSad.plSeen.plWaw.plYeh.plJtC.plD.plR.plT.plU.plLbAI.plAL.plBA.plBB.plCJ.plCL.plCM.plEB.plEX.plGL.plID.plIN.plIS.plNS.plOP.plPO.plPR.plQU.plSA.plXX.plLowerY.plMathY.plNFCQCM.plY.plNFDQCN.plY.plNFKCQCN.plY.plNFKDQCN.plY.plNtDi.plNone.plNu.plNv0.pl1.pl10.pl100.pl1000.pl10000.pl11.pl12.pl13.pl14.pl15.pl16.pl17.pl18.pl19.pl1_16.pl1_2.pl1_3.pl1_4.pl1_8.pl2.pl20.pl200.pl2_3.pl3.pl30.pl300.pl3_16.pl3_4.pl4.pl40.pl400.pl5.pl50.pl500.pl5000.pl50000.pl6.pl60.pl600.pl7.pl70.pl700.pl8.pl80.pl800.pl9.pl90.pl900.plPCMY.plPatSynY.plPerlAlnum.plAssigned.plBlank.plGraph.plPerlWord.plPosixPun.plPrint.plSpacePer.plTitle.plWord.plXPosixPu.pl_PerlAny.pl_PerlCh2.pl_PerlCha.pl_PerlFol.pl_PerlIDC.pl_PerlIDS.pl_PerlNch.pl_PerlPat.pl_PerlPr2.pl_PerlPro.pl_PerlQuo.plQMarkY.plSBAT.plCL.plEX.plFO.plLE.plLO.plNU.plSC.plST.plSp.plUP.plXX.plSDY.plSTermY.plScArab.plArmn.plBeng.plBhks.plCham.plCprt.plCyrl.plDeva.plDupl.plEthi.plGeor.plGlag.plGran.plGrek.plGujr.plGuru.plHan.plHang.plHebr.plHira.plHmng.plKana.plKhar.plKhmr.plKnda.plLana.plLao.plLatn.plLimb.plLinb.plMlym.plMong.plMult.plOrya.plSinh.plTalu.plTaml.plTelu.plTibt.plXsux.plZinh.plZyyy.plZzzz.plScxAdlm.plArab.plArmn.plBeng.plBopo.plCakm.plCopt.plCprt.plCyrl.plDeva.plDupl.plGeor.plGlag.plGran.plGrek.plGujr.plGuru.plHan.plHang.plHira.plKana.plKnda.plLatn.plLimb.plLina.plLinb.plMlym.plMong.plMult.plMymr.plOrya.plPhlp.plShrd.plSind.plSinh.plSyrc.plTagb.plTakr.plTaml.plTelu.plThaa.plTirh.plYi.plZinh.plZyyy.plTermY.plUIdeoY.plUpperY.plWBEX.plExtend.plFO.plHL.plKA.plLE.plMB.plML.plMN.plNU.plXX.plXIDCY.plXIDSY.plversionutf8.pmutf8_heavy.plvendor_perlwarnings.pm/usr/lib//usr/lib/.build-id/a2//usr/lib/.build-id/e0//usr/lib64//usr/lib64/perl5//usr/lib64/perl5/CORE//usr/lib64/perl5/auto//usr/lib64/perl5/auto/re//usr/lib64/perl5/vendor_perl//usr/share/doc//usr/share/doc/perl-libs//usr/share/licenses//usr/share/licenses/perl-libs//usr/share/man/man3//usr/share//usr/share/perl5//usr/share/perl5/unicore//usr/share/perl5/unicore/To//usr/share/perl5/unicore/lib//usr/share/perl5/unicore/lib/Age//usr/share/perl5/unicore/lib/Alpha//usr/share/perl5/unicore/lib/Bc//usr/share/perl5/unicore/lib/BidiC//usr/share/perl5/unicore/lib/BidiM//usr/share/perl5/unicore/lib/Blk//usr/share/perl5/unicore/lib/Bpt//usr/share/perl5/unicore/lib/CE//usr/share/perl5/unicore/lib/CI//usr/share/perl5/unicore/lib/CWCF//usr/share/perl5/unicore/lib/CWCM//usr/share/perl5/unicore/lib/CWKCF//usr/share/perl5/unicore/lib/CWL//usr/share/perl5/unicore/lib/CWT//usr/share/perl5/unicore/lib/CWU//usr/share/perl5/unicore/lib/Cased//usr/share/perl5/unicore/lib/Ccc//usr/share/perl5/unicore/lib/CompEx//usr/share/perl5/unicore/lib/DI//usr/share/perl5/unicore/lib/Dash//usr/share/perl5/unicore/lib/Dep//usr/share/perl5/unicore/lib/Dia//usr/share/perl5/unicore/lib/Dt//usr/share/perl5/unicore/lib/Ea//usr/share/perl5/unicore/lib/E�x�������������h������X�%�
������������2��$"����������������2�3�1��99)
- Remove bundled perl-B-Debug (bug #1142952)
- Remove bundled perl-ExtUtils-CBuilder (bug #1144033)
- Remove bundled perl-ExtUtils-Install (bug #1144068)- Move all Module-CoreList files into perl-Module-CoreList
- Sub-package corelist(1) into perl-Module-CoreList-tools (bug #1142757)
- Remove bundled perl-Module-CoreList, and perl-Module-CoreList-tools
  (bug #1142757)
- Sub-package Devel-PPPort (bug #1143999)
- Sub-package B-Debug (bug #1142952)
- Use native version for perl-ExtUtils-CBuilder
- Specify all dependencies for perl-ExtUtils-Install (bug #1144068)
- Require perl-ExtUtils-ParseXS by perl-ExtUtils-MakeMaker because of xsubpp- Provide 5.20.0 MODULE_COMPAT- 5.20.1 bump (see <http://search.cpan.org/dist/perl-5.20.1/pod/perldelta.pod>
  for release notes)
- Sub-package perl-ExtUtils-Miniperl (bug #1141222)- Specify all dependencies for perl-CPAN (bug #1090112)
- Disable non-core modules at perl-CPAN when bootstrapping
- Remove bundled perl-CPAN (bug #1090112)- Stop providing old perl(MODULE_COMPAT_5.18.*)- Update to Perl 5.20.0
- Clean patches, not needed with new version
- Update patches to work with new version
- Update version of sub-packages, remove the deleted sub-packages
- Sub-package perl-IO-Socket-IP, perl-experimental
- Disable BR perl(local::lib) for cpan tool when bootstraping- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Declare dependencies for cpan tool (bug #1122498)
- Use stronger algorithm needed for FIPS in t/op/crypt.t (bug #1128032)
- Make *DBM_File desctructors thread-safe (bug #1107543)- Sub-package perl-Term-ANSIColor and remove it (bug #1121924)- Remove bundled perl-App-a2p, perl-App-find2perl, perl-App-s2p, and
  perl-Package-Constants
- Correct perl-App-s2p license to ((GPL+ or Artistic) and App-s2p)- Sub-package perl-App-find2perl (bug #1111196)
- Sub-package perl-App-a2p (bug #1111232)
- Sub-package perl-App-s2p (bug #1111242)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Pass -fwrapv to stricter GCC 4.9 (bug #1082957)- Fix t/comp/parser.t not to load system modules (bug #1084399)- Move macro files into %{_rpmconfigdir}/macros.d- Provide perl(CPAN::Meta::Requirements) with six decimal places- Drop perl-Test-Simple-tests package is it is not delivered by dual-lived
  version
- Hide dual-lived perl-Object-Accessor- Use a macro to cover all 64-bit PowerPC architectures (bug #1052709)- Use upstream patch to fix a test failure in perl5db.t when TERM=vt100- 5.18.2 bump (see <http://search.cpan.org/dist/perl-5.18.2/pod/perldelta.pod>
  for release notes)- Document Math::BigInt::CalcEmu requires Math::BigInt (bug #959096)- perl_default_filter macro does not need to filter private libraries from
  provides (bug #1020809)
- perl_default_filter anchors the filter regular expressions
- perl_default_filter appends the filters instead of redefining them- Fix rules for parsing numeric escapes in regexes (bug #978233)
- Fix crash with \&$glob_copy (bug #989486)
- Fix coreamp.t's rand test (bug #970567)
- Reap child in case where exception has been thrown (bug #988805)
- Fix using regexes with multiple code blocks (bug #982131)- 5.18.1 bump (see <http://search.cpan.org/dist/perl-5.18.1/pod/perldelta.pod>
  for release notes)
- Disable macro %{rebuild_from_scratch}
- Fix regex seqfault 5.18 regression (bug #989921)
- Fixed interpolating downgraded variables into upgraded (bug #970913)
- SvTRUE returns correct value (bug #967463)
- Fixed doc command in perl debugger (bug #967461)
- Fixed unaligned access in slab allocator (bug #964950)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.16.*)- Perl 5.18 rebuild- Define SONAME for libperl.so and move the libary into standard path
- Link XS modules to libperl.so on Linux (bug #960048)- Do not load system Term::ReadLine::Gnu while running tests
- Disable ornaments on perl5db AutoTrace tests- Update to Perl 5.18.0
- Clean patches, not needed with new version- Edit local patch level before compilat�x�������������������X%$�
������������������$f�����������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������X������X�%�
�������{������r!�$b����������������r!q!s!�6.3../../libperl.so.5.26.3��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������І�����X�%�
00����������������$Q��������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgettext-0.19.8.1-17.el8.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������/bin/gettextbundled(gnulib)gettextgettext(x86-64)	@@@@@@@@@@@@@@@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/shgettext-libs(x86-64)infoinfolibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcroco-0.6.so.3()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libgettextlib�x�������������Hv�����X|%�
��������@�����.X�$>����������������.X/X-X��x��������������e�����X�#�
�������������~��$n����������������~�}��� option
- Resolves: rhbz#1212341 - [RFE] Allow plugins to override the core configuration
- Resolves: rhbz#1299482 - mock --init fails with message "Failed calculating RPMDB checksum"
- Resolves: rhbz#1488398 - dnf upstream tests failures on f26
- Resolves: rhbz#1192811 - dnf whatprovides should show which provides matched a pattern
- Resolves: rhbz#1288845 - "dnf provides" wildcard matching is unreliable (not all packages with matches listed)
- Resolves: rhbz#1473933 - [abrt] dnf-automatic: resolved(): rpm_conf.py:58:resolved:AttributeError: 'Rpmconf' object has no attribute '_interactive'
- Resolves: rhbz#1237349 - dnf autoremove not removing what dnf list extras shows
- Resolves: rhbz#1470050 - the 'priority=' option in /etc/yum.repos.d/*.repo is not respected
- Resolves: rhbz#1347927 - dnf --cacheonly downloads packages
- Resolves: rhbz#1478115 - [abrt] dnf: _hcmd_undo(): __init__.py:888:_hcmd_undo:IndexError: list index out of range
- Resolves: rhbz#1461171 -  RFE: support --advisory= with install
- Resolves: rhbz#1448874 - "dnf needs-restarting" vanished from bash completion
- Resolves: rhbz#1495116 - Dnf version fails with traceback in container- Fix problem with dnf.Package().remote_location() (RhBug:1476215) (Jaroslav
  Mracek)
- Change behavior of -C according to documentation (RhBug:1473964) (Jaroslav
  Mracek)
- It should prevent to ask attribute of None (RhBug:1359482) (Jaroslav Mracek)
- Solve a problems with --arch options (RhBug:1476834) (Jaroslav Mracek)
- Use security plugin code for dnf-automatic (Jaroslav Mracek)
- Fix unicode error for python2 (Jaroslav Mracek)
- Inform about packages installed for group (Jaroslav Mracek)
- Provide info if pkg is removed due to dependency (RhBug:1244755) (Jaroslav
  Mracek)
- Unify format of %{_mandir} paths in dnf.spec (Jaroslav Mracek)
- Remove test_yumlayer.py as unneeded test (Jaroslav Mracek)
- Provide yum4 package for rhel7 build (Jaroslav Mracek)
- Make yum compatible layer very minimal (RhBug:1476748) (Jaroslav Mracek)
- Remove metadata_expire from yum compatible layer (Jaroslav Mracek)
- Remove keepcache from yum compatibility layer (Jaroslav Mracek)
- Remove options from yum conf (Jaroslav Mracek)
- Remove unused functionality from  yum compatible layer (Jaroslav Mracek)
- Add deplist command for dnf (Jaroslav Mracek)
- Fix problems with --downloaddir options (RhBug:1476464) (Jaroslav Mracek)
- Move description of --forcearch into proper place (Jaroslav Mracek)
- Provide description of --downloaddir option (Jaroslav Mracek)
- Fix if in spec file (Jaroslav Mracek)
- Add description of "test" tsflags (Jaroslav Mracek)
- Enable import gpg_keys with tsflag test (RhBug:1464192) (Jaroslav Mracek)
- Keep old reason when undoing erase (RhBug:1463107) (Eduard Čuba)
- spec: eliminate other weak dependencies for el<=7 (Igor Gnatenko)
- spec: do not strongly require inhibit plugin (Igor Gnatenko)
- Inform that packages are only downloaded (RhBug:1426196) (Jaroslav Mracek)
- Move releasever check after the etc/dnf/vars substitutions. (Alexander
  Kanavin)
- Provide substitution for Repodict.add_new_repo() (RhBug:1457507) (Jaroslav
  Mracek)- Remove autodeglob optimization (Jaroslav Rohel)
- Integrate --destdir with --destdir from download plugin (Ondřej Sojka)
- Add CLI option --destdir (RhBug:1279001) (Ondřej Sojka)
- Add myself to the AUTHORS file (Nathaniel McCallum)
- Add the --forcearch CLI flag (Nathaniel McCallum)
- Add 'ignorearch' option (Nathaniel McCallum)
- Provide an API for setting 'arch' and 'basearch' (Nathaniel McCallum)
- Add nevra forms for repoquery command (Jaroslav Rohel)
- Fix UnicodeDecodeError during checkSig() on non UTF-8 locale (RhBug:1397848)
  (Jaroslav Rohel)
- Add dnf option --noautoremove (RhBug:1361424) (Jaroslav Mracek)
- Add group argument for mark command (Jaroslav Mracek)
- Report problems for each pkg during gpgcheck (RhBug:1387925) (Jaroslav
  Mracek)
- fix minor spelling mistakes (René Genz)
- Print warning when wrong delimiter in cache (RhBug:1332099) (Vítek Hoch)
- Fix the loading of config for �x�������������(U�����X�$�
�������0�������W�$j�����������������W�W�W��l <rvokal@redhat.com> - 1.60-69Radek Vokál <rvokal@redhat.com> - 1.60-68Radek Vokál <rvokal@redhat.com> - 1.60-67Radek Vokál <rvokal@redhat.com> - 1.60-66Radek Vokál <rvokal@redhat.com> - 1.60-65Radek Vokál <rvokal@redhat.com> - 1.60-64Radek Vokál <rvokal@redhat.com> - 1.60-63Jesse Keating <jkeating@redhat.com> - 1.60-62.1Radek Vokál <rvokal@redhat.com> - 1.60-62Jesse Keating <jkeating@redhat.com> - 1.60-61.1Radek Vokál <rvokal@redhat.com> 1.60-61Radek Vokal <rvokal@redhat.com> 1.60-60Radek Vokal <rvokal@redhat.com> 1.60-59Radek Vokal <rvokal@redhat.com> 1.60-58Jesse Keating <jkeating@redhat.com>Radek Vokal <rvokal@redhat.com> 1.60-57Radek Vokal <rvokal@redhat.com> 1.60-56Radek Vokal <rvokal@redhat.com> 1.60-55Radek Vokal <rvokal@redhat.com> 1.60-54Radek Vokal <rvokal@redhat.com> 1.60-53Radek Vokal <rvokal@redhat.com> 1.60-52Radek Vokal <rvokal@redhat.com> 1.60-51Radek Vokal <rvokal@redhat.com> 1.60-50Elliot Lee <sopwith@redhat.com>Radek Vokal <rvokal@redhat.com> 1.60-48Radek Vokal <rvokal@redhat.com> 1.60-47Radek Vokal <rvokal@redhat.com> 1.60-46Radek Vokal <rvokal@redhat.com> 1.60-45Radek Vokal <rvokal@redhat.com> 1.60-44Radek Vokal <rvokal@redhat.com> 1.60-43Radek Vokal <rvokal@redhat.com> 1.60-42Radek Vokal <rvokal@redhat.com> 1.60-41Radek Vokal <rvokal@redhat.com> 1.60-40Radek Vokal <rvokal@redhat.com> 1.60-39Radek Vokal <rvokal@redhat.com> 1.60-38Radek Vokal <rvokal@redhat.com> 1.60-37Radek Vokal <rvokal@redhat.com> 1.60-36Radek Vokal <rvokal@redhat.com> 1.60-35Radek Vokal <rvokal@redhat.com> 1.60-34Radek Vokal <rvokal@redhat.com> 1.60-33Phil Knirsch <pknirsch@redhat.com> 1.60-32Alan Cox <alan@redhat.com> 1.60-31Phil Knirsch <pknirsch@redhat.com> 1.60-30Phil Knirsch <pknirsch@redhat.com> 1.60-29Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-27Phil Knirsch <pknirsch@redhat.com> 1.60-26Phil Knirsch <pknirsch@redhat.com> 1.60-25Harald Hoyer <harald@redhat.com> - 1.60-24Karsten Hopp <karsten@redhat.de> 1.60-23 Phil Knirsch <pknirsch@redhat.com>Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-20.1Phil Knirsch <pknirsch@redhat.com> 1.60-20Phil Knirsch <pknirsch@redhat.com> 1.60-19.1Phil Knirsch <pknirsch@redhat.com> 1.60-19Phil Knirsch <pknirsch@redhat.com> 1.60-18.1Phil Knirsch <pknirsch@redhat.com> 1.60-18Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-16.1Phil Knirsch <pknirsch@redhat.com> 1.60-16Jeremy Katz <katzj@redhat.com> 1.60-15Phil Knirsch <pknirsch@redhat.com> 1.60-14Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-13Phil Knirsch <pknirsch@redhat.com> 1.60-12Phil Knirsch <pknirsch@redhat.com> 1.60-11Tim Powers <timp@redhat.com> 1.60-10Phil Knirsch <pknirsch@redhat.com> 1.60-9Elliot Lee <sopwith@redhat.com> 1.60-8Phil Knirsch <pknirsch@redhat.com> Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Jeremy Katz <katzj@redhat.com>Bill Nottingham <notting@redhat.com>Preston Brown <pbrown@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector <bugzilla@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>John Hardin <jhardin@wolfenet.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Aron Griffis <agriffis@coat.com>Prospector System <bugs@redhat.com>Jason Spangler <jaso�x��������������D�����X�%�
�����xc����~!�$n����������������~!}!!� names of changed patches- 5.20.2 bump (see <http://search.cpan.org/dist/perl-5.20.2/pod/perldelta.pod>
  for release notes)
- Regenerate a2p.c (BZ#1177672)- Improve h2ph fix for GCC 5.0- Fix regressions with GCC 5.0- Sub-package inc-latest module- Delete dual-living programs clashing on debuginfo files (bug #878863)- Report inaccesible file on failed require (bug #1166504)
- Use stronger algorithm needed for FIPS in t/op/taint.t (bug #1128032)- Consider Filter::Util::Call dependency as mandatory (bug #1165183)
- Sub-package encoding module
- Own upper directories by each package that installs a file there and
  remove empty directories (bug #1165013)- Freeze epoch at perl-Pod-Checker and perl-Pod-Usage (bug #1163490)
- Remove bundled perl-ExtUtils-Command (bug #1158536)
- Remove bundled perl-Filter-Simple (bug #1158542)- Do not double-own perl-Pod-Usage' and perl-Pod-Checker' files by
  perl-Pod-Parser on bootstrap
- Sub-package ExtUtils-Command (bug #1158536)
- Sub-package Filter-Simple (bug #1158542)
- Build-require groff-base instead of big groff- Remove bundled perl-Devel-PPPort (bug #1143999)
- Remove bundled perl-B-Debug (bug #1142952)
- Remove bundled perl-ExtUtils-CBuilder (bug #1144033)
- Remove bundled perl-ExtUtils-Install (bug #1144068)- Move all Module-CoreList files into perl-Module-CoreList
- Sub-package corelist(1) into perl-Module-CoreList-tools (bug #1142757)
- Remove bundled perl-Module-CoreList, and perl-Module-CoreList-tools
  (bug #1142757)
- Sub-package Devel-PPPort (bug #1143999)
- Sub-package B-Debug (bug #1142952)
- Use native version for perl-ExtUtils-CBuilder
- Specify all dependencies for perl-ExtUtils-Install (bug #1144068)
- Require perl-ExtUtils-ParseXS by perl-ExtUtils-MakeMaker because of xsubpp- Provide 5.20.0 MODULE_COMPAT- 5.20.1 bump (see <http://search.cpan.org/dist/perl-5.20.1/pod/perldelta.pod>
  for release notes)
- Sub-package perl-ExtUtils-Miniperl (bug #1141222)- Specify all dependencies for perl-CPAN (bug #1090112)
- Disable non-core modules at perl-CPAN when bootstrapping
- Remove bundled perl-CPAN (bug #1090112)- Stop providing old perl(MODULE_COMPAT_5.18.*)- Update to Perl 5.20.0
- Clean patches, not needed with new version
- Update patches to work with new version
- Update version of sub-packages, remove the deleted sub-packages
- Sub-package perl-IO-Socket-IP, perl-experimental
- Disable BR perl(local::lib) for cpan tool when bootstraping- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Declare dependencies for cpan tool (bug #1122498)
- Use stronger algorithm needed for FIPS in t/op/crypt.t (bug #1128032)
- Make *DBM_File desctructors thread-safe (bug #1107543)- Sub-package perl-Term-ANSIColor and remove it (bug #1121924)- Remove bundled perl-App-a2p, perl-App-find2perl, perl-App-s2p, and
  perl-Package-Constants
- Correct perl-App-s2p license to ((GPL+ or Artistic) and App-s2p)- Sub-package perl-App-find2perl (bug #1111196)
- Sub-package perl-App-a2p (bug #1111232)
- Sub-package perl-App-s2p (bug #1111242)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Pass -fwrapv to stricter GCC 4.9 (bug #1082957)- Fix t/comp/parser.t not to load system modules (bug #1084399)- Move macro files into %{_rpmconfigdir}/macros.d- Provide perl(CPAN::Meta::Requirements) with six decimal places- Drop perl-Test-Simple-tests package is it is not delivered by dual-lived
  version
- Hide dual-lived perl-Object-Accessor- Use a macro to cover all 64-bit PowerPC architectures (bug #1052709)- Use upstream patch to fix a test failure in perl5db.t when TERM=vt100- 5.18.2 bump (see <http://search.cpan.org/dist/perl-5.18.2/pod/perldelta.pod>
  for release notes)- Document Math::BigInt::CalcEmu requires Math::BigInt (bug #959096)- perl_default_filter macro does not need to filter private libraries from
  provides (bug #1020809)
- perl_default_filter anchors the filter regular expressions
- perl_default_filter appends the filters instead of redefining them- Fix rules for parsing numeric escapes in regexe�x�������������4�����X�$�
���������Y������YX�$I����������������YXXXZX�st run the sepolgen-ifgen tool to generate
          the data needed by audit2allow to generate refpolicy.
        * Fixed newrole non-pam build.
- Fix Changelog and spelling error in man page- Fix audit2allow on missing translations- More chcat fixes- Change chcat to exec semodule so file context is maintained- Fix system-config-selinux ports view
- Update to upstream
        * Fixed newrole non-pam build.
        * Updated version for stable branch.- Update to upstream
        * Merged unicode-to-string fix for seobject audit from Dan Walsh.
        * Merged man page updates to make "apropos selinux" work from Dan Walsh.* Merged newrole man page patch from Michael Thompson.
        * Merged patch to fix python unicode problem from Dan Walsh.- Fix handling of audit messages for useradd change
Resolves: #222159- Update man pages by adding SELinux to header to fix apropos database
Resolves: #217881- Want to update to match api
- Update to upstream
        * Merged newrole securetty check from Dan Walsh.
        * Merged semodule patch to generalize list support from Karl MacMillan.
Resolves: #200110- Update to upstream
        * Merged fixfiles and seobject fixes from Dan Walsh.
        * Merged semodule support for list of modules after -i from Karl MacMillan.- Update to upstream
        * Merged patch to correctly handle a failure during semanage handle
          creation from Karl MacMillan.
        * Merged patch to fix seobject role modification from Dan Walsh.- Stop newrole -l from working on non secure ttys
Resolves: #200110- Update to upstream
        * Merged patches from Dan Walsh to:
          - omit the optional name from audit2allow
          - use the installed python version in the Makefiles
          - re-open the tty with O_RDWR in newrole- Update to upstream
        * Patch from Dan Walsh to correctly suppress warnings in load_policy.- Fix fixfiles script to use tty command correctly.  If this command fails, it
should set the LOGFILE to /dev/null
Resolves: #220879- Remove hard coding of python2.4 from Makefiles- add exists switch to semanage to tell it not to check for existance of Linux user
Resolves: #219421- Fix audit2allow generating reference policy
- Fix semanage to manage user roles properly
Resolves: #220071- Update po files
- Fix newrole to open stdout and stderr rdrw so more will work on MLS machines
Resolves: #216920- rebuild for python 2.5- Update po files
Resolves: #216920- Update po files
Resolves: #216920- Update to upstream
        * Patch from Dan Walsh to add an pam_acct_msg call to run_init
        * Patch from Dan Walsh to fix error code returns in newrole
        * Patch from Dan Walsh to remove verbose flag from semanage man page
        * Patch from Dan Walsh to make audit2allow use refpolicy Makefile
          in /usr/share/selinux/<SELINUXTYPE>- Fixing the Makefile line again to build with LSPP support
Resolves: #208838- Don't report errors on restorecond when file system does not support XATTRS
Resolves: #217694- Fix -q qualifier on load_policy
Resolves: #214827- Merge to upstream
- Fix makefile line
Resolves: #208838- Additional po changes
- Added all booleans definitions- Upstream accepted my patches
        * Merged setsebool patch from Karl MacMillan.
          This fixes a bug reported by Yuichi Nakamura with
          always setting booleans persistently on an unmanaged system.- Fixes for the gui- Upstream accepted my patches- Add Amy Grifis Patch to preserve newrole exit status- Fix display of gui- Add patch by Jose Plans to make run_init use pam_acct_mgmt- More fixes to gui- Fix audit2allow to generate referene policy- Add group sort for portsPage.py
- Add enable/disableaudit to modules page- Add glade file- Fix Module handling in system-config-selinux- Update to upstream
        * Merged newrole patch set from Michael Thompson.
- Add policycoreutils-gui- No longer requires rhpl- Fix genhomedircon man page- Add newrole audit patch from sgrubb
- Update to upstream
        * Merged audit2allow -l fix from�x��������������#�����X�%�
��������������!�$�����������������!�!�!�ExtUtils::ParseXS to 2.2206 (current) to fix Wx build- Make %global perl_default_filter lazy
- Do not hard-code tapsetdir path- added systemtap tapset to make use of systemtap-sdt-devel
- added an example systemtap script- stable update 5.12.3
- add COMPAT- 463773 revert change. txt files are needed for example by UCD::Unicode,
 PDF::API2,...- required systemtap-sdt-devel on request in 661553- create sub-package for CGI 3.49- Sub-package perl-Class-ISA (bug #651317)- Make perl(ExtUtils::ParseXS) version 4 digits long (bug #650882)- 643447 fix redefinition of constant C in h2ph (visible in git send mail,
  XML::Twig test suite)
- remove ifdef for s390- Package Test-Simple tests to dual-live with standalone package (bug #640752)- remove removal of NDBM- Consolidate Requires filtering
- Consolidate libperl.so* Provides- filter useless requires, provide libperl.so- Reformat perl-threads description
- Fix threads directories ownership- sub-package threads- add vendor path, clean paths in Configure in spec file
- create sub-package threads-shared- Do not leak when destroying thread (RT #77352, RHBZ #630667)- Fixing release number for modules- Update to 5.12.2
- Removed one hardcoded occurence of perl version in build process
- Added correct path to dtrace binary
- BuildRequires: systemtap-sdt-devel- run Configure with -Dusedtrace for systemtap support- Run tests in parallel
- Add "-Wl,--enable-new-dtags" to linker to allow to override perl's rpath by
  LD_LIBRARY_PATH used in tests. Otherwise tested perl would link to old
  in-system libperl.so.
- Normalize spec file indentation- 617956 move perlxs* docs files into perl-devel- 614662 wrong perl-suidperl version in obsolete- add temporary compat provides needed on s390(x)- Add Digest::SHA requirement to perl-CPAN and perl-CPANPLUS (bug #612563)- 607505 add another dir into Module::Build (thanks to Paul Howarth)- Address perl-Compress-Raw directory ownership (BZ 607881).- remove patch with debugging symbols, which should be now ok without it
- update to 5.12.1
- MODULE_COMPAT- packages in buildroot needs MODULE_COMPAT 5.10.1, add it back for rebuild- rebuild with tests in test buildroot- MODULE_COMPAT 5.12.0
- remove BR man
- clean configure
- fix provides/requires in IO-Compress- rebuild 5.12.0 without MODULE_COMPAT- initial 5.12.0 build- 463773 remove useless txt files from installation
- 575842 remove PERL_USE_SAFE_PUTENV, use perl putenv- package tests in their own subpackage- add noarch into correct sub-packages
- move Provides/Obsoletes into correct modules from main perl- restore missing version macros for Compress::Raw::Zlib, IO::Compress::Base
  and IO::Compress::Zlib- clean spec a little more
- rebuild with new gdbm- fix license according to advice from legal
- clean unused patches- update subpackage tests macros to handle packages with an epoch properly- add initial EXPERIMENTAL tests subpackage rpm macros to macros.perl- 547656 CVE-2009-3626 perl: regexp matcher crash on invalid UTF-8 characters  
- 549306 version::Internals should be packaged in perl-version subpackage
- Parse-CPAN-Meta updated and separate package is dead- subpackage parent and Parse-CPAN-Meta; add them to core's dep list- exclude "parent".- exclude Parse-CPAN-Meta.- do not pack Bzip2 manpages either (#544582)- do not pack Bzip2 modules (#544582)
- hack: cheat about Compress::Raw::Zlib version (#544582)- switch off check for ppc64 and s390x
- remove the hack for "make test," it is no longer needed- be more careful with the libperl.so compatibility symlink (#543936)- new upstream version
- release number must be high, because of stale version numbers of some
  of the subpackages
- drop upstreamed patches
- update the versions of bundled modules
- shorten the paths in @INC
- build without DEBUGGING
- implement compatibility measures for the above two changes, for a short
  transition period
- provide perl(:MODULE_COMPAT_5.10.0), for that transition period only- fix patch-update-Compress-Raw-Zlib.patch (did not patch Zlib.pm)�x�������������������X �$�
����������g�$w����������������gfh�ded syslog logging to background mounts as suggested
  by a customer.- fix #183713 - foreground mounts are not retrying as advertised
- fix #151549 - Added 'noacl' mount flag
- fix #169042 - Changed nfsmount to try udp before using tcp when rpc-ing
		the remote rpc.mountd (iff -o tcp is not specified).
		This drastically increases the total number of tcp mounts
		that can happen at once (ala autofs).- Better calling of restorecon as suggested by Bill Nottingham
- prereq restorecon to avoid ordering issues- restorecon /var/log/lastlog- fix #181782 - mkswap selinux relabeling (fix util-linux-2.13-mkswap-selinux.patch)- fix #181782 - mkswap should automatically add selinux label to swapfile
- fix #180730 - col is exiting with 1 (fix util-linux-2.12p-col-EILSEQ.patch)
- fix #181896 - broken example in schedutils man pages
- fix #177331 - login omits pam_acct_mgmt & pam_chauthtok when authentication is skipped.
- fix #177523 - umount -a should not unmount sysfs
- fix #182553 - fdisk -l inside xen guest shows no disks- bump again for double-long bug on ppc(64)- add "blockdev --rmpart N <device>" and "blockdev --rmparts <device>"- rebuilt for new gcc4.1 snapshot and glibc changes- Updated the gssd_check() and idmapd_check(), used with
  nfsv4 mounts, to looked for the correct file in /var/lock/subsys
  which stops bogus warnings.- fix #174676 - hwclock audit return code mismatch
- fix #176441: col truncates data
- fix #174111 - mount allows loopback devices to be mounted more than once to the same mount point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
		is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include�x�����������`�����X0"$�
���������������$c��������������������14eb86d95201d6ca6935e3dc439ce377e3a4e6d42ee543c636764aa3805c998e82a3bea8665009a36935e3dc439ce377e3a4e6d42ee543c636764aa3805c998e82a3bea8665009a3dd44f38e6114ce0db3f438f75f27c600040cac4e6cec2723c6fe3eef44da96c3dd44f38e6114ce0db3f438f75f27c600040cac4e6cec2723c6fe3eef44da96c39642ce60c8b3638fb484d45f3bc8a7502ebb17ef080448b5e2b4dbae5e5136579642ce60c8b3638fb484d45f3bc8a7502ebb17ef080448b5e2b4dbae5e51365745196459ca215a02b16febfcaaa4c5d3a9ce7ce6d4b7fc4f208369615c1dd07645196459ca215a02b16febfcaaa4c5d3a9ce7ce6d4b7fc4f208369615c1dd0761d31773bb6c82dc085d99b548171f98e183be58a426fe2681e9adfde7db4b97a1d31773bb6c82dc085d99b548171f98e183be58a426fe2681e9adfde7db4b97a9def2584687afd61f2dc9f24345b7f35ac12c29b6583c01a78d05368059f462c9def2584687afd61f2dc9f24345b7f35ac12c29b6583c01a78d05368059f462c3ea4a4fb2e14ada35acc6365e71826c87c649f95e185d1a56eea73e7808450e63ea4a4fb2e14ada35acc6365e71826c87c649f95e185d1a56eea73e7808450e6c39188958a641bc9e804e97f11a0a643c48ae2d0338f8557d5710a180c691ceac39188958a641bc9e804e97f11a0a643c48ae2d0338f8557d5710a180c691ceabf6396de889ed4796afe21d7c5553f5d2140f08e5cbfc551908f48f5dd979f73bf6396de889ed4796afe21d7c5553f5d2140f08e5cbfc551908f48f5dd979f7386e67351dfda175406a11539b80436a65bc88e898f1ddc7ea70dc5140e7aedab86e67351dfda175406a11539b80436a65bc88e898f1ddc7ea70dc5140e7aedab81cfcc9b6807a724b902744e3087a50d8bacf8458aa99ed371abc99c22751a5681cfcc9b6807a724b902744e3087a50d8bacf8458aa99ed371abc99c22751a56df2df39774b1fbc68388657db5a36868889ef8ebe4281ea0edbf4a42992dd69fdf2df39774b1fbc68388657db5a36868889ef8ebe4281ea0edbf4a42992dd69f4394adfe44a00047787469591b1a9c0c2fe93c78a8f6fc5ebcaecd0ce69f760f4394adfe44a00047787469591b1a9c0c2fe93c78a8f6fc5ebcaecd0ce69f760f650a97b7d4ddc79884a434773de8a9a10096be8ca36c6ac838ca636f7ad94a5a650a97b7d4ddc79884a434773de8a9a10096be8ca36c6ac838ca636f7ad94a5a056d3b30470701b3b421e1083ecda9a8de85e90cea51729dc176bf3669932266056d3b30470701b3b421e1083ecda9a8de85e90cea51729dc176bf3669932266b0d4980f3187254cdfd6d10b72331f5fde3b0c31c133c6f0edff6fcd9ce45bf3b0d4980f3187254cdfd6d10b72331f5fde3b0c31c133c6f0edff6fcd9ce45bf3bb4356d948639bc7661073554a473a7d14594d0906cb41d570f4371f65134e55bb4356d948639bc7661073554a473a7d14594d0906cb41d570f4371f65134e552c62a9ce222ad6a9448a04f8dcc15f435f1750f64ff9f82859bc298126bf91a72c62a9ce222ad6a9448a04f8dcc15f435f1750f64ff9f82859bc298126bf91a71822bd92370719b8fbc06431c1eea43a70acc1c579e32a42d52ac728ce6f466f1822bd92370719b8fbc06431c1eea43a70acc1c579e32a42d52ac728ce6f466f8d7cfca08cc7d514b05da74290fbcb8c7d12bcae09023d4de31ee4a6ba5b68808d7cfca08cc7d514b05da74290fbcb8c7d12bcae09023d4de31ee4a6ba5b688015d7f8dea78eb4e1620b8c7cc30bdc8ba774f35c33657f2ea1a3edd43f32701b3ec77bd2a6280996e50fc457398baf03ce275935b8473a7350501dd3f4ff80337f4b3e3b3ce6484b638d8d382a53a6582f67c14786ebe2e1a720f9810f771305af14071bb5a858592d5a4e6141cca5747894cef11fa1769ffd6b31f93e1b810d0c0e164648503d58388c25f917dafd0dc65ce754fcc2166785f02f8e4a3c48bd5752bb1f7f3094fa9f4ee879646cc66818d948044b66881e3d6677b6da43f02f7fc9922bab6fb1bc2bfdbb2cb5eddc7bde86c4bb0289f9fbeec50d93f59076e253d6bb381514704a9c072804b175fd78b9b082bc3d436678dba6955a6e3496f40e8810fbaa2d8e8e14c52653d1bedc55124a24ce61916f85b60bb7e641d646d3fb4854edb226e45ad4c81cd8f4b606a0c504b91575f5d6d4e6408ccbcc16de87ea017baba502c916dc90ffdaf7250d27b46910e1901b6b89d19b472bb014da47d3f412a5ff5695263ce7466e27963caa181cd4ddebf522473461767b12237e0ca8ed0447b3115caa62065d542c5b6db6d3108e89ac1f25b3b71575355a76ed8382d1a1cccaf786b866ebb313df0353c077c0e2382ee7aabcb91030e51e68c4ac50603f34de8f78a209112b62dfa69131726c605a55a0ca8ea912a94daaadab2dc71a14ab100bfc1dd68298dcee8d5336ae8fd2dd8736445ac98c1484f2b2b31e79af32754a82032372c9fd3e228ef15fc16d76b85dea80309b62660b9a951cf746392d72d7c2f325423e7744d1eaa389aba1957a1b841d37dc829540186b44fa8c424f232a97954fe8d1a806ea4d92c72ccc8cc66322eba36121f705bb9447dfebc77d79f556b6aaa458be7bef8a3952678906c92c5b8c7e73824c0eb5f17035e954e69b40465392339fdf94eb68c04752c94f1eaad862108aa0337b6c6741d51676acdeadbdc955f01d68f7aeadf1ae6e331e4a866cddb55f60a4eb8f35b09f7b9cb3a243a7242bb7488fc�x��������������������X"%�
�������� ������d�$(�����������������d�d�d�EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzX509_dup.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzPEM_read_CMS.3ssl.gzDEFINE_STACK_OF.3ssl.gzDEFINE_STACK_OF.3ssl.gzDEFINE_STACK_OF.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDES_random_key.3ssl.gzDH_set_method.3ssl.gzDH_size.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters.3ssl.gzDH_get0_pqg.3ssl.gzDH_generate_key.3ssl.gzDH_generate_key.3ssl.gzDH_new.3ssl.gzDH_generate_parameters.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_set_method.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzDH_get0_pqg.3ssl.gzDH_new_by_nid.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_meth_new.3ssl.gzDH_set_method.3ssl.gzDH_size.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_set_method.3ssl.gzBIO_get_ex_new_index.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_pqg.3ssl.gzRSA_print.3ssl.gzRSA_print.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzDSA_set_method.3ssl.gzDSA_SIG_new.3ssl.gzDSA_SIG_new.3ssl.gzDSA_SIG_new.3ssl.gzDSA_size.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_do_sign.3ssl.gzDSA_new.3ssl.gzDSA_generate_parameters.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_set_method.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_new.3ssl.gzDSA_set_method.3ssl.gzRSA_print.3ssl.gzRSA_print.3ssl.gzDSA_size.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_set_method.3ssl.gzBIO_get_ex_new_index.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_sign.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_sign.3ssl.gzX509_dup.3ssl.gzRSA_print.3ssl.gzRSA_print.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzDTLS_set_timer_cb.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_new.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_ex_new_index.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_new��������x�������������X��������������������P�����d������������������������������e��������K8�!#