Current File : /home/inlingua/www/decay_sym/root/proc/thread-self/root/var/lib/rpm/__db.003
�Ѓ���������������������������������������������������������������������������������v�7��	����	����������������������������� �0hP�&�(
�5�C�jeje�L���	--9gL<z=�	O[�$�t
E*&�(
X!p!8!8!8���������������p�������8����������������8���������������������������������� !��������	��������
������������������������
��������������������������������������������������������������������������������P��������� �8������������������?�� `8` �8�(O@O��������0H���������������� ��������!��������"��������#��������$��������%ȥ&�)0�'��HG({0�	)���*��+H�@�,��
��-�X.�j	�R/�S�S0 �
1��������2��������3��������4��������5r@�68AH�7X�	�@8x��d9��:hPH
;p���<q��=nn>8,?�(�@�O�OAH`B����Cp_��
D�~
`+E��������F��������G8�P�HH

`

I��������J � KK��L�D`�Mh���Nx��zOP2h2PHs��Q8�
8�R�RS��Z
T�7�SUx���VxG�GW��������X��������Y��������Z��������[h�
��
\��������]�=>^��������_�Y�Y`��������a��b�U�Uc��@�
dX1p1eX�	6f� �g�^0Wh �
8�
ix�
�jX�
k����
l���m����nH�8o�@p�x�q����r`�	�)s�z�	
t���
u����v�u�	w(%0~x���
y�lpaz�j	h�{���|@h0�}x�`~P��H	 ����� ���>غ�x�(�j��h_ ��h�`w��X��0$@����H��x�����p��`U���pXHL��w
���@e8g
��_#���`��X$
H�	����l��5x���8��Xp����`{x{�(�������������x�������x������������������������������HX����������������������H��5���`&��������H�����������F�P�	�P�	hd &�&H�����������������������H���`@у@����������������@������@	Packages@����������������������@�������������������������X�p�(
(���vd�$f����������������vdwdud�cure_malloc_init.3ssl.gzCRYPTO_secure_malloc_initialized.3ssl.gzCRYPTO_secure_used.3ssl.gzCRYPTO_secure_zalloc.3ssl.gzCRYPTO_set_ex_data.3ssl.gzCRYPTO_set_mem_debug.3ssl.gzCRYPTO_set_mem_functions.3ssl.gzCRYPTO_strdup.3ssl.gzCRYPTO_strndup.3ssl.gzCRYPTO_zalloc.3ssl.gzCTLOG_STORE_free.3ssl.gzCTLOG_STORE_get0_log_by_id.3ssl.gzCTLOG_STORE_load_default_file.3ssl.gzCTLOG_STORE_load_file.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_free.3ssl.gzCTLOG_get0_log_id.3ssl.gzCTLOG_get0_name.3ssl.gzCTLOG_get0_public_key.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new_from_base64.3ssl.gzCT_POLICY_EVAL_CTX_free.3ssl.gzCT_POLICY_EVAL_CTX_get0_cert.3ssl.gzCT_POLICY_EVAL_CTX_get0_issuer.3ssl.gzCT_POLICY_EVAL_CTX_get0_log_store.3ssl.gzCT_POLICY_EVAL_CTX_get_time.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_set1_cert.3ssl.gzCT_POLICY_EVAL_CTX_set1_issuer.3ssl.gzCT_POLICY_EVAL_CTX_set_shared_CTLOG_STORE.3ssl.gzCT_POLICY_EVAL_CTX_set_time.3ssl.gzDECLARE_ASN1_FUNCTIONS.3ssl.gzDECLARE_LHASH_OF.3ssl.gzDECLARE_PEM_rw.3ssl.gzDEFINE_SPECIAL_STACK_OF.3ssl.gzDEFINE_SPECIAL_STACK_OF_CONST.3ssl.gzDEFINE_STACK_OF.3ssl.gzDEFINE_STACK_OF_CONST.3ssl.gzDES_cbc_cksum.3ssl.gzDES_cfb64_encrypt.3ssl.gzDES_cfb_encrypt.3ssl.gzDES_crypt.3ssl.gzDES_ecb2_encrypt.3ssl.gzDES_ecb3_encrypt.3ssl.gzDES_ecb_encrypt.3ssl.gzDES_ede2_cbc_encrypt.3ssl.gzDES_ede2_cfb64_encrypt.3ssl.gzDES_ede2_ofb64_encrypt.3ssl.gzDES_ede3_cbc_encrypt.3ssl.gzDES_ede3_cfb64_encrypt.3ssl.gzDES_ede3_ofb64_encrypt.3ssl.gzDES_fcrypt.3ssl.gzDES_is_weak_key.3ssl.gzDES_key_sched.3ssl.gzDES_ncbc_encrypt.3ssl.gzDES_ofb64_encrypt.3ssl.gzDES_ofb_encrypt.3ssl.gzDES_pcbc_encrypt.3ssl.gzDES_quad_cksum.3ssl.gzDES_random_key.3ssl.gzDES_set_key.3ssl.gzDES_set_key_checked.3ssl.gzDES_set_key_unchecked.3ssl.gzDES_set_odd_parity.3ssl.gzDES_string_to_2keys.3ssl.gzDES_string_to_key.3ssl.gzDES_xcbc_encrypt.3ssl.gzDH_OpenSSL.3ssl.gzDH_bits.3ssl.gzDH_check.3ssl.gzDH_check_ex.3ssl.gzDH_check_params.3ssl.gzDH_check_params_ex.3ssl.gzDH_check_pub_key_ex.3ssl.gzDH_clear_flags.3ssl.gzDH_compute_key.3ssl.gzDH_compute_key_padded.3ssl.gzDH_free.3ssl.gzDH_generate_key.3ssl.gzDH_generate_parameters.3ssl.gzDH_generate_parameters_ex.3ssl.gzDH_get0_engine.3ssl.gzDH_get0_g.3ssl.gzDH_get0_key.3ssl.gzDH_get0_p.3ssl.gzDH_get0_pqg.3ssl.gzDH_get0_priv_key.3ssl.gzDH_get0_pub_key.3ssl.gzDH_get0_q.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_2048_224.3ssl.gzDH_get_2048_256.3ssl.gzDH_get_default_method.3ssl.gzDH_get_ex_data.3ssl.gzDH_get_ex_new_index.3ssl.gzDH_get_length.3ssl.gzDH_get_nid.3ssl.gzDH_meth_dup.3ssl.gzDH_meth_free.3ssl.gzDH_meth_get0_app_data.3ssl.gzDH_meth_get0_name.3ssl.gzDH_meth_get_bn_mod_exp.3ssl.gzDH_meth_get_compute_key.3ssl.gzDH_meth_get_finish.3ssl.gzDH_meth_get_flags.3ssl.gzDH_meth_get_generate_key.3ssl.gzDH_meth_get_generate_params.3ssl.gzDH_meth_get_init.3ssl.gzDH_meth_new.3ssl.gzDH_meth_set0_app_data.3ssl.gzDH_meth_set1_name.3ssl.gzDH_meth_set_bn_mod_exp.3ssl.gzDH_meth_set_compute_key.3ssl.gzDH_meth_set_finish.3ssl.gzDH_meth_set_flags.3ssl.gzDH_meth_set_generate_key.3ssl.gzDH_meth_set_generate_params.3ssl.gzDH_meth_set_init.3ssl.gzDH_new.3ssl.gzDH_new_by_nid.3ssl.gzDH_new_method.3ssl.gzDH_security_bits.3ssl.gzDH_set0_key.3ssl.gzDH_set0_pqg.3ssl.gzDH_set_default_method.3ssl.gzDH_set_ex_data.3ssl.gzDH_set_flags.3ssl.gzDH_set_length.3ssl.gzDH_set_method.3ssl.gzDH_size.3ssl.gzDH_test_flags.3ssl.gzDHparams_print.3ssl.gzDHparams_print_fp.3ssl.gzDIRECTORYSTRING_free.3ssl.gzDIRECTORYSTRING_new.3ssl.gzDISPLAYTEXT_free.3ssl.gzDISPLAYTEXT_new.3ssl.gzDIST_POINT_NAME_free.3ssl.gzDIST_POINT_NAME_new.3ssl.gzDIST_POINT_free.3ssl.gzDIST_POINT_new.3ssl.gzDSA_OpenSSL.3ssl.gzDSA_SIG_free.3ssl.gzDSA_SIG_get0.3ssl.gzDSA_SIG_new.3ssl.gzDSA_SIG_set0.3ssl.gzDSA_bits.3ssl.gzDSA_clear_flags.3ssl.gzDSA_do_sign.3ssl.gzDSA_do_verify.3ssl.gzDSA_dup_DH.3ssl.gzDSA_free.3ssl.gzDSA_generate_key.3ssl.gzDSA_generate_parameters.3ssl.gzDSA_generate_parameters_ex.3ssl.gzDSA_get0_engine.3ssl.gzDSA_get0x��������L			�8��������������� �8 	�������������������������� x����������������x�xNameictname����������������p������@�����������������0�������X���(
���5��$x��������������������s ssh
- dracut-module-setup: filter out localhost for generic_fence_kdump
- dracut-module-setup: get localhost alias by manual- dracut-module-setup.sh: Don't use squash module for fadump
- Don't mount the dump target unless needed
- dracut-module-setup: fix bond ifcfg processing
- Doc: amend the man page of kdump.conf- Limit the size of vmcore-dmesg.txt to 2G
- makedumpfile: x86_64: Fix incorrect exclusion by -e option with KASLR
- mkdumprd: ensure ssh path exists before check size- rebase to kexec-tools-2.0.20 and makedumpfile-1.6.6- Don't forward and drop journalctl logs for fadump- Drop switch root capability for non fadump initramfs- Forward logs in kdump kernel to console directly- kexec/arm64: Add support for handling zlib compressed (Image.gz) image
- kexec/kexec-zlib.h: Add 'is_zlib_file()' helper function
- kexec-uImage-arm64.c: Fix return value of uImage_arm64_probe()
- kexec/kexec.c: Add the missing close() for fd used for kexec_file_load()- kdump.sysconfig/x86_64: Disable HEST by default- dracut-kdump-capture.service: Use OnFailureJobMode instead of deprecated OnFailureIsolate- kexec-kdump-howto.txt: Add notes about device dump
- Disable device dump by default- kdumpctl: check for ssh path availability when rebuild
- kdumpctl: Check kdump.conf for error when rebuild is called
- makedumpfile: x86_64: Add support for AMD Secure Memory Encryption
- aarch64/kdump.sysconfig: Make config options similar to x86_64- kexec-kdump-howto.txt: Add document about encrypted targets
- kexec-kdump-howto.txt: Add document about initramfs rebiuld
- kexec-kdump-howto: Add note on setting correct value of kptr_restrict
- doc: fix dead links in the file kexec-kdump-howto.txt
- earlykdump: provide a prompt message after the rebuilding of kdump initramfs.
- Get rid of duplicated strip_comments when reading config
- mkdumprd: Improve the config reading logic
- kdumpctl: don't always rebuild when extra_modules is set
- kdumpctl: follow symlink when checking for modified files
- fadump: leverage kernel support to re-regisgter FADump- earlykdump: Add a note of final_action option to avoid crash loop
- Add final_action option to kdump.conf
- Add failure_action as alias of default and make default obsolete
- earlykdump: warn when installed kernel version differs from dracut target
- earlykdump: add more sanity check when generating initramfs
- fadump: use the original initrd to rebuild fadump initrdfrom- kdumpctl: Detect block device driver change for initramfs rebuild
- Revert "kdumpctl: Rebuild initramfs if loaded kernel modules changed"
- mkdumprd: allow spaces after 'path' config phrase with network dump setting
- kexec.rules: create dedicated udev rules for ppc64
- Revert "rhel-only/kexec.rules: create dedicated udev rules for ppc64"
- rh-only makedumpfile/arm64: Add support for ARMv8.2-LVA (52-bit user-space VA support)- kexec-tools: rebasing to 2.0.19
- makedumpfile: upgrade to 1.6.5
- kexec-tools: x86: Introduce a new option --reuse-video-type
- makedumpfile: exclude pages that are logically offline
- earlykdump: Fix failure when earlykdump is included by dracut
- Update man page for new kdumpctl command: reload / rebuild
- kdumpctl: add rebuild support
- rhel-only/kexec.rules: create dedicated udev rules for ppc64- Enable building with hardening flags- add gating- makedumpfile/arm64: Add support for ARMv8.2-LVA (52-bit user-space VA support)- Revert "kdumpctl, earlykdump: Don't use kexec_file_load when secure boot is enabled"
- mkdumprd: refine regex on dropping mount options- earlykdump: fix kexec fails to load the early kdump kernel
- makedumpfile/x86_64: fix an unnecessary message with --mem-usage option- dracut-module-setup: Don't build squashed image if required modules are missing- makedumpfile/arm64: Fix 'info->page_offset' calculation for both KASLR and non-KASLR cases
- makedumpfile: Prepare paddr_to_vaddr() for arch-specific p2v conversion- kdumpctl, earlykdump: Don't use kexec_file_load when secure boot is enabled- mkdumprd: drop some nfs mount options when reading from�x����������������������X���(
���������������_�$O����������������_^`�.de>Elliot Lee <sopwith@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-2Bernhard Rosenkraenzer <bero@redhat.com> 2.11b-1Preston Brown <pbrown@redhat.com> 2.11a-4Bernhard Rosenkraenzer <bero@redhat.com> 2.11a-3Erik Troan <ewt@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Tim Powers <timp@redhat.com>Preston Brown <pbrown@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Oliver Paukstadt <oliver.paukstadt@millenux.com>Florian La Roche <Florian.LaRoche@redhat.de>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Prospector <bugzilla@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Bernhard Rosenkraenzer <bero@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Jeff Johnson <jbj@redhat.com>Erik Troan <ewt@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Jakub Jelinek <jakub@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Bill Nottingham <notting@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jakub Jelinek <jakub@redhat.com>Jakub Jelinek <jakub@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Preston Brown <pbrown@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Bill Nottingham <notting@redhat.com>Peter Jones, <pjones@redhat.com>Christian 'Dr. Disk' Hechelmann <drdisk@tc-gruppe.de>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Matt Wilson <msw@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Matt Wilson <msw@redhat.com>Matt Wilson <msw@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Michael Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>David S. Miller <davem@dm.cobaltmicro.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Cristian Gafton <gafton@redhat.com>Mike Wangsmo <wanger@redhat.com>Cristian Gafton <gafton@redhat.com>Michael Fulbright <msf@redhat.com>Michael Fulbright <msf@redhat.com>Erik Troan <ewt@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com�x������������� ��������X���(
Ȩ���W�$m�����������������W�W�W�ld- fixed tcp timers info in netstat (#466845)- fixed ifconfig's man page (#454271, #432328)- fixed man pages for arp (#446195)
- fixed netstat --interfaces option (#446187)
- fixed clearing flags in ifconfig (#450252)- netstat displays correct sctp statistics (#445535) <zprikryl@redhat.com>- fix buffer for newer kernels (#435554)- fix for GCC 4.3- Autorebuild for GCC 4.3- rebuilt- fix netplugd init script (#242919)- better SELinux patch by <dwalsh@redhat.com>- fix segfault for empty interface (#234045)- we don't have -n/--node option (#225554)- quiet sctp (#229232)- spec file cleanup (#226193)- touch /etc/ethers (#225381)- fix arp unaligned access (#220438)- fix nameif crash for 16char long interface names (#209120)- fix -I option for nestat, works as -I=eth0 again.
- add dist tag- directory entries . and .. should be skipped- rebuild- switch --trim to --notrim .. make it less confusing- BuildRequires: libselinux-devel (#191737)- add netdevice.h, fix x25
- fix ifconfig crash when interface name is too long (#190703)- fix arp man page to correspond to man ethers (#190425)- display sctp connections using netstat -S <jbj@redhat.com>- fix wrong definition of _PATH_PROCNET_X25_ROUTE (#188786)- add note about -T to netstat- add note to ifconfig(8) about supported format for IPv4 addresses (#176661)- remove duplicate arp entries (#185604)- show inodes in netstat (#180974)- bump again for double-long bug on ppc(64)- new option for netstat - -T stops trimming remote and local addresses (#176465)- rebuilt for new gcc4.1 snapshot and glibc changes- mii-tool manpage fixed (#180055)- forget to enable the new selinux option :( - config.make changed- new option for nestat, -Z shows selinux context. Patch by <dwalsh@redhat.com>- clear static buffers in interface.c by <drepper@redhat.com> (#176714)- rebuilt- add note to hostname man page about gethostbyname() (#166581)
- don't ship any rarp man page (#170537)- fixed buffer overflow in arp (#164695)- ifconfig - fixed virtual interface dropping (#162888)- fr man pages are back (#159702)- etherwake man page changed to ether-wake (#159156)- don't show "duplicate line" warning (#143933)
- netstat has new statistcs (#133032)
- /etc/neplug is owned by net-tools (#130621)- flush output in mii-tool (#152568)- added mii-diag tool
- added newer ether-wake
- remove useless -i option from ifconfig
- stop trimming interface names (#152457)- rebuilt- behaviour of netstat -i option changed (#115987)
- netstat -i shows all interface, -I<Iface> only one- added RPM_OPT_FLAGS
- execshield patch for netplug <t8m@redhat.com>- small typo in german translation (#148775)- included infiniband support (#147396) <tduffy@sun.com>
- added etherwake man page- net-plug-1.2.9 - no changes, upstream included Red Hat patches
- ether-wake-1.08 - few changes in implementation (#145718)- don't report statistics for virtual devices (#143981) <kzak@redhat.com>
- fixing translation headers - content type format
- kill bitkeeper warning messages- filter out duplicate tcp entries (#139407)- added note to hostname(1) (#140239)
- fixed --num-ports option for netstat (#115100)- mii-tool(8) fixed, labeled as obsolete, added info (#138687)
- netstat crashing on i64 fixed (#138804) Patch by <Andreas.Hirstius@cern.ch>- IBM patch for netstat -s returning negative values on 64bit arch (#144064)
- broadcast calulated if only netmask provided (#60509)- fixed fail to assign the specified netmask before adress is assigned
- patch by Malita, Florin <florin.malita@glenayre.com>- spec file updated, added conversion for french and portugal man pages to UTF-8- parse error fixed (#131539)- The return value of nameif was wrong (#129032) - patch from Fujitsu QA- Trunc patch added (#128359)- Added patch for SI units by Tom "spot" Callaway <tcallawa@redhat.com> #118006- Fix installopts for netplug.- Build requires gettext.- Update to latest netplugd version.- Fixed initscript patch for netplug (#127351)- rebuilt- Fixed compiler warning/error in netplug.
- Up�x����������������������X�y�(
$@omd�$}����������������mdndld�rlcpy.3ssl.gzOPENSSL_strndup.3ssl.gzOPENSSL_thread_stop.3ssl.gzOPENSSL_zalloc.3ssl.gzOSSL_STORE_CTX.3ssl.gzOSSL_STORE_INFO.3ssl.gzOSSL_STORE_INFO_free.3ssl.gzOSSL_STORE_INFO_get0_CERT.3ssl.gzOSSL_STORE_INFO_get0_CRL.3ssl.gzOSSL_STORE_INFO_get0_NAME.3ssl.gzOSSL_STORE_INFO_get0_NAME_description.3ssl.gzOSSL_STORE_INFO_get0_PARAMS.3ssl.gzOSSL_STORE_INFO_get0_PKEY.3ssl.gzOSSL_STORE_INFO_get1_CERT.3ssl.gzOSSL_STORE_INFO_get1_CRL.3ssl.gzOSSL_STORE_INFO_get1_NAME.3ssl.gzOSSL_STORE_INFO_get1_NAME_description.3ssl.gzOSSL_STORE_INFO_get1_PARAMS.3ssl.gzOSSL_STORE_INFO_get1_PKEY.3ssl.gzOSSL_STORE_INFO_get_type.3ssl.gzOSSL_STORE_INFO_new_CERT.3ssl.gzOSSL_STORE_INFO_new_CRL.3ssl.gzOSSL_STORE_INFO_new_NAME.3ssl.gzOSSL_STORE_INFO_new_PARAMS.3ssl.gzOSSL_STORE_INFO_new_PKEY.3ssl.gzOSSL_STORE_INFO_set0_NAME_description.3ssl.gzOSSL_STORE_INFO_type_string.3ssl.gzOSSL_STORE_LOADER.3ssl.gzOSSL_STORE_LOADER_CTX.3ssl.gzOSSL_STORE_LOADER_free.3ssl.gzOSSL_STORE_LOADER_get0_engine.3ssl.gzOSSL_STORE_LOADER_get0_scheme.3ssl.gzOSSL_STORE_LOADER_new.3ssl.gzOSSL_STORE_LOADER_set_close.3ssl.gzOSSL_STORE_LOADER_set_ctrl.3ssl.gzOSSL_STORE_LOADER_set_eof.3ssl.gzOSSL_STORE_LOADER_set_error.3ssl.gzOSSL_STORE_LOADER_set_expect.3ssl.gzOSSL_STORE_LOADER_set_find.3ssl.gzOSSL_STORE_LOADER_set_load.3ssl.gzOSSL_STORE_LOADER_set_open.3ssl.gzOSSL_STORE_SEARCH.3ssl.gzOSSL_STORE_SEARCH_by_alias.3ssl.gzOSSL_STORE_SEARCH_by_issuer_serial.3ssl.gzOSSL_STORE_SEARCH_by_key_fingerprint.3ssl.gzOSSL_STORE_SEARCH_by_name.3ssl.gzOSSL_STORE_SEARCH_free.3ssl.gzOSSL_STORE_SEARCH_get0_bytes.3ssl.gzOSSL_STORE_SEARCH_get0_digest.3ssl.gzOSSL_STORE_SEARCH_get0_name.3ssl.gzOSSL_STORE_SEARCH_get0_serial.3ssl.gzOSSL_STORE_SEARCH_get0_string.3ssl.gzOSSL_STORE_SEARCH_get_type.3ssl.gzOSSL_STORE_close.3ssl.gzOSSL_STORE_close_fn.3ssl.gzOSSL_STORE_ctrl.3ssl.gzOSSL_STORE_ctrl_fn.3ssl.gzOSSL_STORE_eof.3ssl.gzOSSL_STORE_eof_fn.3ssl.gzOSSL_STORE_error.3ssl.gzOSSL_STORE_error_fn.3ssl.gzOSSL_STORE_expect.3ssl.gzOSSL_STORE_expect_fn.3ssl.gzOSSL_STORE_find.3ssl.gzOSSL_STORE_find_fn.3ssl.gzOSSL_STORE_load.3ssl.gzOSSL_STORE_load_fn.3ssl.gzOSSL_STORE_open.3ssl.gzOSSL_STORE_open_fn.3ssl.gzOSSL_STORE_post_process_info_fn.3ssl.gzOSSL_STORE_register_loader.3ssl.gzOSSL_STORE_supports_search.3ssl.gzOSSL_STORE_unregister_loader.3ssl.gzOTHERNAME_free.3ssl.gzOTHERNAME_new.3ssl.gzOpenSSL_add_all_algorithms.3ssl.gzOpenSSL_add_all_ciphers.3ssl.gzOpenSSL_add_all_digests.3ssl.gzOpenSSL_add_ssl_algorithms.3ssl.gzOpenSSL_version.3ssl.gzOpenSSL_version_num.3ssl.gzPBE2PARAM_free.3ssl.gzPBE2PARAM_new.3ssl.gzPBEPARAM_free.3ssl.gzPBEPARAM_new.3ssl.gzPBKDF2PARAM_free.3ssl.gzPBKDF2PARAM_new.3ssl.gzPEM_FLAG_EAY_COMPATIBLE.3ssl.gzPEM_FLAG_ONLY_B64.3ssl.gzPEM_FLAG_SECURE.3ssl.gzPEM_bytes_read_bio.3ssl.gzPEM_bytes_read_bio_secmem.3ssl.gzPEM_do_header.3ssl.gzPEM_get_EVP_CIPHER_INFO.3ssl.gzPEM_read.3ssl.gzPEM_read_CMS.3ssl.gzPEM_read_DHparams.3ssl.gzPEM_read_DSAPrivateKey.3ssl.gzPEM_read_DSA_PUBKEY.3ssl.gzPEM_read_DSAparams.3ssl.gzPEM_read_ECPKParameters.3ssl.gzPEM_read_ECPrivateKey.3ssl.gzPEM_read_EC_PUBKEY.3ssl.gzPEM_read_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_read_PKCS7.3ssl.gzPEM_read_PKCS8.3ssl.gzPEM_read_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_read_PUBKEY.3ssl.gzPEM_read_PrivateKey.3ssl.gzPEM_read_RSAPrivateKey.3ssl.gzPEM_read_RSAPublicKey.3ssl.gzPEM_read_RSA_PUBKEY.3ssl.gzPEM_read_SSL_SESSION.3ssl.gzPEM_read_X509.3ssl.gzPEM_read_X509_AUX.3ssl.gzPEM_read_X509_CRL.3ssl.gzPEM_read_X509_REQ.3ssl.gzPEM_read_bio.3ssl.gzPEM_read_bio_CMS.3ssl.gzPEM_read_bio_DHparams.3ssl.gzPEM_read_bio_DSAPrivateKey.3ssl.gzPEM_read_bio_DSA_PUBKEY.3ssl.gzPEM_read_bio_DSAparams.3ssl.gzPEM_read_bio_ECPKParameters.3ssl.gzPEM_read_bio_EC_PUBKEY.3ssl.gzPEM_read_bio_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_read_bio_PKCS7.3ssl.gzPEM_read_bio_PKCS8.3ssl.gzPEM_read_bio_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_read_bio_PUBKEY.3ssl.gzPEM_read_bio_Parameters.3ssl.gzPEM_read_bio_PrivateKey.3ssl.gzPEM_read_bio_RSAPrivateKey.3ssl.gzPEM_read_bio_�x�����ȗ�������XD7�(
�0,���$h�����������������������jskarvad@redhat.com> - 2.20.0-0.2.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.20.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.19.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.19.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.18.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.16.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.16.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.15.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.14.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-5Ondřej Lysoněk <olysonek@redhat.com> - 2.13.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.13.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.12.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-15Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-14Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-13Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-12Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-11Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-10Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-9Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-8Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-7Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-5Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-4Ondřej Lysoněk <olysonek@redhat.com> - 2.10.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.10.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-10.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-9.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.9.0-1.20180430git5d0a9d91Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-5Fedora Release Engineering <releng@fedoraproject.org> - 2.8.0-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.8.0-1Fedora Release Engineering <releng@fedoraproject.org> - 2.7.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.7.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.6.0-3Fedora Release Engineering <releng@fedoraproject.org> - 2.6.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.6.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.5.0-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.4.1-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-5Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.4.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.3.0-3Jaroslav Škarvada <jskar�x�������������xt�������X�`�(
y84�d�$�����������������d�d�d��x��������������c�������X�S�(
��������8��d�$�����������������d�d�d�r Pisar <ppisar@redhat.com> - 1:1.0.1e-10Tomas Mraz <tmraz@redhat.com> 1.0.1e-9Tomas Mraz <tmraz@redhat.com> 1.0.1e-8Tomas Mraz <tmraz@redhat.com> 1.0.1e-7Tomas Mraz <tmraz@redhat.com> 1.0.1e-6Peter Robinson <pbrobinson@fedoraproject.org> 1.0.1e-5Tomas Mraz <tmraz@redhat.com> 1.0.1e-4Tomas Mraz <tmraz@redhat.com> 1.0.1e-3Tomas Mraz <tmraz@redhat.com> 1.0.1e-2Tomas Mraz <tmraz@redhat.com> 1.0.1e-1Tomas Mraz <tmraz@redhat.com> 1.0.1c-12Tomas Mraz <tmraz@redhat.com> 1.0.1c-11Tomas Mraz <tmraz@redhat.com> 1.0.1c-10Tomas Mraz <tmraz@redhat.com> 1.0.1c-9Tomas Mraz <tmraz@redhat.com> 1.0.1c-8Tomas Mraz <tmraz@redhat.com> 1.0.1c-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1:1.0.1c-6Tomas Mraz <tmraz@redhat.com> 1.0.1c-5Tomas Mraz <tmraz@redhat.com> 1.0.1c-4Tomas Mraz <tmraz@redhat.com> 1.0.1c-3Tomas Mraz <tmraz@redhat.com> 1.0.1c-2Tomas Mraz <tmraz@redhat.com> 1.0.1c-1Tomas Mraz <tmraz@redhat.com> 1.0.1b-1Tomas Mraz <tmraz@redhat.com> 1.0.1a-1Tomas Mraz <tmraz@redhat.com> 1.0.1-3Tomas Mraz <tmraz@redhat.com> 1.0.1-2Tomas Mraz <tmraz@redhat.com> 1.0.1-1Tomas Mraz <tmraz@redhat.com> 1.0.1-0.3.beta3Tomas Mraz <tmraz@redhat.com> 1.0.1-0.2.beta3Tomas Mraz <tmraz@redhat.com> 1.0.1-0.1.beta2Tomas Mraz <tmraz@redhat.com> 1.0.0g-1Tomas Mraz <tmraz@redhat.com> 1.0.0f-1Tomas Mraz <tmraz@redhat.com> 1.0.0e-4Tomas Mraz <tmraz@redhat.com> 1.0.0e-3Tomas Mraz <tmraz@redhat.com> 1.0.0e-2Tomas Mraz <tmraz@redhat.com> 1.0.0e-1Tomas Mraz <tmraz@redhat.com> 1.0.0d-8Tomas Mraz <tmraz@redhat.com> 1.0.0d-7Tomas Mraz <tmraz@redhat.com> 1.0.0d-6Tomas Mraz <tmraz@redhat.com> 1.0.0d-5Tomas Mraz <tmraz@redhat.com> 1.0.0d-4Tomas Mraz <tmraz@redhat.com> 1.0.0d-3Tomas Mraz <tmraz@redhat.com> 1.0.0d-2Tomas Mraz <tmraz@redhat.com> 1.0.0d-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.0.0c-4Tomas Mraz <tmraz@redhat.com> 1.0.0c-3Tomas Mraz <tmraz@redhat.com> 1.0.0c-2Tomas Mraz <tmraz@redhat.com> 1.0.0c-1Tomas Mraz <tmraz@redhat.com> 1.0.0b-3Tomas Mraz <tmraz@redhat.com> 1.0.0b-2Tomas Mraz <tmraz@redhat.com> 1.0.0b-1Tomas Mraz <tmraz@redhat.com> 1.0.0a-3Tomas Mraz <tmraz@redhat.com> 1.0.0a-2Tomas Mraz <tmraz@redhat.com> 1.0.0a-1Tomas Mraz <tmraz@redhat.com> 1.0.0-5Tomas Mraz <tmraz@redhat.com> 1.0.0-4Tomas Mraz <tmraz@redhat.com> 1.0.0-3Tomas Mraz <tmraz@redhat.com> 1.0.0-2Tomas Mraz <tmraz@redhat.com> 1.0.0-1Tomas Mraz <tmraz@redhat.com> 1.0.0-0.22.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.21.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.20.beta5Tomas Mraz <tmraz@redhat.com> 1.0.0-0.19.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.18.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.17.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.16.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.15.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.14.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.13.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.12.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.11.beta4Tomas Mraz <tmraz@redhat.com> 1.0.0-0.10.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.9.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.8.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.7.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.6.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.5.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.4.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.3.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.2.beta3Tomas Mraz <tmraz@redhat.com> 1.0.0-0.1.beta3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.9.8k-7Bill Nottingham <notting@redhat.com>Tomas Mraz <tmraz@redhat.com> 0.9.8k-6Tomas Mraz <tmraz@redhat.com> 0.9.8k-5Tomas Mraz <tmraz@redhat.com> 0.9.8k-4Tomas Mraz <tmraz@redhat.com> 0.9.8k-3Tomas Mraz <tmraz@redhat.com> 0.9.8k-2Tomas Mraz <tmraz@redhat.com> 0.9.8k-1Tomas Mraz <tmraz@redhat.com> 0.9.8j-10Tomas Mraz <tmraz@redhat.com> 0.9.8j-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.9.8j-8Tomas Mraz <tmraz@redhat.com> 0.9.8j-7Tomas Mraz <tmraz@redhat.com> 0.9.8j-6Tomas Mraz <tmraz@redhat.com> 0.9.8j-5Tomas Mraz <tmraz@redhat.com> �x�����>	HS�������X��(
 B�#n�$~����������������nmo�	


 !"#$%&&'())*+,--./012234556789:;<=>>?@@@@ABCDEEFGGHIIJJJKLLMNOPQQRSTUVVWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZ[[[[[[\]]]]]^_`abcdefghijklmnopqrstuvwxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzadjtimemtabloginremoterunuserrunuser-lsusu-lcalchmemchrtcolcolcrtcolrmcolumndmesgejectfallocatefincorefindmntflockgetopthexdumpi386ioniceipcmkipcrmipcsisosizekilllastlastblinux32linux64loggerloginlooklsblklscpulsipclslockslsloginslsmemlsnsmcookiemesgmoremountmountpointnameinsenterprlimitrawrenamerenicerevscriptscriptreplaysetarchsetprivsetsidsettermsutasksetulumountuname26unshareutmpdumpuuidgenuuidparsewallwdctlwhereiswritex86_64.build-id009219e358382627110aa2873705f9e5a571b03bcd2682bb03f2fd95d69809b4885cca619ab7d301bd476ab709c516470e74fd08f54074d31c19b4064260a6230beda04eb252db03555241020324f81b57d0c25d77b2e6cfd52a2aad1b74c56ecb46a91d9b4e45afe837c7eb4c53548b75df2f8d0705cb23930f026445ef98d4da490b100ca70f47a3df6926f840aa8aaf351d6db02657710d4d67d0386521294a1d143ea2871f3e2ed5bc2e04db32ea290e362b0acc07b4e7553291368912761ccd0cf8deb4d1707be9885f8ced7c5780a4945a1785861d70ef2d39ebe7f4ca2cdb365cc5a9aa9e356b3c96a85e99a6ed0176c1ffbe9de63047f7e4400a7ac9312f0b0a383360b8423522795127961534bdb060e23445fc8dbdb11ac88ebc3f1a74eadc0d0b2556283541638a6871762059904627fb8fde808eb8f3b4360912916f7247ca72648ef4304ab0c46f4b0d5037d58cfc0cc4b064b5777d1c610edbdcf3ab0a3339151120aba86b79c44792da063cd5ba688e3dc53d099729d0d03eabf8e79d4d6afdd25194be2cf43e82124a0700ec5ece3d81ba6c675b598ef23c719877f48f78170c2497b43896d06a8651763c624306ce1f6ad3ce18ecc219a303d336ea5f77810e4bfdf3b9a45c0228b0a2bfdd376e48b58b91f36c4ffbec8ad9ffda8daccb0e7a3adef656d847ebd2530df3fecc75965786f1fbc7aa64e4d87e05258a56708bfcdd0b212c0d8dfbe17ba4d3ca76407d9657406f96ecbc2f6576f5d78f254bf3571b1f5d4c8197c089708b3416bc29fcd59d841c72ac308f5a939fcd2197a7cb8e3ccee3cb41b0992027c77e5c808cf19b002989ce568c9557a920e439e272255eb883c9111918963553b0b1ffd855d7ee9782d9f5ac1ac892946bc8cadb66581180a4347370a05f1e784fd38990fcea�x��������������B�������X��(
8�N��������$��������������������on- Update to 0.7.20
- new SOLVER_EXCLUDEFROMWEAK job to ignore pkgs for weak dependencies
- support for environments in comps parser
- fix misparsing of '&' in attributes with libxml2
- choice rules: treat orphaned packages as newest
- fix compatibility with Python 3.10- Update to 0.7.19
- repo_add_conda: add flag to skip v2 packages
- fix rare segfault in resolve_jobrules() that could happen if new rules are learnt
- fix error handling in solv_xfopen_fd()
- fix memory leaks- Fix rpm dependency- Update to 0.7.17
- selected bug fixes:
  * repo_write: fix handling of nested flexarray
  * improve choicerule generation a bit more to cover more cases
  * harden testcase parser against repos being added too late
  * support python-3.10
  * check /var/lib/rpm macro in rpmdb code
- new features:
  * handle default/visible/langonly attributes in comps parser
  * support multiple collections in updateinfo parser
  * add '-D' option in rpmdb2solv to set the dbpath- Enable zstd compression in libsolv- Update to 0.7.16
- selected bug fixes:
  * make testcase_mangle_repo_names deal correctly with freed repos
  [bnc#1177238]
  * fix add_complex_recommends() selecting conflicted packages in
    rare cases leading to crashes
  * improve choicerule generation so that package updates are
    prefered in more cases
  * fix deduceq2addedmap clearing bits outside of the map
  * conda: feature depriorization and fix startswith implementation
  * Fix solvable swapping messing up idarrays
  * fix ruleinfo of complex dependencies returning the wrong origin
  * fix solv_zchunk decoding error if large chunks are used
    [bnc#1159314]
- new features
  * new testcase_mangle_repo_names() function
  * new solv_fmemopen() function
  * Enable zstd compression support for sle15 and sle15-sp2
  * Support blacklisted packages in solver_findproblemrule()
    [bnc#1172135]
  * Support rules with multiple negative literals in choice rule
    generation
  * build with -DENABLE_RPMDB_LIBRPM=1 on SUSE to support
    multiple rpm database backends
  * added two new function to make libzypp independent of the rpm
    database format
  * support conda constrains dependencies- Update to 0.7.11
- selected bug fixes:
  * support arch<->noarch package changes when creating patch
    conflicts from the updateinfo data
  * also support other rpm database types
  * fixed solv_zchunk decoding error if large chunks are used
  * treat retracted pathes as irrelevant
  * made add_update_target work with multiversion installs
- new features
  * support for SOLVER_BLACKLIST jobs that block the installation of matched
    packages unless they are directly selected by an SOLVER_INSTALL job
  * libsolv now also parses the patch status in the updateinfo parser
  * new solvable_matchessolvable() function
  * support conda constrains dependencies
  * new rpm_stat_database() function
  * new rpm_hash_database_state() function- Update to 0.7.7
- selected bug fixes:
  * fix updating of too many packages in focusbest mode
  * fix handling of disabled installed packages in distupgrade
  * fix repository priority handling for multiversion packages
  * better support of inverval deps in pool_match_dep()
  * support src rpms that have non-empty provides
  * fix favorq leaking between solver runs if the solver is reused
  * fix SOLVER_FLAG_FOCUS_BEST updateing packages without reason
  * be more correct with multiversion packages that obsolete their
    own name
  * allow building with swig-4.0.0
  * lock jobs now take precedence over dup and forcebest jobs
- new features
  * new POOL_FLAG_WHATPROVIDESWITHDISABLED pool flag 
  * bindings: add get_disabled_list() and set_disabled_list()
  * bindings: add whatcontainsdep()
  * bindings: make the selection filters return the self object
  * MSVC compilation support- Backport patches: Use OpenSSL for computing hashes (RhBug:1630300)- Backport patch: Not considered excluded packages as a best candidate (RhBug:1677583)- soname bump to "1"
- incompatible API changes:
  * bindings: Selection.flags is now an attrib�x�������������82�������X�ܜ(
@��M������O��$_����������������O�P�N��h�/�h�/�h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�0+h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h��x��������������!�������X�ޚ(
���������Du��$e����������������u�v��D�?�hd����	�	-���������������	�)�X�^h
�
	�

�
�
*

p
�
�
� 
HXp�(-84�9P�:m�G��
H��
I� 
X�,Y�4\�d
]��
^��b�fd��e��f��l��t��
u��
v� ������"��d�x�|6����6
�!�dh
tgxh|Cyum4.7.021.el8_10.alma.1Package managerUtility that allows users to manage packages on their systems.
It supports RPMs, modules and comps groups & environments.g��s390x-builder01.almalinux.org0GAlmaLinuxAlmaLinuxGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/rpm-software-management/dnflinuxnoarchV�+OWV􁤡�����������������`tf�g��g��g��g��g��g��g��g��g��633e249364390d0039a36eae62b88d487e4dc524fe0a5dd166d955ed77a925244e9b9a734b9e49487bee8c55aa8a5d7836e0fd778a603df49e8eed8a3abb6beee296da78e45625199c0e9357c1f125e87cca1d3973b652948da3ee2edc9a00b393c62612b96e27d3dc771dc154ab3b6beee939274524ae9077e2a7e2318f24c60b813e2d7982896faa9b6ba56108480214d226d83a5c51cc5401f5d4d818a82ednf/dnf.conf../dnf/plugins../dnf/protected.d../dnf/varsdnf-3rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootdnf-4.7.0-21.el8_10.alma.1.src.rpm����������������������������������������config(yum)yum



config(yum)dnfrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)4.7.0-21.el8_10.alma.14.7.0-21.el8_10.alma.13.0.4-14.6.0-14.0-15.2-14.14.3g�%�g�@e-%�d� �dw6�dd��dx�c���c�E�cY!@c p�b֜�b��brj�a�e�a�q@a�b�a�b�aS@`��@`���`%@`"y@`!'�`3@`��`��`2@_���_��@_���_ @_��^��@^�?@^��^K�^4�^[�]�+�]��@]��@]��@]���]nU�]i�]S��]Ik�]�@\���\�\@\�7�\eX@\]o@\\�\Z�@\/J�\��[��[�[ā@[�#@[�\�[�h@[�-�[qr�[i��[[	@[P}@[GB�[6@[2*�Y�B@Y�@Y�p@Y�*@Y�V@Yu�@Y>�@Y"�YR@Yt�X�s�X��X��X��@X�Y�XQ4@XAb@W�@W�R�W��@W��W��W��W�@WDB@W=��W��V��V�@Vr��VI�@VC�V�VB�VB�VB�U��U�A�U�5@UȒ@U�c@U�4@U��@Uv�@Uv�@U@�U�@T�	�T���T���T.��S��S��S�;@S�i@S�E�S��Sc��SW�@S0@S&�S�S
�@Eduard Abdullin <eabdullin@almalinux.org> - 4.7.0-21.alma.1Marek Blaha <mblaha@redhat.com> - 4.7.0-21Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-20Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-19Nicola Sella <nsella@redhat.com> - 4.7.0-18Jaroslav Rohel <jrohel@redhat.com> - 4.7.0-17Marek Blaha <mblaha@redhat.com> - 4.7.0-16Nicola Sella <nsella@redhat.com> - 4.7.0-15Nicola Sella <nsella@redhat.com> - 4.7.0-14Nicola Sella <nsella@redhat.com> - 4.7.0-13Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-12Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-11Richard W.M. Jones <rjones@redhat.com> - 4.7.0-10Lukas Hrazky <lhrazky@redhat.com> - 4.7.0-8Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-7Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-6Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-5Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-3Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-2Pavla Kratochvilova <pkratoch@redhat.com> - 4.7.0-1Nicola Sella <nsella@redhat.com> - 4.4.2-10Nicola Sella <nsella@redhat.com> - 4.4.2-9Nicola �x�������������X�������X���(
������������������$~��������������������grub2 efi config file
- pass persistent name to dracut --device
- pass persistent name to dracut --mount
- use persistent name in kdump.conf of initramfs
- mkdumprd: add function get_persistent_dev
- remove useless uuid and label handling- doc fix for mount dump target before mkdumprd
- pull makedumpfile 1.5.0- pass raw device as dracut argument
- iscsi setup fix
- firstboot: add automatic and manual memory reservation for rhel
- firstboot: remove unnecessary underline shortkey
- firstboot: fix gtk warning about non-zero page size
- firstboot: update all kernels config in grubbyCmd
- firstboot: add actual reserved memory widget
- firstboot code cleanup
- rhcrashkernel-param: echo crashkernel=auto for rhel7
- Remove the kernel-kdump handling
- s390x firstboot fix
- remove elilo support
- grub2 fix in firstboot
- Take closing the reboot dialog as no
- Handle new crashkernel= syntax in firstboot
- Fix a localized string in firstboot
- Configure kdump in firstboot
- fix firstboot to ensure kdump svc is disabled properly
- firstboot text domain fix
- Update to use systemctl instead of sysv chkconfig
- port force_rebuild kdump.conf option
- Change return value to indicate the result of dump_raw() correctly.
- call dracut function for default shell- refactor net option
- use fstab-sys to mount nfs
- rename function dump_localfs
- dump_localfs error path fix
- update kexec-kdump-howto.txt about systemctl commands
- ssh propagate alert message fix
- remove useless dracut cmdline '-c /dev/null'
- remove useless dracut cmdline for kernel-modules and kdumpbase
- install core_collector in module-setup.sh
- install extra_bins in module-setup.sh
- remove busybox dependency
- improve warning message of space checking
- do not mount root twice
- do not add fstab-sys module in dracut cmdline
- omit dash module
- network dns config fix
- shell exit value fix- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- add s390x netdev setup
- Add s390x support
- Cleanup temp file leaved at /tmp/
- add check_size function for fs dump
- add ssh check_size
- blacklist patch apply fix
- Respect bonding mode
- Support dump over vlan tagged bonding- add blacklist option, Resolves: bz805774
- Add kdump_post and kdump_pre support, Resolves: bz805773
- Port check_config from rhel6, Resolves: bz805778
- raw core_collector fix
- ssh core_collector fix
- drcut-kdump.sh: cleanup kdump.conf check- cleanup DUMP_INSTRUCTION handling
- final reboot behavior fix
- dump_rootfs for default target fix
- add vlan support
- fix and refactor bond handling code
- fix and refactor bridge handling code
- core_collector doc basic fix
- omit plymouth module, Resolves: bz821997
- mkdumprd manpage cleanup manpage
- mkdumprd: remove --debug
- mkdumprd: remove noconf
- makedumprd: remove -d
- kdump.conf add sshkey
- kdump.conf remove disk_timeout
- kdump.conf make path uncommented
- kdump.conf.5 add default poweroff
- kdump.conf default shell fix
- kdump.conf default default action fix
- kdump.conf.5 remove module option
- kdump.conf remove kdump_pre/kdump_post
- kdump.conf: remove link_delay- do_default_action cleanup, Resolves: bz805773
- add rhcrashkernel-param for anaconda use, Resolves: bz707441
- Basic iscsi target dump support (software initiator), Resolves bz822701
- Static ip configuratio support, Resolves: bz822739
- udev rules fix, Resolves: bz808817- remove dracut-files.tgz2- mkdumprd: Start using --hostonly and --add kdumpbase while calling dracut
- get_mp function cleanup
- move kdump script order to the end of pre pivot
- port raw dump from rhel6
- remove multi dump- update dracut-files.tbz2- update ppc64 sysconfig, resolve bug 811449
- deal with nic rename issue, resolve bug 810107
- update x86_64 sysconfig, resolve bug 813711- variable name fix from Dave Young.- get ip addr with getent
- spec: depends on dracut-network
- Handle net option for nfs in kdump.conf correctly- Bump this version.- Fixup sysytemd service file.- Add ssh dump support, resolve bug 789253.- Pull the latest makedumpfile release, 1.4.2�x���������������������X:��(
xi��������$k�������������������L/,?+d����	�	8�|�������������	���?�EL�	�
,�8
�		�
 
@
�8"�"h"(�8�9:P>�@�B�G�H `I �X!Y!$Z!L[!P\!X]!�^#db&dd'�e'�f'�l'�t'�u(Hv(�w)\x)�y*<�*��*��*��+++�,�,��
.�.��/// g/$h/(Ccryptsetup-libs2.3.77.el8Cryptsetup shared libraryThis package contains the cryptsetup shared library, libcryptsetup.e+a�x64-builder01.almalinux.org ��AlmaLinuxAlmaLinuxGPLv2+ and LGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Librarieshttps://gitlab.com/cryptsetup/cryptsetuplinuxx86_64-#HIrjo��q�g��8�ŝ ��)���C!$/�R��>�B#��A�A�A�������A큤��������������������������������������e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�O1d`P�Ȉe+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�e+a�d6bb4b689200c2348945700a6b0dad5df92bc2015860d15f36a25590814d77b00f8629d71a149e283f11966880fbd4649f72dac58ee73ab2898de5dbd230fdf145670cce8b6a0ddd66c8016cd8ccef6cd71f35717cbacc7f1e895b3855207b338c33cc37871654ec7ed87e6fbb896c8cf33ef5ef05b1611a5aed857596ffafa5956d0a91de87341f2dfb8a368e07f48f551664d6c198961d47cfeb2871211c5476a39c8c29196100c56ea4d99da32f0fe856c7eaf773b3f56d6bd7ebef681636699bffa295584c8aec0b7e152f690cc70e2a98bdc307f724d9ffb911f48f1c96803b4f86d3fb43f763a1a25bd17d59585332d2b4b26261369047d740c4bf534b1473d41a3ebd6fea41a04e21d323efb5570e1b56b44b4482072b564c2a7c44e8fec0c8a6379ce2ebe746d89dfaf34088af9807d16df489899c8343ac81a582d97cfb80aed1ddd3710b56a6fa11e3d75c1fe793607d2e1d40c3447841d2a38070ebd90da02522962a67732b8600e28e93f216ce47f8c2c621a30f35921515af0e35fc8a7e3a5dec7eb29c353acf9b5545702eb121ee02568acd4dabf3e69ee0d017d5bdb3dab5034e4e7f0642abb2ff91f58df5afe154ec46c490d3aabf25203f8fa39aeefe9a99c86df7e0398cc94e4c6c63b32f52002f2470a8d4a6043052870a40840454b8a0dd0a6adf3d6d402180e4c25e591fee5f4251017f1e05d1c29271b075da371f5dbcc25b68ab67f66b249d6afa0a58fa5b9a1ffa19bc3717cd3d1a19c413925c9531e888da4907975ead1e5b7eb23b717c842cad41d07ee92bd62ba2d77cbc6abffc2a23e4eb6b477ecfcd640a48db16715ceccf59fd0282f3af7b83d9af738ef89051a6d93bf11cd1cc8119226bf059ae8c4ef8dc342ab0572a0c1e67fc3cd5ea94fc4486339d314c14f5be4c5189611ea77db7f9ab0022384227cb6876aa26971a476ffc5dc59cffd6953024a7793226e2cffb99b7366a247a../../../../usr/lib64/libcryptsetup.so.12.6.0libcryptsetup.so.12.6.0@��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcryptsetup-2.3.7-7.el8.src.rpm���������������������������������������������������������������������������������������������������������������cryptsetup-libscryptsetup-libs(x86-64)cryptsetup-luks-libslibcryptsetup.so.12()(64bit)libcryptsetup.so.12(�x�������������H�����X�r�(
x%
�ytd�$d����������������tdudsd�EC_KEY_get0_group.3ssl.gzEC_KEY_get0_private_key.3ssl.gzEC_KEY_get0_public_key.3ssl.gzEC_KEY_get_conv_form.3ssl.gzEC_KEY_get_enc_flags.3ssl.gzEC_KEY_get_ex_data.3ssl.gzEC_KEY_get_ex_new_index.3ssl.gzEC_KEY_get_flags.3ssl.gzEC_KEY_get_method.3ssl.gzEC_KEY_key2buf.3ssl.gzEC_KEY_new.3ssl.gzEC_KEY_new_by_curve_name.3ssl.gzEC_KEY_oct2key.3ssl.gzEC_KEY_oct2priv.3ssl.gzEC_KEY_precompute_mult.3ssl.gzEC_KEY_priv2buf.3ssl.gzEC_KEY_priv2oct.3ssl.gzEC_KEY_set_asn1_flag.3ssl.gzEC_KEY_set_conv_form.3ssl.gzEC_KEY_set_enc_flags.3ssl.gzEC_KEY_set_ex_data.3ssl.gzEC_KEY_set_flags.3ssl.gzEC_KEY_set_group.3ssl.gzEC_KEY_set_method.3ssl.gzEC_KEY_set_private_key.3ssl.gzEC_KEY_set_public_key.3ssl.gzEC_KEY_set_public_key_affine_coordinates.3ssl.gzEC_KEY_up_ref.3ssl.gzEC_METHOD_get_field_type.3ssl.gzEC_POINT_add.3ssl.gzEC_POINT_bn2point.3ssl.gzEC_POINT_clear_free.3ssl.gzEC_POINT_cmp.3ssl.gzEC_POINT_copy.3ssl.gzEC_POINT_dbl.3ssl.gzEC_POINT_dup.3ssl.gzEC_POINT_free.3ssl.gzEC_POINT_get_Jprojective_coordinates_GFp.3ssl.gzEC_POINT_get_affine_coordinates.3ssl.gzEC_POINT_get_affine_coordinates_GF2m.3ssl.gzEC_POINT_get_affine_coordinates_GFp.3ssl.gzEC_POINT_hex2point.3ssl.gzEC_POINT_invert.3ssl.gzEC_POINT_is_at_infinity.3ssl.gzEC_POINT_is_on_curve.3ssl.gzEC_POINT_make_affine.3ssl.gzEC_POINT_method_of.3ssl.gzEC_POINT_mul.3ssl.gzEC_POINT_new.3ssl.gzEC_POINT_oct2point.3ssl.gzEC_POINT_point2bn.3ssl.gzEC_POINT_point2buf.3ssl.gzEC_POINT_point2hex.3ssl.gzEC_POINT_point2oct.3ssl.gzEC_POINT_set_Jprojective_coordinates_GFp.3ssl.gzEC_POINT_set_affine_coordinates.3ssl.gzEC_POINT_set_affine_coordinates_GF2m.3ssl.gzEC_POINT_set_affine_coordinates_GFp.3ssl.gzEC_POINT_set_compressed_coordinates.3ssl.gzEC_POINT_set_compressed_coordinates_GF2m.3ssl.gzEC_POINT_set_compressed_coordinates_GFp.3ssl.gzEC_POINT_set_to_infinity.3ssl.gzEC_POINTs_make_affine.3ssl.gzEC_POINTs_mul.3ssl.gzEC_get_builtin_curves.3ssl.gzEDIPARTYNAME_free.3ssl.gzEDIPARTYNAME_new.3ssl.gzENGINE_add.3ssl.gzENGINE_add_conf_module.3ssl.gzENGINE_by_id.3ssl.gzENGINE_cleanup.3ssl.gzENGINE_cmd_is_executable.3ssl.gzENGINE_ctrl.3ssl.gzENGINE_ctrl_cmd.3ssl.gzENGINE_ctrl_cmd_string.3ssl.gzENGINE_finish.3ssl.gzENGINE_free.3ssl.gzENGINE_get_DH.3ssl.gzENGINE_get_DSA.3ssl.gzENGINE_get_RAND.3ssl.gzENGINE_get_RSA.3ssl.gzENGINE_get_cipher.3ssl.gzENGINE_get_cipher_engine.3ssl.gzENGINE_get_ciphers.3ssl.gzENGINE_get_cmd_defns.3ssl.gzENGINE_get_ctrl_function.3ssl.gzENGINE_get_default_DH.3ssl.gzENGINE_get_default_DSA.3ssl.gzENGINE_get_default_RAND.3ssl.gzENGINE_get_default_RSA.3ssl.gzENGINE_get_destroy_function.3ssl.gzENGINE_get_digest.3ssl.gzENGINE_get_digest_engine.3ssl.gzENGINE_get_digests.3ssl.gzENGINE_get_ex_data.3ssl.gzENGINE_get_ex_new_index.3ssl.gzENGINE_get_finish_function.3ssl.gzENGINE_get_first.3ssl.gzENGINE_get_flags.3ssl.gzENGINE_get_id.3ssl.gzENGINE_get_init_function.3ssl.gzENGINE_get_last.3ssl.gzENGINE_get_load_privkey_function.3ssl.gzENGINE_get_load_pubkey_function.3ssl.gzENGINE_get_name.3ssl.gzENGINE_get_next.3ssl.gzENGINE_get_prev.3ssl.gzENGINE_get_table_flags.3ssl.gzENGINE_init.3ssl.gzENGINE_load_builtin_engines.3ssl.gzENGINE_load_private_key.3ssl.gzENGINE_load_public_key.3ssl.gzENGINE_new.3ssl.gzENGINE_register_DH.3ssl.gzENGINE_register_DSA.3ssl.gzENGINE_register_RAND.3ssl.gzENGINE_register_RSA.3ssl.gzENGINE_register_all_DH.3ssl.gzENGINE_register_all_DSA.3ssl.gzENGINE_register_all_RAND.3ssl.gzENGINE_register_all_RSA.3ssl.gzENGINE_register_all_ciphers.3ssl.gzENGINE_register_all_complete.3ssl.gzENGINE_register_all_digests.3ssl.gzENGINE_register_ciphers.3ssl.gzENGINE_register_complete.3ssl.gzENGINE_register_digests.3ssl.gzENGINE_remove.3ssl.gzENGINE_set_DH.3ssl.gzENGINE_set_DSA.3ssl.gzENGINE_set_RAND.3ssl.gzENGINE_set_RSA.3ssl.gzENGINE_set_ciphers.3ssl.gzENGINE_set_cmd_defns.3ssl.gzENGINE_set_ctrl_function.3ssl.gzENGINE_set_default.3ssl.gzENGINE_set_default_DH.3ssl.gzENGINE_set_default_DSA.3ssl.gzENGINE_set_default_RAND.3ssl.gzENGINE_set_default_RSA.�x���������������������Xf�(
��؏�d�$�����������������d�dd�
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������









	























 
!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd�x�������������(�������X��(
�$X�����{!�$k����������������{!z!|!�7)
- Fix an overflow when parsing a character range with no preceding character
  (RT#132245)
- Fix walking symbol table for ISA in Carp
- Fix handling file names with null bytes in stat and lstat functions
  (RT#131895)
- Fix a crash when untying an object witout a stash
- Fix deparsing of transliterations with unprintable characters (RT#132405)
- Fix error reporting on do() on a directory (RT#125774)
- Fix stack manipulation when a lexical subroutine is defined in a do block in
  a member of an iteration list (RT#132442)
- Fix setting $! when statting a closed file handle (RT#108288)
- Fix tainting of s/// with overloaded replacement (RT#115266)
- Expand system() arguments before a fork (RT#121105)
- Avoid undefined behavior when copying memory in Glob and pp_caller (RT#131746)- Update perl(:MODULE_COMPAT)- 5.26.1 bump (see <http://search.cpan.org/dist/perl-5.26.1/pod/perldelta.pod>
  for release notes)- Fix unreliable Time-HiRes tests (CPAN RT#122819)
- Do not require $Config{libs} providers by perl-devel package (bug #1481324)- Fix reporting malformed UTF-8 character (RT#131646)
- Fix File::Glob rt131211.t test random failures
- Fix t/op/hash.t test random failures
- Parse caret variables with subscripts as normal variables inside ${...}
  escaping (RT#131664)
- Do not display too many bytes when reporting malformed UTF-8 character
- Fix select called with a repeated magical variable (RT#131645)
- Fix error message for "our sub foo::bar" (RT#131679)
- Fix executing arybase::_tie_it() in Safe compartement (RT#131588)
- Fix handling attribute specification on our variables (RT#131597)
- Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907)
- Fix compiler warnings in code generated by ExtUtils::Constant
  (CPAN RT#63832, CPAN RT#101487)
- Fix GCC version detection for -D_FORTIFY_SOURCE override (RT#131809)- Enable separate debuginfo back- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- perl package installs all core modules, interpreter moved to
  perl-interpreter package, perl-core package is obsolete
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>
  (bug #1464903)- Make File::Glob more resistant against degenerative matching (RT#131211)
- Fix a crash when calling a subroutine from a stash (RT#131085)
- Fix an improper cast of a negative integer to an unsigned 8-bit type (RT#131190)
- Fix cloning :via handles on thread creation (RT#131221)
- Fix glob UTF-8 flag on a glob reassignment (RT#131263)
- Fix a buffer overflow in my_atof2() (RT#131526)
- Fix handling backslashes in PATH environment variable when executing
  "perl -S" (RT#129183)
- Fix a conditional jump on uninitilized memory in re_intuit_start() (RT#131575)
- Fix spurious "Assuming NOT a POSIX class" warning (RT#131522)
- Provide perl-interpreter RPM dependency symbol
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>- Stop providing old perl(MODULE_COMPAT_5.24.*)- 5.26.0 bump (see <http://search.cpan.org/dist/perl-5.26.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages
- Update or remove patches
- Enable hardening (bug #1238804)
- Use 64 bit ints on 32 bit platforms (bug #1268828)- Introduce build-conditions for groff, systemtap, syslog tests, and tcsh- Fix a null-pointer dereference on malformed code (RT#130815)
- Fix an use-after-free in substr() that modifies a magic variable (RT#129340)
- Fix a memory leak leak in Perl_reg_named_buff_fetch() (RT#130822)
- Fix an invalid memory read when parsing a loop variable (RT#130814)
- Fix a heap-use-after-free in four-arguments substr call (RT#130624)- Adapt Compress::Raw::Zlib to zlib-1.2.11 (bug #1420326)
- Fix a heap buffer overflow when evaluating regexps with embedded code blocks
  from more than one source (RT#129881)
- Fix a memory leak in list assignment from or to magic values (RT#130766)- Adapt tests to zlib-1.2.11 (bug #1420326)
- Fix a crash when compiling a regexp with impossible quantifiers (RT#130561)
- Fix a buffer overrun with format and "u�x����������������������X֜(
�%�������r�$b����������������rqs�Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Add patch for OpenSSL 1.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Split libtspi to a trousers-lib subpackage (#1225062)
- Fix FTBFS with current gcc (drop inline keyword when bogus)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- New upstream bug fix release- Fix crash when linking libgnutls and libmysqlclient (#1069079)
- Don't order tcsd after syslog.target (#1055198)- Minor spec cleanups- New upstream bug fix and license change release- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Remove +x bit from service file (#963916)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- New upstream bug fix release- Make daemon full RELRO- bz #836476 - Provide native systemd service- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- New upstream bug fix release- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- New upstream bug fix release- Fix paths in man pages, mark them as %doc -- fix BZ#676394- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fix init script to conform to Fedora guidelines
- Do not overuse macros- Fix issue freeing a data structure- New upstream bug fix release
- Upstream requested the tpm-emulator patch be dropped- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Do not overuse macros.
- Removed unnecessary file requirements on chkconfig, ldconfig and service,
  now requiring the initscripts and chkconfig packages.- Fix a typo in groupadd causing the %pre scriptlet to fail (resolves BZ#486155).- Fix FTBFS: added trousers-0.3.1-gcc44.patch- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- rebuild with new openssl- Bump release to avoid wrong tag in rawhide- Work around SELinux namespace pollution (#464037)
- Use SO_REUSEADDR
- Use TPM emulator if it's available and no hardware is- Use the uid/gid pair assigned to trousers from BZ#457593- Incorporated changes from the RHEL package which were done by Steve Grubb- Fix cast issue preventing successful build on ppc64 and x86_64- Fix for BZ #434267 and #440733. Patch authored by Debora Velarde- Autorebuild for GCC 4.3- Updated static rpm's comment line (too long)- Updated specfile for RHBZ#323441 comment #28- Updated specfile for RHBZ#323441 comment #22- Updated to include the include dirs in the devel package;
added the no-install-hooks patch- Updated specfile for RHBZ#323441 comment #13- Updated specfile for comments in RHBZ#323441- Updated build section to use smp_mflags
- Removed .la file from installed dest and files section- Initial add of changelog tag for trousers CVS/bin/sh/bin/sh/bin/sh/bin/sh	
0.3.15-2.el80.3.15-2.el80.3.15-2.el8	
tcsd.conf.build-id0dbc815834d8966763d592edfdca1306117b0277tcsd.servicetcsdtrousersChangeLogREADMEtcsd.conf.5.gztcsd.8.gztpm/etc//usr/lib//usr/lib/.build-id//usr/lib/.build-id/0d//usr/lib/systemd/system//usr/sbin//usr/share/doc//usr/share/doc/trousers//usr/share/man/man5//usr/share/man/man8//var/lib/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically link�x���������������������XA�(
��������h���$��������������������opt-1.pycmonitor_load.cpython-36.pycmonitor_net.cpython-36.opt-1.pycmonitor_net.cpython-36.pycrepository.cpython-36.opt-1.pycrepository.cpython-36.pycbase.pymonitor_disk.pymonitor_load.pymonitor_net.pyrepository.pypatterns.pyplugins__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycbase.cpython-36.opt-1.pycbase.cpython-36.pycdecorators.cpython-36.opt-1.pycdecorators.cpython-36.pycexceptions.cpython-36.opt-1.pycexceptions.cpython-36.pychotplug.cpython-36.opt-1.pychotplug.cpython-36.pycplugin_acpi.cpython-36.opt-1.pycplugin_acpi.cpython-36.pycplugin_audio.cpython-36.opt-1.pycplugin_audio.cpython-36.pycplugin_bootloader.cpython-36.opt-1.pycplugin_bootloader.cpython-36.pycplugin_cpu.cpython-36.opt-1.pycplugin_cpu.cpython-36.pycplugin_disk.cpython-36.opt-1.pycplugin_disk.cpython-36.pycplugin_eeepc_she.cpython-36.opt-1.pycplugin_eeepc_she.cpython-36.pycplugin_irqbalance.cpython-36.opt-1.pycplugin_irqbalance.cpython-36.pycplugin_modules.cpython-36.opt-1.pycplugin_modules.cpython-36.pycplugin_mounts.cpython-36.opt-1.pycplugin_mounts.cpython-36.pycplugin_net.cpython-36.opt-1.pycplugin_net.cpython-36.pycplugin_rtentsk.cpython-36.opt-1.pycplugin_rtentsk.cpython-36.pycplugin_scheduler.cpython-36.opt-1.pycplugin_scheduler.cpython-36.pycplugin_script.cpython-36.opt-1.pycplugin_script.cpython-36.pycplugin_scsi_host.cpython-36.opt-1.pycplugin_scsi_host.cpython-36.pycplugin_selinux.cpython-36.opt-1.pycplugin_selinux.cpython-36.pycplugin_service.cpython-36.opt-1.pycplugin_service.cpython-36.pycplugin_sysctl.cpython-36.opt-1.pycplugin_sysctl.cpython-36.pycplugin_sysfs.cpython-36.opt-1.pycplugin_sysfs.cpython-36.pycplugin_systemd.cpython-36.opt-1.pycplugin_systemd.cpython-36.pycplugin_uncore.cpython-36.opt-1.pycplugin_uncore.cpython-36.pycplugin_usb.cpython-36.opt-1.pycplugin_usb.cpython-36.pycplugin_video.cpython-36.opt-1.pycplugin_video.cpython-36.pycplugin_vm.cpython-36.opt-1.pycplugin_vm.cpython-36.pycrepository.cpython-36.opt-1.pycrepository.cpython-36.pycbase.pydecorators.pyexceptions.pyhotplug.pyinstance__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycfactory.cpython-36.opt-1.pycfactory.cpython-36.pycinstance.cpython-36.opt-1.pycinstance.cpython-36.pycfactory.pyinstance.pyplugin_acpi.pyplugin_audio.pyplugin_bootloader.pyplugin_cpu.pyplugin_disk.pyplugin_eeepc_she.pyplugin_irqbalance.pyplugin_modules.pyplugin_mounts.pyplugin_net.pyplugin_rtentsk.pyplugin_scheduler.pyplugin_script.pyplugin_scsi_host.pyplugin_selinux.pyplugin_service.pyplugin_sysctl.pyplugin_sysfs.pyplugin_systemd.pyplugin_uncore.pyplugin_usb.pyplugin_video.pyplugin_vm.pyrepository.pyppd__pycache__config.cpython-36.opt-1.pycconfig.cpython-36.pyccontroller.cpython-36.opt-1.pyccontroller.cpython-36.pycconfig.pycontroller.pydbus.confppd.conftuned-ppd.dbus.servicetuned-ppd.policytuned-ppd.serviceprofiles__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycexceptions.cpython-36.opt-1.pycexceptions.cpython-36.pycfactory.cpython-36.opt-1.pycfactory.cpython-36.pycloader.cpython-36.opt-1.pycloader.cpython-36.pyclocator.cpython-36.opt-1.pyclocator.cpython-36.pycmerger.cpython-36.opt-1.pycmerger.cpython-36.pycprofile.cpython-36.opt-1.pycprofile.cpython-36.pycunit.cpython-36.opt-1.pycunit.cpython-36.pycvariables.cpython-36.opt-1.pycvariables.cpython-36.pycexceptions.pyfactory.pyfunctions__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycbase.cpython-36.opt-1.pycbase.cpython-36.pycfunction_assertion.cpython-36.opt-1.pycfunction_assertion.cpython-36.pycfunction_assertion_non_equal.cpython-36.opt-1.pycfunction_assertion_non_equal.cpython-36.pycfunction_calc_isolated_cores.cpython-36.opt-1.pycfunction_calc_isolated_cores.cpython-36.pycfunction_check_net_queue_count.cpython-36.opt-1.pycfunction_check_net_queue_count.cpython-36.pycfunction_cpuinfo_check.cpython-36.opt-1.pycfunction_cpuinfo_check.cpython-36.pyc�x�������������p��������X4�(
H�
�~y�����$i����������������yxz�RaRJRIR9R6R;RR$RR!R RR5R	RYRFRDRHRRaRPRIR$RR#RR!R RRHRFRORRaRJRIRR#R$RR!R RRHRRaR6RLRJRIRRR$R!R RRHR5R	RYRFRDRRaRRRRR$RR!R RRRRaR R!RRRaRRRR R!RRQRRaR$RRR!RR RR<R=R7R9R8R;R6R5R	RYRDRFRRaR6R;R!R RR5R	RYRFRDRRaRRR$R!R RRRaRR$RR!R RRFRRaRIRR$RRR!R RRHRRaR R!RRRaR R!RRRaR R!RRRaR RRRaRWRUR#R!RR RRDRVRTRRaRR$RR!R RRRaR R!RRRaRR$RR!R RR&RRaR R!RRRaRRR$RR!R RRQRRaRWRCRARRR#R!R RR@RBRVRRaRR#R$RR!R RRRaR R!RRQRRaRRR!RR RR<R=R7R:R9R8R;R6R5R	RYRFRDRRaRR$R!R RRRaRR!R RRRaR R!RR[RZRYRRaRZRJRIRR$RR!R RRYRHRRaRRR$RR!R RRRaRIRR$RR!R RRHRRaR$RRR!RR RRaRR R$R!RRRaRR$RR!R RRRaR%R"RRR$RRR!R RRRaRR$RR!RR RRDRRaRRRR$R#R!R RR
RRRR
R	RYRRaRRRR$R#R!R RRRaRRRR$R#R!R RRRaR6R;RRR$R!R RRKRIR-R0R+RHR*R5R	RYRFRDR?RQRRaRR#R!R"R RRRaRR#R!R RRRaRR$RR!R RRRaRR$R#RR!R RRRaRIRRR$R#R!R RRR-R/R,R0R.R1R+R*R	RYRHRQRRaRR RR	RYRRaR
RRRRR$R#R!RR RR7R8R;R6R5R	RFRYRDRRaRR$R#RR!R RR\RRaRRRR$R#R!R RRRaR R!RRRaR8R<R;R6R9RRRR$R#R!R RR5R	RYRFRDRRaR3R$RRR!R RR2RRRaRR$RR!R RRRaRJRIRRRR$R#R!R RRHRRaR R$R!RRRaRR$RR!R RR\RRaRRRR$R#R!R RRRaRRRRZRRRR$R#R!R RRYR	RFRRaR R!RRRaRIR
R
RRRRRRRR$R#R!R RR	RYRHRRaR RRRaR R!RRRaRRRR$R#R!R RRRaRJRIRRR#R$RR!R RRHRRaRR$RR!R RRRaRWRCRARRR#R!R RR@RBRVRRaRIRRRR$R#R!R RR-R.R/R,R0R+R*R	RYRHRQRRaR(RRRR$R!R RR'RFRRaRZRRR R!RR	RYRRaR
RRR R!RR8R9R;R6R5R	RFRDRYRRaRRRIRR$R#RR!R RR7R8R9R;R6R	R5RYRFRDRHRRaR!R RRRaRRR
RRRRJRIRR$R#RR!R RR	RYRHRRaRIRRRR$R#R!R RRHRRautf-8e960c4b3ea942cc136ae5b87ac0597bad5f894570eeb8678b0bb65ac8b26ee17?����'�<�3!�^���P,��*����%�f�

	*����%�-3�3@�\He��N³6�s� ��v�PD�ɚ�2��T���-��PZoԇ%ǼLf��9B��Z�z�?�<�c@"�Pmz#$8;⯙��)�)�<n�tW�*��m%�
zx������U2��Zߟr>��]����-�&#l"���/�q:�O+��ҽ���BQ�9�
Z�1�m���A��W1�#�&���l���o8���VW�E�P��s�W���@;����;�4p܋e�Ў��ҍ��Q���PԎ]����:j2�����_����D����Dk_N\+3�Xh{�s�vM�3������1Uze&!/��@�`�8���������Eư��5Q][�K����c~b��Z�����O��K7h]��]���
���Z�X���F�N��<�2��#�)�,b�h�	\)���=�D|���P��G��}t7�{�;��H7��%�J�\58��� "C�<��!>bC�ͩ3�p����TT);���>�H�xBv�@��"P��]4p0:�Ŵ��7��"��z���3!�^���P,��*����%�f�

	*����%���9`���(S�x����������������������X��(
��������73Y�$#����������������3Y4Y2Y�STRING.3ssl.gzi2d_DISPLAYTEXT.3ssl.gzi2d_DIST_POINT.3ssl.gzi2d_DIST_POINT_NAME.3ssl.gzi2d_DSAPrivateKey.3ssl.gzi2d_DSAPrivateKey_bio.3ssl.gzi2d_DSAPrivateKey_fp.3ssl.gzi2d_DSAPublicKey.3ssl.gzi2d_DSA_PUBKEY.3ssl.gzi2d_DSA_PUBKEY_bio.3ssl.gzi2d_DSA_PUBKEY_fp.3ssl.gzi2d_DSA_SIG.3ssl.gzi2d_DSAparams.3ssl.gzi2d_ECDSA_SIG.3ssl.gzi2d_ECPKParameters.3ssl.gzi2d_ECParameters.3ssl.gzi2d_ECPrivateKey.3ssl.gzi2d_ECPrivateKey_bio.3ssl.gzi2d_ECPrivateKey_fp.3ssl.gzi2d_EC_PUBKEY.3ssl.gzi2d_EC_PUBKEY_bio.3ssl.gzi2d_EC_PUBKEY_fp.3ssl.gzi2d_EDIPARTYNAME.3ssl.gzi2d_ESS_CERT_ID.3ssl.gzi2d_ESS_ISSUER_SERIAL.3ssl.gzi2d_ESS_SIGNING_CERT.3ssl.gzi2d_EXTENDED_KEY_USAGE.3ssl.gzi2d_GENERAL_NAME.3ssl.gzi2d_GENERAL_NAMES.3ssl.gzi2d_IPAddressChoice.3ssl.gzi2d_IPAddressFamily.3ssl.gzi2d_IPAddressOrRange.3ssl.gzi2d_IPAddressRange.3ssl.gzi2d_ISSUING_DIST_POINT.3ssl.gzi2d_NAMING_AUTHORITY.3ssl.gzi2d_NETSCAPE_CERT_SEQUENCE.3ssl.gzi2d_NETSCAPE_SPKAC.3ssl.gzi2d_NETSCAPE_SPKI.3ssl.gzi2d_NOTICEREF.3ssl.gzi2d_OCSP_BASICRESP.3ssl.gzi2d_OCSP_CERTID.3ssl.gzi2d_OCSP_CERTSTATUS.3ssl.gzi2d_OCSP_CRLID.3ssl.gzi2d_OCSP_ONEREQ.3ssl.gzi2d_OCSP_REQINFO.3ssl.gzi2d_OCSP_REQUEST.3ssl.gzi2d_OCSP_RESPBYTES.3ssl.gzi2d_OCSP_RESPDATA.3ssl.gzi2d_OCSP_RESPID.3ssl.gzi2d_OCSP_RESPONSE.3ssl.gzi2d_OCSP_REVOKEDINFO.3ssl.gzi2d_OCSP_SERVICELOC.3ssl.gzi2d_OCSP_SIGNATURE.3ssl.gzi2d_OCSP_SINGLERESP.3ssl.gzi2d_OTHERNAME.3ssl.gzi2d_PBE2PARAM.3ssl.gzi2d_PBEPARAM.3ssl.gzi2d_PBKDF2PARAM.3ssl.gzi2d_PKCS12.3ssl.gzi2d_PKCS12_BAGS.3ssl.gzi2d_PKCS12_MAC_DATA.3ssl.gzi2d_PKCS12_SAFEBAG.3ssl.gzi2d_PKCS12_bio.3ssl.gzi2d_PKCS12_fp.3ssl.gzi2d_PKCS7.3ssl.gzi2d_PKCS7_DIGEST.3ssl.gzi2d_PKCS7_ENCRYPT.3ssl.gzi2d_PKCS7_ENC_CONTENT.3ssl.gzi2d_PKCS7_ENVELOPE.3ssl.gzi2d_PKCS7_ISSUER_AND_SERIAL.3ssl.gzi2d_PKCS7_NDEF.3ssl.gzi2d_PKCS7_RECIP_INFO.3ssl.gzi2d_PKCS7_SIGNED.3ssl.gzi2d_PKCS7_SIGNER_INFO.3ssl.gzi2d_PKCS7_SIGN_ENVELOPE.3ssl.gzi2d_PKCS7_bio.3ssl.gzi2d_PKCS7_bio_stream.3ssl.gzi2d_PKCS7_fp.3ssl.gzi2d_PKCS8PrivateKeyInfo_bio.3ssl.gzi2d_PKCS8PrivateKeyInfo_fp.3ssl.gzi2d_PKCS8PrivateKey_bio.3ssl.gzi2d_PKCS8PrivateKey_fp.3ssl.gzi2d_PKCS8PrivateKey_nid_bio.3ssl.gzi2d_PKCS8PrivateKey_nid_fp.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO_bio.3ssl.gzi2d_PKCS8_PRIV_KEY_INFO_fp.3ssl.gzi2d_PKCS8_bio.3ssl.gzi2d_PKCS8_fp.3ssl.gzi2d_PKEY_USAGE_PERIOD.3ssl.gzi2d_POLICYINFO.3ssl.gzi2d_POLICYQUALINFO.3ssl.gzi2d_PROFESSION_INFO.3ssl.gzi2d_PROXY_CERT_INFO_EXTENSION.3ssl.gzi2d_PROXY_POLICY.3ssl.gzi2d_PUBKEY.3ssl.gzi2d_PUBKEY_bio.3ssl.gzi2d_PUBKEY_fp.3ssl.gzi2d_PrivateKey.3ssl.gzi2d_PublicKey.3ssl.gzi2d_RSAPrivateKey.3ssl.gzi2d_RSAPrivateKey_bio.3ssl.gzi2d_RSAPrivateKey_fp.3ssl.gzi2d_RSAPublicKey.3ssl.gzi2d_RSAPublicKey_bio.3ssl.gzi2d_RSAPublicKey_fp.3ssl.gzi2d_RSA_OAEP_PARAMS.3ssl.gzi2d_RSA_PSS_PARAMS.3ssl.gzi2d_RSA_PUBKEY.3ssl.gzi2d_RSA_PUBKEY_bio.3ssl.gzi2d_RSA_PUBKEY_fp.3ssl.gzi2d_SCRYPT_PARAMS.3ssl.gzi2d_SCT_LIST.3ssl.gzi2d_SSL_SESSION.3ssl.gzi2d_SXNET.3ssl.gzi2d_SXNETID.3ssl.gzi2d_TS_ACCURACY.3ssl.gzi2d_TS_MSG_IMPRINT.3ssl.gzi2d_TS_MSG_IMPRINT_bio.3ssl.gzi2d_TS_MSG_IMPRINT_fp.3ssl.gzi2d_TS_REQ.3ssl.gzi2d_TS_REQ_bio.3ssl.gzi2d_TS_REQ_fp.3ssl.gzi2d_TS_RESP.3ssl.gzi2d_TS_RESP_bio.3ssl.gzi2d_TS_RESP_fp.3ssl.gzi2d_TS_STATUS_INFO.3ssl.gzi2d_TS_TST_INFO.3ssl.gzi2d_TS_TST_INFO_bio.3ssl.gzi2d_TS_TST_INFO_fp.3ssl.gzi2d_USERNOTICE.3ssl.gzi2d_X509.3ssl.gzi2d_X509_ALGOR.3ssl.gzi2d_X509_ALGORS.3ssl.gzi2d_X509_ATTRIBUTE.3ssl.gzi2d_X509_AUX.3ssl.gzi2d_X509_CERT_AUX.3ssl.gzi2d_X509_CINF.3ssl.gzi2d_X509_CRL.3ssl.gzi2d_X509_CRL_INFO.3ssl.gzi2d_X509_CRL_bio.3ssl.gzi2d_X509_CRL_fp.3ssl.gzi2d_X509_EXTENSION.3ssl.gzi2d_X509_EXTENSIONS.3ssl.gzi2d_X509_NAME.3ssl.gzi2d_X509_NAME_ENTRY.3ssl.gzi2d_X509_PUBKEY.3ssl.gzi2d_X509_REQ.3ssl.gzi2d_X509_REQ_INFO.3ssl.gzi2d_X509_REQ_bio.3ssl.gzi2d_X509_REQ_fp.3ssl.gzi2d_X509_REVOKED.3ssl.gzi2d_X509_SIG.3ssl.gzi2d_X509_VAL.3ssl.gzi2d_re_X509_CRL_tbs.3ssl.gzi2d_re_X509_REQ_tbs.3ssl.gzi2d_re_X509_tbs.3ssl.gzi2o_SCT.3ssl.gzix�����X�������0|������NNN����������������� X�`	������������������������C.&�������������������Providename@x����������������z������@��������������Pz�������X	��(
�^��������w!�$g����������������w!v!x!�Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.0-281Petr Pisar <ppisar@redhat.com> - 4:5.16.3-280Petr Pisar <ppisar@redhat.com> - 4:5.16.3-279Petr Pisar <ppisar@redhat.com> - 4:5.16.3-278Petr Pisar <ppisar@redhat.com> - 4:5.16.3-277Petr Pisar <ppisar@redhat.com> - 4:5.16.3-276Petr Pisar <ppisar@redhat.com> - 4:5.16.3-275Petr Pisar <ppisar@redhat.com> - 4:5.16.3-274Petr Pisar <ppisar@redhat.com> - 4:5.16.3-273Petr Pisar <ppisar@redhat.com> - 4:5.16.3-272Petr Pisar <ppisar@redhat.com> - 4:5.16.3-271Petr Pisar <ppisar@redhat.com> - 4:5.16.3-270Petr Pisar <ppisar@redhat.com> - 4:5.16.3-269Petr Pisar <ppisar@redhat.com> - 4:5.16.3-268Petr Pisar <ppisar@redhat.com> - 4:5.16.3-267Petr Pisar <ppisar@redhat.com> - 4:5.16.3-266Petr Pisar <ppisar@redhat.com> - 4:5.16.3-265Petr Pisar <ppisar@redhat.com> - 4:5.16.3-264Petr Pisar <ppisar@redhat.com> - 4:5.16.3-263Petr Pisar <ppisar@redhat.com> - 4:5.16.3-262Petr Pisar <ppisar@redhat.com> - 4:5.16.3-261Petr Pisar <ppisar@redhat.com> - 4:5.16.2-260Petr Pisar <ppisar@redhat.com> - 4:5.16.2-259Petr Pisar <ppisar@redhat.com> - 4:5.16.2-258Petr Pisar <ppisar@redhat.com> - 4:5.16.2-257Petr Pisar <ppisar@redhat.com> - 4:5.16.2-256Petr Pisar <ppisar@redhat.com> - 4:5.16.2-255Petr Pisar <ppisar@redhat.com> - 4:5.16.2-254Petr Pisar <ppisar@redhat.com> - 4:5.16.2-253Petr Pisar <ppisar@redhat.com> - 4:5.16.2-252Petr Pisar <ppisar@redhat.com> - 4:5.16.2-251Petr Pisar <ppisar@redhat.com> - 4:5.16.2-250Petr Pisar <ppisar@redhat.com> - 4:5.16.2-249Petr Pisar <ppisar@redhat.com> - 4:5.16.2-248Petr Pisar <ppisar@redhat.com> - 4:5.16.2-247Petr Pisar <ppisar@redhat.com> - 4:5.16.2-246Petr Pisar <ppisar@redhat.com> - 4:5.16.2-245Petr Pisar <ppisar@redhat.com> - 4:5.16.2-244Petr Pisar <ppisar@redhat.com> - 4:5.16.2-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.2-242Petr Pisar <ppisar@redhat.com> - 4:5.16.1-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.1-240Petr Pisar <ppisar@redhat.com> - 4:5.16.1-239Petr Pisar <ppisar@redhat.com> - 4:5.16.1-238Petr Pisar <ppisar@redhat.com> - 4:5.16.1-237Petr Pisar <ppisar@redhat.com> - 4:5.16.1-236Petr Pisar <ppisar@redhat.com> - 4:5.16.1-235Petr Pisar <ppisar@redhat.com> - 4:5.16.1-234Petr Pisar <ppisar@redhat.com> - 4:5.16.1-233Petr Pisar <ppisar@redhat.com> - 4:5.16.1-232Petr Pisar <ppisar@redhat.com> - 4:5.16.1-231Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-230Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-229Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.1-228Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.16.0-227Paul Howarth <paul@city-fan.org> 4:5.16.0-226Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.0-225Petr Pisar <ppisar@redhat.com> - 4:5.16.0-224Petr Pisar <ppisar@redhat.com> - 4:5.16.0-223Petr Pisar <ppisar@redhat.com> - 4:5.16.0-222Petr Pisar <ppisar@redhat.com> - 4:5.16.0-221Petr Pisar <ppisar@redhat.com> - 4:5.16.0-220Petr Pisar <ppisar@redhat.com> - 4:5.16.0-219Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.0-218Petr Pisar <ppisar@redhat.com> - 4:5.16.0-218Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-217Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-RC2-217Petr Pisar <ppisar@redhat.com> - 4:5.14.2-216Petr Pisar <ppisar@redhat.com> - 4:5.14.2-215Petr Pisar <ppisar@redhat.com> - 4:5.14.2-214Petr Pisar <ppisar@redhat.com> - 4:5.14.2-213Petr Pisar <ppisar@redhat.com> - 4:5.14.2-212Petr Pisar <ppisar@redhat.com> - 4:5.14.2-211Paul Howarth <paul@city-fan.org> - 4:5.14.2-210Iain Arnell <iarnell@gmail.com> -4:5.14.2-209Paul Howarth <paul@city-fan.org> - 4:5.14.2-208Petr Pisar <ppisar@redhat.com> - 4:5.14.2-207Petr Pisar <ppisar@redhat.com> - 4:5.14.2-206Petr Pisar <ppisar@redhat.com> - 4:5.14.2-205Ville Skyttä <ville.skytta@iki.fi> - 4:5.14.2-204Petr Pisar <ppisar@redhat.com> - 4:5.14.2-203Petr Pisar <ppisar@redhat.com> - 4:5.14.2-202Petr Pisar <ppisar@redhat.com> - 4:5.14.2-201Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-200Petr Pisar <ppisar@redhat.com> - 4:5.14.2-199Petr Pi�x�������������j�������X
ݜ(
�@�������N��$^����������������N�O�M��/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�3e988a918be8ddd0289b7a9d0e0a130f0bd68e7ff98881145b527cc4a0e8297b3e988a918be8ddd0289b7a9d0e0a130f0bd68e7ff98881145b527cc4a0e8297b24ade0e65ef1b3ac9a43fb272b3ae5b1c8668ddd1f0eddb30fb2a5fc4f4289c0319f2374f99145ec96cdd0d9b508766ea6eba7e804a1f1f35e22f4e0ab227ceb243f0d9554a5cae051ed2678441b8ece4420afce0e16bf075ca45f8bb13453073bcb33adc642fda10bddc272a4b3bf0d447bbc3d2ba69fa4e901670cd31464bf5baf2d3875ff1d6c92b2e144fd757c8e56e21dab19b3faa2570ac53df159217ea9674c31c73b804c3cbfefb2ae387869f7b39e86af4dbae915b900c66649ef4bd5df27a880b6a95583fc942411666c91e5854abb9f866f5f3144f6ec65077c4909c5e2ee35ee18d9043d95273f1cd37bc82e80567fd1372a1eb134c809c39504f8733a3187a07951a542ee393a01e6cd74a66f58767de4d4c15ccdacff2ecc40af3d93fd39ac15dc187be68af9eef36fe60def865f628999da8bd894cc1211c102cce578326ffb0393234fd16f4d4d2ce62deec827a6e62454df27e5a2d3d22ad368f4970279a97a108268c6e8399977f6fe221ad34b31d753495ab9b6f9d99c2042fd2fc694a0e9e01c33007dcfd998abadfbd19d90c4a92f4898746650a11e29b1db7f52d761940ad4108122fb75c6be6fd260ed4a0d42b11d64d6b34164876a412dc9e7127247d33be22a7be4c915109770dbed47c6c368a192387967a82f8941dd9aad3f7eef4d813803005bdaa4d22dac9984c64da1acfb3b8759c1ba7600ccb4fff6e9b6aed9433cdbca27b6c560d974976fbb4d052b15841a2e6ad90889f0f212c8770d7f228b0baac725f330e3c449de8c67ecd456da4fe4c3134022387acf63e8458b3a74e73d76b9d13920618e02915764644ceb2b8a7861456305765cc5b8ee54b1be3a3181d2b23fc1d4fdceef50c0c4788ce99a62d28f5c98ef904bfbb5c47c28ed4df69d251e7d90318d7ac7c01179ba9de1a28660eb65c9a4ae2e21488091ab272522de6910158f06d32382aa89f75c84581d0ecaf5ea3eb1ab85471a807140aaca7ebb7016a9df26f28a2bbf3bc300fdafbcf0326581e064778488f657288470f14c6c4d421aeda7e970943c27c049830532d653bec3854b1746eab95926b59d351e1116c6f6a417f12f181d3493e27372a62a56bb33f43282fb2b55e7e8627c6b04e6109332e8418d5a9c163236e3c2a5e13c5cb85b523fce35f295b7d125d886e647b4416ffe59caff6eb4af4656ecf86dc1a61c18aa66e3fd2963a1b19c6a1b24327e16e459fbec9db7cea9f5331e097c3b884697b7a82824d3679b1719c4a66579e9ce114c665eaad2ff40b4f2514e34b794226ec8c68ea14d655372ddb30ffeec94aa14bbcb98cd051fb6c1956fca772e822bd4cc4e112be004e9a96a242f39955d3c7d561a8c308b9cfa63c77cded987d845fd6876992a918a4e8d2c2927b1bc8048837457cb6d15552438fcbf3b13286ce82e4ba31f86d2801601f1a01bfa1fa4f139aec07b928e9093920e8147e9f7f75aa491af9db0bea641ebf0b141893419866d356227a1ec5c88ea7a4e905988cbd7a4376930ac066c3ea52685889c50ec45f1921287f224ac277b9ad9440e0374b7627ab497f4c8f29caf6f1d924385406847e55bf72164a2ade71e5617471dc95a3f8d5635cfea97083d732e7a005b8392e2719�x��������������Y�������XC�(
p�0���$��������������������ib/python3.6/site-packages/tuned/daemon//usr/lib/python3.6/site-packages/tuned/daemon/__pycache__//usr/lib/python3.6/site-packages/tuned/exports//usr/lib/python3.6/site-packages/tuned/exports/__pycache__//usr/lib/python3.6/site-packages/tuned/hardware//usr/lib/python3.6/site-packages/tuned/hardware/__pycache__//usr/lib/python3.6/site-packages/tuned/monitors//usr/lib/python3.6/site-packages/tuned/monitors/__pycache__//usr/lib/python3.6/site-packages/tuned/plugins//usr/lib/python3.6/site-packages/tuned/plugins/__pycache__//usr/lib/python3.6/site-packages/tuned/plugins/instance//usr/lib/python3.6/site-packages/tuned/plugins/instance/__pycache__//usr/lib/python3.6/site-packages/tuned/ppd//usr/lib/python3.6/site-packages/tuned/ppd/__pycache__//usr/lib/python3.6/site-packages/tuned/profiles//usr/lib/python3.6/site-packages/tuned/profiles/__pycache__//usr/lib/python3.6/site-packages/tuned/profiles/functions//usr/lib/python3.6/site-packages/tuned/profiles/functions/__pycache__//usr/lib/python3.6/site-packages/tuned/storage//usr/lib/python3.6/site-packages/tuned/storage/__pycache__//usr/lib/python3.6/site-packages/tuned/units//usr/lib/python3.6/site-packages/tuned/units/__pycache__//usr/lib/python3.6/site-packages/tuned/utils//usr/lib/python3.6/site-packages/tuned/utils/__pycache__//usr/lib/systemd/system//usr/lib/tmpfiles.d//usr/lib//usr/lib/tuned//usr/lib/tuned/accelerator-performance//usr/lib/tuned/aws//usr/lib/tuned/balanced//usr/lib/tuned/desktop//usr/lib/tuned/epyc-eda//usr/lib/tuned/hpc-compute//usr/lib/tuned/intel-sst//usr/lib/tuned/latency-performance//usr/lib/tuned/network-latency//usr/lib/tuned/network-throughput//usr/lib/tuned/optimize-serial-console//usr/lib/tuned/powersave//usr/lib/tuned/recommend.d//usr/lib/tuned/throughput-performance//usr/lib/tuned/virtual-guest//usr/lib/tuned/virtual-host//usr/libexec//usr/libexec/tuned//usr/sbin//usr/share/bash-completion/completions//usr/share/dbus-1/system.d//usr/share/doc//usr/share/doc/tuned//usr/share/man/man5//usr/share/man/man7//usr/share/man/man8//usr/share/polkit-1/actions//usr/share//usr/share/tuned//usr/share/tuned/grub2//var/lib//var/log/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -march=z13 -mtune=z14 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz2noarch-redhat-linux-gnu�x�������������I�������X�J�(
30mgW�$w����������������gWfWedoraproject.org> - 0.3.0-1Fedora Release Engineering <releng@fedoraproject.org> - 0.2.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.2.0-2Jan Vcelak <jvcelak@fedoraproject.org> 0.2.0-1- Distribute also fstrm-utils (#2039889)- Apply coverity fixes also to bundled libmy- Update to 0.6.1 (#1922510)- Rebuild for gating- Move command line tools to utils subpackage- Rebuilt for libevent rebase- Update to new upstream version 0.6.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_32_Mass_Rebuild- Update to new upstream version 0.5.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Update to new upstream version 0.4.0 BZ#1577420- Update to new upstream version 0.3.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- new upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- initial package���0.6.1-3.el80.6.1-3.el8.build-id14b6069c5f0033645ac8524821abf7c3f02395c7libfstrm.so.0libfstrm.so.0.1.0fstrmCOPYRIGHTLICENSE/usr/lib//usr/lib/.build-id//usr/lib/.build-id/14//usr/lib64//usr/share/doc//usr/share/doc/fstrm/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=14b6069c5f0033645ac8524821abf7c3f02395c7, strippedASCII textPPPPRRRRRRRRRRutf-876f2a73e101c479657c846b19c5b07c4035b6ce819461f70269abc26edcc6beb?���@^���!�<���Q�d~���cC��
	Q�d~�����8��ڥ;\w�F��@
���XU`=����`u��
rm��C��3ú��[��cB�e9�ᘴW�a�j�}�/-(�ZC������I��q��6������3-�r8�j���K�*�/�ت�)|�LI�v��/�ΰ�ad~r�n%�m����
�W��la�w�Ġ�U�-[��@�3�k$SU��J�E�_�5���6�ޔ��d���)�SO�"
]|��Yɑ�/����Z��݊G��q�9���Ȭ�L��#��? s�Ё�q��y�c�n8h��7�27��TZ��T#~=\,��qՅ�Ru"ya�5��Z�^����4\�/�c�q����6l.R�N��MiE��^��6���?9?ϯ����;���R\ʆ�[���'���:����!�<��ΰ��Q�d~���cC��
	Q�d~��ꙁ�vj��`b8n$���෷N������vN�ӫN?��G�C���
I�X��e%��Wi��Y#g�����M�"/s��]w�1����֔�n'���4)Q�Y,"�hulȡ�Aڧ�]��S8�}����
�SzG�!���}ޮ��|���Q�3�H�	�a�j�3h���.����uF�j��+0f��r�.<��	�cf��[�)\Y�v)�Ĉ�VZ�QlCU��Oh{= ӗ��W�p����47�9��A Q��Z^ui��iŠ��nkR�I]i�:��r	��o�9��1`�Iŵ����R�Db� �l��d�Ǭ��4��/��yÅG3��+���Y�V?�B���� ����o�f��:�F�09da4d948461c2523b3d5247a1b43f3926023d9a28f5acd2d169e78b0da68db02df5ddab761266019521c64679883b78348b7e0af���Lf��ituous@gmail.com> - 265-1Cockpit Project <cockpituous@gmail.com> - 264-1Cockpit Project <cockpituous@gmail.com> - 263-1Cockpit Project <cockpituous@gmail.com> - 262-1Cockpit Project <cockpituous@gmail.com> - 261-1Fedora Release Engineering <releng@fedoraproject.org> - 260-2Martin Pitt <mpitt@redhat.com> - 260-1Marius Vollmer <mvollmer@redhat.com> - 259-1Allison Karlitskaya <allison.karlitskaya@redhat.com> - 258-1Katerina Koukiou <kkoukiou@redhat.com> - 25�x��������������8�������X��(
�!XR������H��$X����������������H�I�G��b9f92186e5cb50ff4b382411f0925d4f9787ddb01a555c02fc734f7c2c6359e6e91f4c5c4081fbbd667505dc4daef02b20b9eea97a37e282fbcb341edc3a7585bffdd003803a28440319cf5af68b2fe87dc594475e075555545aa8f5269ea5c54b726dc2ead417ff7a9a233dd38c338b4e63d558436f9a13e0837fcb9bd0e275ec5895cc67199189037dd2012128cc4d6c0a788f09303e02c51a2e136143c429753f5cd9bedd2442a5b11bec01da0bb1b819706f1a11a4cb2c2079543cc16c99118d68bbb8352ec259eb0af9a4c57de60e57fc3ca7f2f31bab9b6d848f0da99dd1f115eb1e8b20ee1342f73fba71fa8e41582256a64f4de420c1fd2ef6fb7d5ffeadafcd8a3419ffe4f53bd03a6842d96895b21d21d1ba822a6409a62c854c98f903c45d92aed0164d69a368fb9370daae360ad91e08df48aced4894a4fff9e5fd6fda8218b20f8d101bc409f02bf53a27c7e81c0b793946ee44d5d471828966c3b4709593eb8576984d66683b7f24415cf4a7552b20fa3b91e78a3f23b22ed536ad033bad1c77f77a06c4c3b572f4794a0e49172987f18139834889a79ad5bc11dc1370a2cd9e41ab9a1b83de595477aee2a6a80a3fb8dd2037c4625daf20f2a3e6d365da440c91369c7beeba581bb0a7610c66d2a1ee0fda0d17a7afab3ba9ff38efa0c8a47d080be3fd28a09b89f9d1c9d1b1c95e0a7d6a8ddb8682aea18822c5c5a3a907fd4334621e4eb5a0f388d887e2126d10749b191aa71843ced14a018acde9ca2095ad5382d90c88372377b55607a9a21d82bc610604de70b92de7bdc9962e89f1f031ac2505452645dfddca314dd3c7df2cfe81777a5f20a4b5966473b8f70027afb4f89bc5d634bc4d50ff33640d80e1003e02d15e22a8d18190f91cefd81f80e9455db3101d0a96eec3cb1036212a94ef8184bfae4924eea1a139158b481977cde628d7ac47a6df32bdc98e9d25b8e19dad9f0df7f8b7c2a253102df1172270672c5fe8f87ba286f898590ff61c5086e384485753db4322cc992e96487bb051b2fc371091da99793899e6710eedeee07da5cd3b9b291b50d9ed1e2ba2da501deb857b5896dbf43c969317718874b78f4711061e7930ca2520e2b692a530a39027596a5aadd58b13f5917debde2a0a44390c754554fd124b78d361283b91992c25fa0cfb0289b86b5f8a295bbbc19c5ed57a939eadd478a0b0b70ec70645e9fc475cc58d63c0d89c7627a6c91e98d891c089957876f5463da482cf8971fb3aa5e7fbf0b66e39dce425b70047fb3624f4a72e744ae9451f17cc03332d510ba4d7688dd87e713211f1fabec33dd3e779c63003b454a3236eff2053c27eb9daab11fe3d08d6107187be45023ce01b3d7a9f46f70259ef36704bcb7bc5e0e509155f5ba9bb033cc2310cf0fde82fca3f5434f965412dd982574c763225e0420e4d78cd03908e4471246415008add05873a15854d19406e5ff8ad4367ced13577e8b5e2725fe88051ae45489569c960b2e622d4c56bb11826966971958258fecd8dbf45138b0f532168816f682bac40ea81b0c4d11d0cd41418f694dd213e192458b176358842243339ef92b6ecd2d3d3e484487268223ab7380846df9ec69b683b108f2a870525f10cb2cba282c2ceddba415ee936934d3e6076f3e8619ee81c654d65e017b25a5f2b28fa862a48c354e5c3f93a88eb8416c63f074406ea50ce83f5606c05f85cf371e5ad8c3677cd438d5aacf96411bf6847cedda60ecbb1c09c1b52acb86eefdd139a303ea736c16f5395a89321ae7db62cd446968ac83a9b792ad75774a81a9bbe4a46b13df9e6282890b95151b2fa5a7fb33f33105625705db10440a4e0825fefea99c390eae4bce020c3ab39b297bba021157ed80c8d79309048de4d962e54a54fecba7daf444737c64954df5330c02a4fe588c7839ba987b3c8a08faca5400493b1f1fd8df7ca77b42804fc3b6e1a591f872f727d5eafcc7e186ef13e5e5a9b994f8c891c49f477b160b72cfeba21b84253201295166a088b8d489d04253b74c55e16246f55bbe4f00473e953148e29a02d3b208f213a2b9a9afe28a82d716ab3df9a439084db4c3df294409f349ed16a95f5723e1855a8a8ba2951f82d3f87b9137a4349b3ae7527e20b62d8b7bd34bf1ecb416a51d1a4e85814a75e21adc57b56a158d43d4d16d967e3d978eed4dce14bac0162d00208485ff84eeeb1540d20813891a04edee1d4fa399d4c622ed0d5a8fe06ce5af1257a4bfa5005e0d102eb9af030bfba0fc0ff6ea20e9fa9b470ffca448780d32a351bc87920bcbc0c25d4809efaa22896af8bfb31fc4a786b7bca77e6ebcb8574510283bfb99467ff39aa11dc9c7534329c5e8a0803ac7e3749f853fec724c84df26d84f0fd06fbce43e06bf706f942f1db7fa964eabc92c9f999f73536955c73b3718623d6886e7ca07129000bd6d70adbf3053fe7533881f6c07ea1e59eaa6bf77967078b3bbdb9789d1a2745ac6073189ab1b5b1071b4c90b00c401e354aeacbf9929111aabb2535813227527a45ca7462aaf14765c166e288905206c38413ab720622ad4e92ed7516cc1647be6d3da9a5d077487a9c00ce4dcabdd6785cfd7cda870bbf57732d6f9d2f9ab605e3edd8164555ab6f62197a2a7db8dcd5da77670784c88cebbdaf6a212b549e76a086dd34a9efc2b284566144d29a08c2ebe1a9ee0e97eaff90206fd99748fe50306ca316160cd9e6caa95dc2973fbb16171e3da6f0e3579a5d67656e041ce38c0f2517f6f4c006e998978ed817fa92c948a620da6fd53d93b86252cf2577db2aaad7�x��������������'�������Xd�(
�y��������d�$�����������������d�d�d�xyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopq�x�������������p�������X�(
���������
���$�����������������������- Add the continuous integration script (Radek Holy)
- Set proper charset on email in dnf-automatic (RhBug:1254982) (Valentina
  Mukhamedzhanova)
- doc: improve configuration description (RhBug:1261766) (Michal Luscon)
- remove: show from which repo a package is (Vladan Kudlac)
- list: show from which repo a package is (RhBug:1234491) (Vladan Kudlac)
- Spelling/grammar fixes (Ville Skyttä)
- install: fix crash when terminal window is small (RhBug:1256531) (Vladan
  Kudlac)
- install: mark unification of the progress bar (Vladan Kudlac)
- fix translations in python3 (RhBug:1254687) (Michal Luscon)
- group: CompsQuery now returns group ids (RhBug:1261656) (Michal Luscon)- fix access to demands (RhBug:1259194) (Jan Silhan)
- make clean_requiremets_on_remove=True (RhBug:1260280) (Jan Silhan)- Fixed typo (RhBug:1249319) (Adam Salih)
- fixed downgrade with wildcard (RhBug:1234763) (Adam Salih)
- reorganize logic of get_best_selector(s) and query (RhBug:1242946) (Adam
  Salih)
- completion_helper: don't crash if exception occurred (RhBug:1225225) (Igor
  Gnatenko)
- base: expire cache if repo is not available (Michal Luscon)
- Don't suggest --allowerasing if it is enabled (Christian Stadelmann)
- translation works in python3 (RhBug:1254687) (Jan Silhan)
- logrotate less often (RhBug:1247766) (Jan Silhan)
- implement dnf mark command (RhBug:1125925) (Michal Luscon)
- groups: use comps data to migrate persistor (Michal Luscon)
- groups: preserve api compatibility (Michal Luscon)
- groups: use persistor data for removing env/group (Michal Luscon)
- persistor: add migration and bump version (Michal Luscon)
- persistor: store name and ui_name of group (Michal Luscon)
- show real metadata timestamp on the server in verbose mode (Jan Silhan)
- lock: make rpmdb lock blocking (RhBug:1210289) (Michal Luscon)- update: installonly pkgs are not shown in both install and skipped section
  (RhBug:1252415) (Jan Silhan)
- output: sort skipped packages (Jan Silhan)
- output: skipped conflicts are set (RhBug:1252032) (Jan Silhan)
- keep the dwongrading package installed if transaction fails (RhBug:1249379)
  (Jan Silhan)
- don't store empty attributes (RhBug:1246928) (Michael Mraka)
- doc: correct dnf.conf man section (RhBug:1245349) (Michal Luscon)- print skipped pkg with broken deps too (Related:RhBug:1210445) (Jan Silhan)
- history: set commands output as default (RhBug:1218401) (Michal Luscon)
- Update es.po. save:guardar -> save:ahorrar (Máximo Castañeda)
- cosmetic: option arg in Base.*install is replaced with strict (Jan Silhan)
- group: don't fail on first non-existing group (Jan Silhan)
- install: skips local pkgs of lower version when strict=0
  (Related:RhBug:1227952) (Jan Silhan)
- install: skip broken/conflicting packages in groups when strict=0 (Jan
  Silhan)
- install: skip broken/conflicting packages when strict=0 (Jan Silhan)
- implemented `strict` config option working in install cmd (RhBug:1197456)
  (Jan Silhan)
- fixed 'dnf --quiet repolist' lack of output (RhBug:1236310) (Nick Coghlan)
- Add support for MIPS architecture (Michal Toman)
- package: respect baseurl attribute in localPkg() (RhBug:1219638) (Michal
  Luscon)
- Download error message is not written on the same line as progress bar
  anymore (RhBug: 1224248) (Adam Salih)
- dnf downgrade does not try to downgrade not installed packages (RhBug:
  1243501) (max9631)
- pkgs not installed due to rpm error are reported (RhBug:1207981) (Adam Salih)
- dnf install checks availability of all given packages (RhBug:1208918) (Adam
  Salih)
- implemented install_weak_deps config option (RhBug:1221635) (Jan Silhan)
- ignore SIGPIPE (RhBug:1236306) (Michael Mraka)
- always add LoggingTransactionDisplay to the list of transaction displays
  (RhBug:1234639) (Radek Holy)
- Add missing FILES section (RhBug: 1225237) (Adam Salih)
- doc: Add yum vs dnf hook information (RhBug:1244486) (Parag Nemade)
- doc: clarify the expected type of the do_transactions's display parameter
  (Radek Holy)
- apichange: add dnf.cli.demand.DemandSheet.transaction_display (Ra�x��������������X�(
��p��������$��������������������a@U�@T���T��T��@S�@S�@S�;@S��@S���S�~@SZN@SX��SE6@R��@R��@R�G@Ro�@Q��Q��@Q�*@Q�@Q�4�Q��Q��@Qb�@Qb�@Q�P6@P
<�P
<�P��P@O�;�OЗ�O��@O��O}�@Oy��Oi�Oi�O1@O*z�Jaroslav Rohel <jrohel@redhat.com> - 0.7.20-6Jaroslav Rohel <jrohel@redhat.com> - 0.7.20-5Nicola Sella <nsella@redhat.com> - 0.7.20-4Lukas Hrazky <lhrazky@redhat.com> - 0.7.20-3Lukas Hrazky <lhrazky@redhat.com> - 0.7.20-2Pavla Kratochvilova <pkratoch@redhat.com> - 0.7.20-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.19-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.17-2Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.17-1Nicola Sella <nsella@redhat.com> - 0.7.16-2Nicola Sella <nsella@redhat.com> - 0.7.16-1Ales Matej <amatej@redhat.org> - 0.7.11-1Ales Matej <amatej@redhat.org> - 0.7.7-1Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-3Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-2Pavla Kratochvilova <pkratoch@redhat.org> - 0.7.4-1Jaroslav Mracek <jmracek@redhat.com> - 0.6.35-6Jaroslav Mracek <jmracek@redhat.com> - 0.6.35-5Pavla Kratochvilova <pkratoch@redhat.org> - 0.6.35-4Jaroslav Mracek <jmracek@redhat.org> - 0.6.35-3Charalampos Stratakis <cstratak@redhat.com> - 0.6.34-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.34-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.33-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.32-1Fedora Release Engineering <releng@fedoraproject.org> - 0.6.31-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.31-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-9.git.2901.47fbaa2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-8.git.2900.8bdcce1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-7.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-6.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-5.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-4.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-3.git.2898.ae214a6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-3.git.2887.97b8c0cPanu Matilainen <pmatilai@redhat.com> - 0.6.30-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.30-1Panu Matilainen <pmatilai@redhat.com> - 0.6.29-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.29-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-8Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-7Igor Gnatenko <ignatenko@redhat.com> - 0.6.28-6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-5Fedora Release Engineering <releng@fedoraproject.org> - 0.6.28-4Fedora Release Engineering <releng@fedoraproject.org> - 0.6.28-3Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.28-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.27-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.27-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-5.git.20.668e249Neal Gompa <ngompa13@gmail.com> - 0.6.26-4.git.19.2262346Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-3.git.19.2262346Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-2Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.26-1Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.6.25-1Vít Ondruch <vondruch@redhat.com> - 0.6.24-4Charalampos Stratakis <cstratak@redhat.com> - 0.6.24-3Orion Poplawski <orion@cora.nwra.com> - 0.6.24-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.24-1Denis Ollier <larchunix@gmail.com> - 0.6.23-6Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-5Neal Gompa <ngompa13@gmail.com> - 0.6.23-4Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-3Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.23-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.22-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.22-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.22-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.21-3Igor Gnatenko <ignatenko@redhat.com> - 0.6.21-2Igor Gnatenko <ignatenko@redhat.c�x�������������P��������X�w�(
����
od�$����������������odpdnd�P_camellia_192_ctr.3ssl.gzEVP_camellia_192_ecb.3ssl.gzEVP_camellia_192_ofb.3ssl.gzEVP_camellia_256_cbc.3ssl.gzEVP_camellia_256_cfb.3ssl.gzEVP_camellia_256_cfb1.3ssl.gzEVP_camellia_256_cfb128.3ssl.gzEVP_camellia_256_cfb8.3ssl.gzEVP_camellia_256_ctr.3ssl.gzEVP_camellia_256_ecb.3ssl.gzEVP_camellia_256_ofb.3ssl.gzEVP_cast5_cbc.3ssl.gzEVP_cast5_cfb.3ssl.gzEVP_cast5_cfb64.3ssl.gzEVP_cast5_ecb.3ssl.gzEVP_cast5_ofb.3ssl.gzEVP_chacha20.3ssl.gzEVP_chacha20_poly1305.3ssl.gzEVP_cleanup.3ssl.gzEVP_des.3ssl.gzEVP_des_cbc.3ssl.gzEVP_des_cfb.3ssl.gzEVP_des_cfb1.3ssl.gzEVP_des_cfb64.3ssl.gzEVP_des_cfb8.3ssl.gzEVP_des_ecb.3ssl.gzEVP_des_ede.3ssl.gzEVP_des_ede3.3ssl.gzEVP_des_ede3_cbc.3ssl.gzEVP_des_ede3_cfb.3ssl.gzEVP_des_ede3_cfb1.3ssl.gzEVP_des_ede3_cfb64.3ssl.gzEVP_des_ede3_cfb8.3ssl.gzEVP_des_ede3_ecb.3ssl.gzEVP_des_ede3_ofb.3ssl.gzEVP_des_ede3_wrap.3ssl.gzEVP_des_ede_cbc.3ssl.gzEVP_des_ede_cfb.3ssl.gzEVP_des_ede_cfb64.3ssl.gzEVP_des_ede_ecb.3ssl.gzEVP_des_ede_ofb.3ssl.gzEVP_des_ofb.3ssl.gzEVP_desx_cbc.3ssl.gzEVP_enc_null.3ssl.gzEVP_get_cipherbyname.3ssl.gzEVP_get_cipherbynid.3ssl.gzEVP_get_cipherbyobj.3ssl.gzEVP_get_digestbyname.3ssl.gzEVP_get_digestbynid.3ssl.gzEVP_get_digestbyobj.3ssl.gzEVP_idea_cbc.3ssl.gzEVP_idea_cfb.3ssl.gzEVP_idea_cfb64.3ssl.gzEVP_idea_ecb.3ssl.gzEVP_idea_ofb.3ssl.gzEVP_md2.3ssl.gzEVP_md4.3ssl.gzEVP_md5.3ssl.gzEVP_md5_sha1.3ssl.gzEVP_md_null.3ssl.gzEVP_mdc2.3ssl.gzEVP_rc2_40_cbc.3ssl.gzEVP_rc2_64_cbc.3ssl.gzEVP_rc2_cbc.3ssl.gzEVP_rc2_cfb.3ssl.gzEVP_rc2_cfb64.3ssl.gzEVP_rc2_ecb.3ssl.gzEVP_rc2_ofb.3ssl.gzEVP_rc4.3ssl.gzEVP_rc4_40.3ssl.gzEVP_rc4_hmac_md5.3ssl.gzEVP_rc5_32_12_16_cbc.3ssl.gzEVP_rc5_32_12_16_cfb.3ssl.gzEVP_rc5_32_12_16_cfb64.3ssl.gzEVP_rc5_32_12_16_ecb.3ssl.gzEVP_rc5_32_12_16_ofb.3ssl.gzEVP_ripemd160.3ssl.gzEVP_seed_cbc.3ssl.gzEVP_seed_cfb.3ssl.gzEVP_seed_cfb128.3ssl.gzEVP_seed_ecb.3ssl.gzEVP_seed_ofb.3ssl.gzEVP_sha1.3ssl.gzEVP_sha224.3ssl.gzEVP_sha256.3ssl.gzEVP_sha384.3ssl.gzEVP_sha3_224.3ssl.gzEVP_sha3_256.3ssl.gzEVP_sha3_384.3ssl.gzEVP_sha3_512.3ssl.gzEVP_sha512.3ssl.gzEVP_sha512_224.3ssl.gzEVP_sha512_256.3ssl.gzEVP_shake128.3ssl.gzEVP_shake256.3ssl.gzEVP_sm3.3ssl.gzEVP_sm4_cbc.3ssl.gzEVP_sm4_cfb.3ssl.gzEVP_sm4_cfb128.3ssl.gzEVP_sm4_ctr.3ssl.gzEVP_sm4_ecb.3ssl.gzEVP_sm4_ofb.3ssl.gzEVP_whirlpool.3ssl.gzEXTENDED_KEY_USAGE_free.3ssl.gzEXTENDED_KEY_USAGE_new.3ssl.gzGENERAL_NAMES_free.3ssl.gzGENERAL_NAMES_new.3ssl.gzGENERAL_NAME_dup.3ssl.gzGENERAL_NAME_free.3ssl.gzGENERAL_NAME_new.3ssl.gzGENERAL_SUBTREE_free.3ssl.gzGENERAL_SUBTREE_new.3ssl.gzGEN_SESSION_CB.3ssl.gzHMAC.3ssl.gzHMAC_CTX_copy.3ssl.gzHMAC_CTX_free.3ssl.gzHMAC_CTX_get_md.3ssl.gzHMAC_CTX_new.3ssl.gzHMAC_CTX_reset.3ssl.gzHMAC_CTX_set_flags.3ssl.gzHMAC_Final.3ssl.gzHMAC_Init.3ssl.gzHMAC_Init_ex.3ssl.gzHMAC_Update.3ssl.gzHMAC_size.3ssl.gzIMPLEMENT_ASN1_FUNCTIONS.3ssl.gzIMPLEMENT_LHASH_COMP_FN.3ssl.gzIMPLEMENT_LHASH_HASH_FN.3ssl.gzIPAddressChoice_free.3ssl.gzIPAddressChoice_new.3ssl.gzIPAddressFamily_free.3ssl.gzIPAddressFamily_new.3ssl.gzIPAddressOrRange_free.3ssl.gzIPAddressOrRange_new.3ssl.gzIPAddressRange_free.3ssl.gzIPAddressRange_new.3ssl.gzISSUING_DIST_POINT_free.3ssl.gzISSUING_DIST_POINT_new.3ssl.gzLHASH.3ssl.gzLHASH_DOALL_ARG_FN_TYPE.3ssl.gzMD2.3ssl.gzMD2_Final.3ssl.gzMD2_Init.3ssl.gzMD2_Update.3ssl.gzMD4.3ssl.gzMD4_Final.3ssl.gzMD4_Init.3ssl.gzMD4_Update.3ssl.gzMD5.3ssl.gzMD5_Final.3ssl.gzMD5_Init.3ssl.gzMD5_Update.3ssl.gzMDC2.3ssl.gzMDC2_Final.3ssl.gzMDC2_Init.3ssl.gzMDC2_Update.3ssl.gzNAME_CONSTRAINTS_free.3ssl.gzNAME_CONSTRAINTS_new.3ssl.gzNAMING_AUTHORITY.3ssl.gzNAMING_AUTHORITY_free.3ssl.gzNAMING_AUTHORITY_get0_authorityId.3ssl.gzNAMING_AUTHORITY_get0_authorityText.3ssl.gzNAMING_AUTHORITY_get0_authorityURL.3ssl.gzNAMING_AUTHORITY_new.3ssl.gzNAMING_AUTHORITY_set0_authorityId.3ssl.gzNAMING_AUTHORITY_set0_authorityText.3ssl.gzNAMING_AUTHORITY_set0_authorityURL.3ssl.gzNETSCAPE_CERT_SEQUENCE_free.3ssl.gzNETSCAPE_CERT_SEQUENCE_new.3ssl.gzNETSCAP�x��������������������X��(
H���$Y��������������������ot.sedremove-potcdate.sinstylespo-default.csspo-emacs-x.csspo-emacs-xterm.csspo-emacs-xterm16.csspo-emacs-xterm256.csspo-vim.cssgettext.info.gzgettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-tools.mogettext-runtime.mogettext-runtime.mogettext-tools.moenvsubst.1.gzgettext.1.gzgettextize.1.gzmsgattrib.1.gzmsgcat.1.gzmsgcmp.1.gzmsgcomm.1.gzmsgconv.1.gzmsgen.1.gzmsgexec.1.gzmsgfilter.1.gzmsgfmt.1.gzmsggrep.1.gzmsginit.1.gzmsgmerge.1.gzmsgunfmt.1.gzmsguniq.1.gzngettext.1.gzrecode-sr-latin.1.gzxgettext.1.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/04//usr/lib/.build-id/07//usr/lib/.build-id/13//usr/lib/.build-id/1b//usr/lib/.build-id/24//usr/lib/.build-id/2b//usr/lib/.build-id/2e//usr/lib/.build-id/32//usr/lib/.build-id/3f//usr/lib/.build-id/42//usr/lib/.build-id/44//usr/lib/.build-id/4e//usr/lib/.build-id/53//usr/lib/.build-id/6d//usr/lib/.build-id/7e//usr/lib/.build-id/84//usr/lib/.build-id/8f//usr/lib/.build-id/c5//usr/lib/.build-id/cf//usr/lib/.build-id/f6//usr/lib64//usr/lib64/gettext//usr/share/doc//usr/share/doc/gettext//usr/share//usr/share//usr/share/gettext-0.19.8//usr/share/gettext-0.19.8/its//usr/share/gettext//usr/share/gettext/po//usr/share/gettext/styles//usr/share/info//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en@boldquot/LC_MESSAGES//usr/share/locale/en@quot/LC_MESSAGES//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_HK/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Werror=format-sec�x�������������@�������X
��(
�@�
�W�$j�����������������W�W�W��l <rvokal@redhat.com> - 1.60-69Radek Vokál <rvokal@redhat.com> - 1.60-68Radek Vokál <rvokal@redhat.com> - 1.60-67Radek Vokál <rvokal@redhat.com> - 1.60-66Radek Vokál <rvokal@redhat.com> - 1.60-65Radek Vokál <rvokal@redhat.com> - 1.60-64Radek Vokál <rvokal@redhat.com> - 1.60-63Jesse Keating <jkeating@redhat.com> - 1.60-62.1Radek Vokál <rvokal@redhat.com> - 1.60-62Jesse Keating <jkeating@redhat.com> - 1.60-61.1Radek Vokál <rvokal@redhat.com> 1.60-61Radek Vokal <rvokal@redhat.com> 1.60-60Radek Vokal <rvokal@redhat.com> 1.60-59Radek Vokal <rvokal@redhat.com> 1.60-58Jesse Keating <jkeating@redhat.com>Radek Vokal <rvokal@redhat.com> 1.60-57Radek Vokal <rvokal@redhat.com> 1.60-56Radek Vokal <rvokal@redhat.com> 1.60-55Radek Vokal <rvokal@redhat.com> 1.60-54Radek Vokal <rvokal@redhat.com> 1.60-53Radek Vokal <rvokal@redhat.com> 1.60-52Radek Vokal <rvokal@redhat.com> 1.60-51Radek Vokal <rvokal@redhat.com> 1.60-50Elliot Lee <sopwith@redhat.com>Radek Vokal <rvokal@redhat.com> 1.60-48Radek Vokal <rvokal@redhat.com> 1.60-47Radek Vokal <rvokal@redhat.com> 1.60-46Radek Vokal <rvokal@redhat.com> 1.60-45Radek Vokal <rvokal@redhat.com> 1.60-44Radek Vokal <rvokal@redhat.com> 1.60-43Radek Vokal <rvokal@redhat.com> 1.60-42Radek Vokal <rvokal@redhat.com> 1.60-41Radek Vokal <rvokal@redhat.com> 1.60-40Radek Vokal <rvokal@redhat.com> 1.60-39Radek Vokal <rvokal@redhat.com> 1.60-38Radek Vokal <rvokal@redhat.com> 1.60-37Radek Vokal <rvokal@redhat.com> 1.60-36Radek Vokal <rvokal@redhat.com> 1.60-35Radek Vokal <rvokal@redhat.com> 1.60-34Radek Vokal <rvokal@redhat.com> 1.60-33Phil Knirsch <pknirsch@redhat.com> 1.60-32Alan Cox <alan@redhat.com> 1.60-31Phil Knirsch <pknirsch@redhat.com> 1.60-30Phil Knirsch <pknirsch@redhat.com> 1.60-29Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-27Phil Knirsch <pknirsch@redhat.com> 1.60-26Phil Knirsch <pknirsch@redhat.com> 1.60-25Harald Hoyer <harald@redhat.com> - 1.60-24Karsten Hopp <karsten@redhat.de> 1.60-23 Phil Knirsch <pknirsch@redhat.com>Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-20.1Phil Knirsch <pknirsch@redhat.com> 1.60-20Phil Knirsch <pknirsch@redhat.com> 1.60-19.1Phil Knirsch <pknirsch@redhat.com> 1.60-19Phil Knirsch <pknirsch@redhat.com> 1.60-18.1Phil Knirsch <pknirsch@redhat.com> 1.60-18Elliot Lee <sopwith@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-16.1Phil Knirsch <pknirsch@redhat.com> 1.60-16Jeremy Katz <katzj@redhat.com> 1.60-15Phil Knirsch <pknirsch@redhat.com> 1.60-14Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com>Phil Knirsch <pknirsch@redhat.com> 1.60-13Phil Knirsch <pknirsch@redhat.com> 1.60-12Phil Knirsch <pknirsch@redhat.com> 1.60-11Tim Powers <timp@redhat.com> 1.60-10Phil Knirsch <pknirsch@redhat.com> 1.60-9Elliot Lee <sopwith@redhat.com> 1.60-8Phil Knirsch <pknirsch@redhat.com> Tim Powers <timp@redhat.com>Tim Powers <timp@redhat.com>Jeremy Katz <katzj@redhat.com>Bill Nottingham <notting@redhat.com>Preston Brown <pbrown@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Preston Brown <pbrown@redhat.com>Preston Brown <pbrown@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Crutcher Dunnavant <crutcher@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector <bugzilla@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>John Hardin <jhardin@wolfenet.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com> Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jakub Jelinek <jj@ultra.linux.cz>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Aron Griffis <agriffis@coat.com>Prospector System <bugs@redhat.com>Jason Spangler <jaso�x���������������������X�(
�8�j�$z����������������jik�(tweak raw.8 man page, make rawdevices.8 symlink).- remove kbdrate (fixes kbd conflict)- Add util-linux-2.11n-ownerumount.patch (#56593)
- Add patch102 (util-linux-2.11n-colrm.patch) to fix #51887
- Fix #53452 nits.
- Fix #56953 (remove tunelp on s390)
- Fix #56459, and in addition switch to using sed instead of perl.
- Fix #58471
- Fix #57300
- Fix #37436
- Fix #32132- Update to 2.11n
- Merge mount/losetup back in.- Add patch38 (util-linux-2.11f-ctty2.patch) to ignore SIGINT/SIGTERM/SIGQUIT in the parent, so that ^\ won't break things.- Merge patches 36, 75, 76, and 77 into patch #37, to attempt resolve all the remaining issues with #54741.- add nologin man-page for s390/s390x- Don't build kbdrate on s390/s390x
- Don't make the pivot_root.8 man page executable(!)- Patch/idea #76 from HJL, fixes bug #54741 (race condition in login 
acquisition of controlling terminal).- fix permissions problem with vipw & shadow files, again (doh!)- added patch from Olaf Kirch to fix possible pwent structure overwriting- fdisk patch from arjan- Don't include cfdisk, since it appears to be an even bigger pile of junk than fdisk? :)- don't require usermode- Incorporate kbdrate back in.- revert the patch that calls setsid() in login that we had reverted
  locally but got integrated upstream (#46223)- correct s390x patch- Add my megapatch (various bugs)
- Include pivot_root (#44828)- make shadow files 0400, not 0600- fix permissions problem with vipw & shadow files- update to 2.11f, remove any merged patches
- add s390x patches for somewhat larger swap- added --verbose patch to mkcramfs; it's much quieter by default now- removed warning about starting partitions on cylinder 0 -- swap version2
  makes it unnecessary- Fix up s390x support- Fix up login for real (a console session should be the controlling tty)
  by reverting to 2.10s code (#36839, #36840, #39237)
- Add man page for agetty (#39287)
- 2.11b, while at it- /sbin/nologin from OpenBSD added.- Fix up login - exiting immediately even if the password is correct
  is not exactly a nice feature.
- Make definite plans to kill people who update login without checking
  if the new version works ;)- upgraded to 2.11a (kbdrate moved to kbd, among other things)
- turned off ALLOW_VCS_USE
- modified mkcramfs to not use a large number of file descriptors
- include mkfs.bfs- changed Requires: kernel >= 2.2.12-7 to Conflicts: kernel < 2.2.12-7
  (fixes a initscripts -> util-linux -> kernel -> initscripts prereq loop)- patched mkcramfs to use the PAGE_SIZE from asm/page.h instead of hard
  coding 4096 (fixes mkcramfs on alpha...)- added mkcramfs (from linux/scripts/mkcramfs)- fixed bug #29131, where ipc.info didn't have an info dir entry,
  added the dir entry to ipc.texi (Patch58)- use lang finder script
- install info files- reverted login patch; seems to cause problems
- added agetty- updated kill man page
- added patch to fix vipw race
- updated vipw to edit /etc/shadow and /etc/gshadow, if appropriate
- added patch to disassociate login from tty, session, and pgrp- fixed problem w/ empty extended partitions
- added patch to fix the date in the more man page
- set OPT to pass optimization flags to make rather then RPM_OPT_FLAG
- fixed fdisk -l /Proc/partitions parsing
- updated to 2.10s- danish translations added- fix segfault in login in btmp patch (#24025)- ported to s390- update to 2.10p
- update patch37 to newer fdisk version- update to 2.10o
-  fdformat: fixed to work with kernel 2.4.0test6 (Marek Wojtowicz)
-  login: not installed suid
-  getopt: by default install aux files in /usr/share/misc
- update to 2.10n:
-  added blockdev.8
-  change to elvtune (andrea)
-  fixed overrun in agetty (vii@penguinpowered.com)
-  shutdown: prefer umounting by mount point (rgooch)
-  fdisk: added plan9
-  fdisk: remove empty links in chain of extended partitions
-  hwclock: handle both /dev/rtc and /dev/efirtc (Bill Nottingham)
-  script: added -f (flush) option (Ivan Schreter)
-  script: added -q (quiet) option (Per Andreas Buer)
-  getop�x�������������0��������X�(
��ȯ	cX�$s����������������cXbXdX�/lib/.build-id/3f//usr/lib/.build-id/50//usr/lib/.build-id/61//usr/lib/.build-id/6e//usr/lib/.build-id/72//usr/lib/.build-id/ae//usr/lib/.build-id/b8//usr/lib/.build-id/e0//usr/lib/.build-id/ee//usr/lib/systemd/system-generators//usr/lib/systemd/system//usr/libexec/selinux//usr/libexec/selinux/hll//usr/sbin//usr/share//usr/share/bash-completion/completions//usr/share/doc//usr/share/licenses//usr/share/licenses/policycoreutils//usr/share/locale/af/LC_MESSAGES//usr/share/locale/am/LC_MESSAGES//usr/share/locale/ar/LC_MESSAGES//usr/share/locale/as/LC_MESSAGES//usr/share/locale/bal/LC_MESSAGES//usr/share/locale/be/LC_MESSAGES//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bn/LC_MESSAGES//usr/share/locale/bn_IN/LC_MESSAGES//usr/share/locale/br/LC_MESSAGES//usr/share/locale/bs/LC_MESSAGES//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cy/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/de_CH/LC_MESSAGES//usr/share/locale/el/LC_MESSAGES//usr/share/locale/en_GB/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fa/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gu/LC_MESSAGES//usr/share/locale/he/LC_MESSAGES//usr/share/locale/hi/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/ia/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/ilo/LC_MESSAGES//usr/share/locale/is/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ka/LC_MESSAGES//usr/share/locale/kk/LC_MESSAGES//usr/share/locale/km/LC_MESSAGES//usr/share/locale/kn/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lv/LC_MESSAGES//usr/share/locale/mai/LC_MESSAGES//usr/share/locale/mk/LC_MESSAGES//usr/share/locale/ml/LC_MESSAGES//usr/share/locale/mr/LC_MESSAGES//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nds/LC_MESSAGES//usr/share/locale/ne/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nn/LC_MESSAGES//usr/share/locale/nso/LC_MESSAGES//usr/share/locale/or/LC_MESSAGES//usr/share/locale/pa/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/si/LC_MESSAGES//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sq/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sr@latin/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/ta/LC_MESSAGES//usr/share/locale/te/LC_MESSAGES//usr/share/locale/tg/LC_MESSAGES//usr/share/locale/th/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/ur/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/locale/zu/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8//usr/share/man/ru/man1//usr/share/man/ru/man5//usr/share/man/ru/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x����������������������Xڜ(
����������������Q��$A����������������Q�P��K(t?�d����(�	,�	S�����������Z�	���������\�	��
!��0����
���
����220�@��L[Mp[T'[(T�8T��9[�:���BO�GO��H^D�Il��Xp��Yr��Zu�[u�\u��]�p�^���b��d�Ce�Hf�Kl�Mt�h�u��v�)w�x�x�y���p�t�z����6"
"6
$P$y�$�$��(hg(lh(pCperl-interpreter5.26.3423.el8_10Standalone executable Perl interpreterThis is a Perl interpreter as a standalone executable /usr/bin/perl
required for handling Perl scripts. It does not provide all the other Perl
modules or tools.

Install this package if you want to program in Perl or enable your system to
handle Perl scripts with /usr/bin/perl interpreter.

If your script requires some Perl modules, you can install them with
"perl(MODULE)" where "MODULE" is a name of required module. E.g. install
"perl(Test::More)" to make Test::More Perl module available.

If you need all the Perl modules that come with upstream Perl sources, so
called core modules, install perl package.

If you only need perl run-time as a shared library, i.e. Perl interpreter
embedded into another application, the only essential package is perl-libs.

Perl header files can be found in perl-devel package.

Perl utils like "splain" or "perlbug" can be found in perl-utils package.h�02x64-builder03.almalinux.org۴DAlmaLinuxAlmaLinux(GPL+ or Artistic) and (GPLv2+ or Artistic) and BSD and Public Domain and UCDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.perl.org/linuxx86_641�1�?8A325<097/5698A84+6F:31'0;7042419:+:371)07122/84)92'23<z��^06~�y��Ob��:3[bt^�	�p	O>N���X�/
�
�rHD�M���!9��\]���L]^_^�u�cOB!a�^HP�8n�ON�>N�N�_H��nH>@>�^��8�>0^�>0^pi���<��m��yl��
����>3����/ck�'
+����,N�N	��������w0%�m5|<&v�u�'s�
56H0TVt >	��	�	�/
�V�US
d?kc�N����iP��X-ѧ�
����8���*h�s��`���g��"�S�J���n��� G�l�����*�[-��$F��<#���ntrN�$��h1�N�l9�*�B��#���(��v�<}rf�x��������������������X(ǚ(
��������@}������$w��������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcockpit-310.5-1.el8_10.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������bundled(npm(@patternfly/patternfly))bundled(npm(@patternfly/react-core))bundled(npm(@patternfly/react-icons))bundled(npm(@patternfly/react-styles))bundled(npm(@patternfly/react-table))bundled(npm(@patternfly/react-tokens))bundled(npm(argparse))bundled(npm(array-buffer-byte-length))bundled(npm(attr-accept))bundled(npm(autolinker))bundled(npm(available-t�x����������������������X�(
���������������8��$(����������������8�9�7��nell <iarnell@gmail.com> 4:5.14.1-173Paul Howarth <paul@city-fan.org> - 4:5.14.1-172Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-171Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-170Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-169Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-167Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-165Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-163Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-162Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-160Petr Pisar <ppisar@redhat.com> - 4:5.12.3-159Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-158Robin Lee <cheeselee@fedoraproject.org> - 4:5.12.3-157Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-156Iain Arnell <iarnell@gmail.com> 4:5.12.3-154Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.12.3-153Petr Pisar <ppisar@redhat.com> - 4:5.12.3-152Tom Callaway <spot@fedoraproject.org> - 4:5.12.3-151Petr Pisar <ppisar@redhat.com> - 4:5.12.3-150Lukas Berk <lberk@redhat.com> - 4:5.12.3-149Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-148Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-146Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-145Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-144Petr Pisar <ppisar@redhat.com> - 4:5.12.2-143Petr Pisar <ppisar@redhat.com> - 4:5.12.2-142Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-141Petr Pisar <ppisar@redhat.com> - 4:5.12.2-140Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-139Petr Pisar <ppisar@redhat.com> - 4:5.12.2-138Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-137Petr Pisar <ppisar@redhat.com> - 4:5.12.2-136Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-135Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-134Petr Pisar <ppisar@redhat.com> - 4:5.12.2-133Petr Sabata <psabata@redhat.com> - 5:5.12.2-132Petr Sabata <psabata@redhat.com> - 4:5.12.2-1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-131Petr Pisar <ppisar@redhat.com> - 4:5.12.1-130Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-129Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-128Dan Horák <dan[at]danny.cz> - 4:5.12.1-127Petr Pisar <ppisar@redhat.com> - 4:5.12.1-126Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-125Ralf Corsépius <corsepiu@fedoraproject.org> -  4:5.12.1-124Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-123Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-122Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-121Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-120-testMarcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119.1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-118Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-117Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-116Paul Howarth <paul@city-fan.org> - 4:5.10.1-115Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-114Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-112Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-111Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-110Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-109Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-107Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-106Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-105Stepan Kasal <skasal@redhat.com> - 4:5.10.1-104Stepan Kasal <skasal@redhat.com> - 4:5.10.1-103Stepan Kasal <skasal@redhat.com> - 4:5.10.1-102Stepan Kasal <skasal@redhat.com> - 4:5.10.1-101Stepan Kasal <skasal@redhat.com> - 4:5.10.1-100Stepan Kasal <skasal@redhat.com> - 4:5.10.0-87Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-86Stepan Kasal <skasal@redhat.com> - 4:5.10.0-85Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-84Stepan Kasal <skasal@redhat.com> - 4:5.10.0-83Chris Weyl <cweyl@�x�������������r�������X$�(
��������0m)U�$9����������������)U8�
���������������xsgbVQE@4/#
���������������ythcWRFA50$�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
z
u
i
d
X
S
G
B
6
1
%
 



���������������{vjeYTHC72&!���������������|wkfZUID83'"�
�
�
�
�
�
�
�
�
�
�
�
�
�
}
x
l
g
[
V
J
E
9
4
(
#




�	�	�	�	�	�	�	�	�	�	�	�	�	�	~	y	m	h	\	W	K	F	:	5	)	$					��������������zni]XLG;6*%���������������{oj^YMH<7+&	���������������|pk_ZNI=8,'
���������������}ql`[OJ>andling (rh #543088) (rh #560742)
- core: better handling of /etc/hosts if hostname was already added by the user
- applet: crash less on D-Bus property errors (rh #557007)
- applet: fix crash entering wired 802.1x connection details (rh #556763)- core: validate the autostart .desktop file
- build: fix nmcli for the stricter ld (fixes FTBFS)
- build: fix nm-connection-editor for the stricter ld (fixes FTBFS)
- applet: don't autostart in KDE on F13+ (#541353)- core: add Bluetooth Dial-Up Networking (DUN) support (rh #136663)
- core: start DHCPv6 on receipt of RA 'otherconf'/'managed' bits
- nmcli: allow enable/disable of WiFi and WWAN- ifcfg-rh: read and wri��L���L���L���L���L���L���L����(X�����g��o�Q�,-���p�6��o�h!�1��������d�(���N(�����1X�F���h.���W���A&�L]�����3�Aj���w�
ҐJ����A!����fW��
Ґ����A�=����U@���rEWi�
Ґu����A�d����r�V�>��A�������d���r�V,�����r���r������r�����,�&�����r�^�����<��,��������r0��X3��6���r'(9�M�������P��X3�n�����r�|��M�d������x�4��X3�����r���M�ŹH����a����X3�v0��T''�V��"����(y���X$��X3w�����?��X3��L9�����+��X3ԩt�����$��&ߢ`�����,L�p8�ˢ���P�Q2���p8�6��,�T''HU< ��P�%W����ed�Dn�T''1UT0���3������e�"���T''U������h#~T''�T�}���W|���T("y����x���T�*u��_,or���T��qjU|P��o�mts#X2n��=��n���D�@m���T<Dm�mt%#��j��$}j�ЖH�h�mt�"x�f��%f�Ж4 9d����$bBIx���a�ЖGH `����?^BIW�L�]���H��]���H3ZC�X����6VC$)Tn��gX4R���H<Rt��H7QC�.P���03Nt݄���IC�%�0H��T�>Ft�7�uEC�=�D�u���C�܋.�@RB��CT'BC�V�@�u,��-?�܋T:2>��*�;>t�%y(�=C�th <�܋*:�=:��`*:t�c���9��
()9C�}�8���?6t�(��5C�A4���|2t��4h1C��0�u*;</tݐ`-C`',��d��)C���&(��Q4%�(���$��t|G"��8 U!��c�H�W?
@��%���z�x�X�>� ������pQ���h��[���Y�t�
���G���h	��Hx��� ]��wx+�c�e�\;�͎B`8��ق�d*�x������Ha�������X	�(
����������������V�$�����������������VVV�ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b49d222b6badb99e2485f43943117291c1c3d9af, strippeddirectoryPerl5 module source textPerl POD document, ASCII textASCII textPerl5 module source, ASCII text, with very long linesELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6348c2486233cf8e50702aea59b737f7d32ac688, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2fc46f25fa2c9ce10bd177a351ff4ffcbc38df5e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0789a40331769143eac65087200fc9ee07673eca, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7f855b53e57aba52c5572d9fe81a2a129fcf1f2a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=20307d9d535d93a26fd5238cc181a63b187ed089, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0b93a2c0e77051df14d9030fd92d070d87536ff4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1192ff9fe30513a27467baeeb3ac4b0c46ade694, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=873bc4d23ab94b4f545cca420fece9674e3956a6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=983e0d728a343d4a89e31820e554b1f0aaa64842, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=afce3a4dbeaafaec2475b32e35d4ad37974526cc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b2295248594e0a59c9b04789c86a4ea61450db28, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c2a9c27a61d461d7d8abc060374f3d0cd93cbec3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ffc49ed5166a3a16af22eab118ab777a9455a009, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=44855f734112d8ff9b4e42fc4287d5bb6b018a2d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c95699abb089d63ec4395b9814f1d88b592740dd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ee4534ed175175d26b182e4de505564a26f85767, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=66c529abd1c3eb4d79a84be19a9d2be6f892f494, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3239efc797250ec716ad27df6214fa2581354112, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5036906a748b622a828c8f41a639395cd88c5d56, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ef3dbbac3ef6f3ff8d5fe2e8cb3050eb1fc1623d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1bc4cd0bba113258f0015fdceca91323141831bb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4576a7383cb0ff03607febebb22ed85e20c8cd93, strippedASCII text, with very long linestroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)awk or perl script, ASCII textAlgol 68 source, ASCII textPerl5 module source, ASCII textPerl POD document, ASCII text, with very long linesPerl POD document, UTF-8 Unicode textC source, ASCII textOS/2 REXX batch file, ASCII textPython script, ASCII text executable, with ve�x�������������Q�������X�(
���������a������=��$-����������������=�>�<������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������perl(AnyDBM_File)perl(AutoLoader)perl(AutoSplit)perl(B)perl(B::Concise)perl(B::Deparse)perl(B::OBJECT)perl(B::Op_private)perl(B::Showlex)perl(B::Terse)perl(B::Xref)perl(Benchmark)perl(Class::Struct)perl(Class::Struct::Tie_ISA)perl(Config)perl(Config::Extensions)perl(DB)perl(DBM_Filter)perl(DBM_Filter::compress)perl(DBM_Filter::encode)perl(DBM_Filter::int32)perl(DBM_Filter::null)perl(DBM_Filter::utf8)perl(DirHandle)perl(Dumpvalue)perl(DynaLoader)perl(EVERY::LAST)perl(English)perl(ExtUtils::Constant)perl(ExtUtils::Constant::Base)perl(ExtUtils::Constant::ProxySubs)perl(ExtUtils::Constant::Utils)perl(ExtUtils::Constant::XS)perl(Fcntl)perl(File::Basename)perl(File::Compare)perl(File::Copy)perl(File::DosGlob)perl(File::Find)perl(File::Glob)perl(File::stat)perl(FileCache)perl(FileHandle)perl(FindBin)perl(GDBM_File)perl(Getopt::Std)perl(Hash::Util)perl(Hash::Util::FieldHash)perl(I18N::Collate)perl(I18N::LangTags)perl(I18N::LangTags::Detect)perl(I18N::LangTags::List)perl(I18N::Langinfo)perl(IPC::Open2)perl(IPC::Open3)perl(NDBM_File)perl(NEXT)perl(NEXT::ACTUAL)perl(NEXT::ACTUAL::DISTINCT)perl(NEXT::ACTUAL::UNSEEN)perl(NEXT::DISTINCT)perl(NEXT::DISTINCT::ACTUAL)perl(NEXT::UNSEEN)perl(NEXT::UNSEEN::ACTUAL)perl(Net::hostent)perl(Net::netent)perl(Net::protoent)perl(Net::servent)perl(O)perl(ODBM_File)perl(Opcode)perl(POSIX)perl(POSIX::SigAction)perl(POSIX::SigRt)perl(POSIX::SigSet)perl(PerlIO)perl(PerlIO::encoding)perl(PerlIO::mmap)perl(PerlIO::scalar)perl(PerlIO::via)perl(Pod::Functions)perl(SDBM_File)perl(Safe)perl(Search::Dict)perl(SelectSaver)perl(Symbol)perl(Sys::Hostname)perl(Term::Complete)perl(Term::ReadLine)perl(Term::ReadLine::Stub)perl(Term::ReadLine::TermCap)perl(Term::ReadLine::Tk)perl(Text::Abbrev)perl(Thread)perl(Thread::Semaphore)perl(Tie::Array)perl(Tie::ExtraHash)perl(Tie::File)perl(Tie::File::Cache)perl(Tie::File::Heap)perl(Tie::Handle)perl(Tie::Hash)perl(Tie::Hash)perl(Tie::Hash::NamedCapture)perl(Tie::Memoize)perl(Tie::RefHash)perl(Tie::RefHash::Nestable)perl(Tie::Scalar)perl(Tie::StdA�x�������������x@�������X̜(
����������!�$�����������������!�!�!��������5.26.30.271.010.341.111.191.374:5.26.3-423.el8_104:5.26.3-423.el8_10	








 !"##########$%&'())))))))))))))*****+,,,,,,,,--------------------------------./01234555555555555555556666666666667777777777777777777778888888888888888899999::::::::::::::::::::;<==>>??@@AAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCDEEEEEEEEEEEEEEEEEEEEEEFGGGGGGGGGGGGHIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLMNOOOOOOOOOOOPQ.build-id622685f0db1f52fc83bfea6f0f78f27bafb41eb12d7ea2fd7cae12140a00da756abe0c14597flibperl.so.5.26libperl.so.5.26.3perl5CORElibperl.soautorere.sore.pmvendor_perlautoperl-libsAUTHORSChangesREADMEperl-libsArtisticCopyingXSLoader.3pm.gzinteger.3pm.gzre.3pm.gzstrict.3pm.gzutf8.3pm.gzwarnings.3pm.gzperl5XSLoader.pminteger.pmstrict.pmunicoreBlocks.txtCombiningClass.plDecomposition.plHeavy.plName.plName.pmNamedSequences.txtSpecialCasing.txtToAge.plBc.plBmg.plBpb.plBpt.plCf.plDigit.plEa.plFold.plGCB.plGc.plHst.plInPC.plInSC.plIsc.plJg.plJt.plLb.plLc.plLower.plNFCQC.plNFDQC.plNFKCCF.plNFKCQC.plNFKDQC.plNa1.plNameAlia.plNt.plNv.plPerlDeci.plSB.plSc.plScx.plTc.plTitle.plUc.plUpper.plWB.pl_PerlLB.pl_PerlWB.plUCD.pllibAgeNA.plV11.plV20.plV30.plV31.plV32.plV40.plV41.plV50.plV51.plV52.plV60.plV61.plV70.plV80.plV90.plAlphaY.plBcAL.plAN.plB.plBN.plCS.plEN.plES.plET.plL.plNSM.plON.plR.plWS.plBidiCY.plBidiMY.plBlkNB.plBptC.plN.plO.plCEY.plCIY.plCWCFY.plCWCMY.plCWKCFY.plCWLY.plCWTY.plCWUY.plCasedY.plCccA.plAR.plATAR.plB.plBR.plDB.plNK.plNR.plOV.plVR.plCompExY.plDIY.plDashY.plDepY.plDiaY.plDtCom.plEnc.plFin.plFont.plInit.plIso.plMed.plNar.plNb.plNonCanon.plSqr.plSub.plSup.plVert.plEaA.plH.plN.pl�x�����p��/�������Xx�(
h�������nd�$~����������������ndodmd�E_SPKAC_free.3ssl.gzNETSCAPE_SPKAC_new.3ssl.gzNETSCAPE_SPKI_free.3ssl.gzNETSCAPE_SPKI_new.3ssl.gzNOTICEREF_free.3ssl.gzNOTICEREF_new.3ssl.gzOBJ_cleanup.3ssl.gzOBJ_cmp.3ssl.gzOBJ_create.3ssl.gzOBJ_dup.3ssl.gzOBJ_get0_data.3ssl.gzOBJ_length.3ssl.gzOBJ_ln2nid.3ssl.gzOBJ_nid2ln.3ssl.gzOBJ_nid2obj.3ssl.gzOBJ_nid2sn.3ssl.gzOBJ_obj2nid.3ssl.gzOBJ_obj2txt.3ssl.gzOBJ_sn2nid.3ssl.gzOBJ_txt2nid.3ssl.gzOBJ_txt2obj.3ssl.gzOCSP_BASICRESP_free.3ssl.gzOCSP_BASICRESP_new.3ssl.gzOCSP_CERTID_dup.3ssl.gzOCSP_CERTID_free.3ssl.gzOCSP_CERTID_new.3ssl.gzOCSP_CERTSTATUS_free.3ssl.gzOCSP_CERTSTATUS_new.3ssl.gzOCSP_CRLID_free.3ssl.gzOCSP_CRLID_new.3ssl.gzOCSP_ONEREQ_free.3ssl.gzOCSP_ONEREQ_new.3ssl.gzOCSP_REQINFO_free.3ssl.gzOCSP_REQINFO_new.3ssl.gzOCSP_REQUEST_free.3ssl.gzOCSP_REQUEST_new.3ssl.gzOCSP_REQ_CTX_add1_header.3ssl.gzOCSP_REQ_CTX_free.3ssl.gzOCSP_REQ_CTX_i2d.3ssl.gzOCSP_REQ_CTX_set1_req.3ssl.gzOCSP_RESPBYTES_free.3ssl.gzOCSP_RESPBYTES_new.3ssl.gzOCSP_RESPDATA_free.3ssl.gzOCSP_RESPDATA_new.3ssl.gzOCSP_RESPID_free.3ssl.gzOCSP_RESPID_match.3ssl.gzOCSP_RESPID_new.3ssl.gzOCSP_RESPID_set_by_key.3ssl.gzOCSP_RESPID_set_by_name.3ssl.gzOCSP_RESPONSE_free.3ssl.gzOCSP_RESPONSE_new.3ssl.gzOCSP_REVOKEDINFO_free.3ssl.gzOCSP_REVOKEDINFO_new.3ssl.gzOCSP_SERVICELOC_free.3ssl.gzOCSP_SERVICELOC_new.3ssl.gzOCSP_SIGNATURE_free.3ssl.gzOCSP_SIGNATURE_new.3ssl.gzOCSP_SINGLERESP_free.3ssl.gzOCSP_SINGLERESP_new.3ssl.gzOCSP_basic_add1_nonce.3ssl.gzOCSP_basic_sign.3ssl.gzOCSP_basic_sign_ctx.3ssl.gzOCSP_basic_verify.3ssl.gzOCSP_cert_id_new.3ssl.gzOCSP_cert_to_id.3ssl.gzOCSP_check_nonce.3ssl.gzOCSP_check_validity.3ssl.gzOCSP_copy_nonce.3ssl.gzOCSP_id_cmp.3ssl.gzOCSP_id_get0_info.3ssl.gzOCSP_id_issuer_cmp.3ssl.gzOCSP_request_add0_id.3ssl.gzOCSP_request_add1_cert.3ssl.gzOCSP_request_add1_nonce.3ssl.gzOCSP_request_onereq_count.3ssl.gzOCSP_request_onereq_get0.3ssl.gzOCSP_request_sign.3ssl.gzOCSP_resp_count.3ssl.gzOCSP_resp_find.3ssl.gzOCSP_resp_find_status.3ssl.gzOCSP_resp_get0.3ssl.gzOCSP_resp_get0_certs.3ssl.gzOCSP_resp_get0_id.3ssl.gzOCSP_resp_get0_produced_at.3ssl.gzOCSP_resp_get0_respdata.3ssl.gzOCSP_resp_get0_signature.3ssl.gzOCSP_resp_get0_signer.3ssl.gzOCSP_resp_get0_tbs_sigalg.3ssl.gzOCSP_resp_get1_id.3ssl.gzOCSP_response_create.3ssl.gzOCSP_response_get1_basic.3ssl.gzOCSP_response_status.3ssl.gzOCSP_sendreq_bio.3ssl.gzOCSP_sendreq_nbio.3ssl.gzOCSP_sendreq_new.3ssl.gzOCSP_set_max_response_length.3ssl.gzOCSP_single_get0_status.3ssl.gzOPENSSL_Applink.3ssl.gzOPENSSL_INIT_free.3ssl.gzOPENSSL_INIT_new.3ssl.gzOPENSSL_INIT_set_config_appname.3ssl.gzOPENSSL_INIT_set_config_file_flags.3ssl.gzOPENSSL_INIT_set_config_filename.3ssl.gzOPENSSL_LH_COMPFUNC.3ssl.gzOPENSSL_LH_DOALL_FUNC.3ssl.gzOPENSSL_LH_HASHFUNC.3ssl.gzOPENSSL_LH_node_stats.3ssl.gzOPENSSL_LH_node_stats_bio.3ssl.gzOPENSSL_LH_node_usage_stats.3ssl.gzOPENSSL_LH_node_usage_stats_bio.3ssl.gzOPENSSL_LH_stats.3ssl.gzOPENSSL_LH_stats_bio.3ssl.gzOPENSSL_MALLOC_FAILURES.3ssl.gzOPENSSL_MALLOC_FD.3ssl.gzOPENSSL_VERSION_NUMBER.3ssl.gzOPENSSL_VERSION_TEXT.3ssl.gzOPENSSL_atexit.3ssl.gzOPENSSL_buf2hexstr.3ssl.gzOPENSSL_cipher_name.3ssl.gzOPENSSL_cleanse.3ssl.gzOPENSSL_cleanup.3ssl.gzOPENSSL_clear_free.3ssl.gzOPENSSL_clear_realloc.3ssl.gzOPENSSL_config.3ssl.gzOPENSSL_fork_child.3ssl.gzOPENSSL_fork_parent.3ssl.gzOPENSSL_fork_prepare.3ssl.gzOPENSSL_free.3ssl.gzOPENSSL_hexchar2int.3ssl.gzOPENSSL_hexstr2buf.3ssl.gzOPENSSL_ia32cap.3ssl.gzOPENSSL_init_crypto.3ssl.gzOPENSSL_init_ssl.3ssl.gzOPENSSL_instrument_bus.3ssl.gzOPENSSL_instrument_bus2.3ssl.gzOPENSSL_load_builtin_modules.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc_init.3ssl.gzOPENSSL_mem_debug_pop.3ssl.gzOPENSSL_mem_debug_push.3ssl.gzOPENSSL_memdup.3ssl.gzOPENSSL_no_config.3ssl.gzOPENSSL_realloc.3ssl.gzOPENSSL_secure_actual_size.3ssl.gzOPENSSL_secure_clear_free.3ssl.gzOPENSSL_secure_free.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_zalloc.3ssl.gzOPENSSL_strdup.3ssl.gzOPENSSL_strlcat.3ssl.gzOPENSSL_st�x�������������h�������X�(
p�2������)��$9����������������)�*�(��../0123456789:;;<<<<;;;;;;;==;;>>?;@;;;;;;;;AAAA;;B;CD;;;;EEEEEEEEFFFFFFFFFFFFFFF;GHGIGJKJLGMGNOPOGQRGSGTGUGVGWXWYWZW[G\G]^G_`aGbGcGd;eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeffffffffffffffffffeeeee;;;gg;;hhh;;;;;;;;iiiiiiiiiii;;;;jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkllllmmlllnlolllpppppllllqqrrrrqlssssslllltluuuvvlwwlllxxxxllyllzlll{{l|ll}l~~~~~~~~~lll�l��lllllllllll�lllllllll�lll��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������llllll�perlperl5.26.3.build-id00ac4539aeb462508c811e4e9b589d476b7b8f3d0789a40331769143eac65087200fc9ee07673eca0b93a2c0e77051df14d9030fd92d070d87536ff4106c8ce60fb6a70ca010eddc08655cec22149b221192ff9fe30513a27467baeeb3ac4b0c46ade69414927ecfe0c603ccb7153250ef2f52f12614542216bc822e4ec2050b8c267a7095a6fe3ceaff5c911844a37b15cfa03be2cb97c07817e17e9ebc50be1bc4cd0bba113258f0015fdceca91323141831bb20307d9d535d93a26fd5238cc181a63b187ed0892fc46f25fa2c9ce10bd177a351ff4ffcbc38df5e30655675b453c3b9ff261dde6fd07866714a933f316f1260b949023b936dad89521d017e169906a13239efc797250ec716ad27df6214fa2581354112366feac23936d5e5f06afeed41e3034fa6a4a5b03c94a41868acedbf6b992ee0ac410�x���������������������X/�(
��������x���$`��������������������bcd2d35913ad6ef6d536ceda87991f9781dfbe2cdd427a85852a32084a6c3df898cce07ac7a97b76a50214d2135ad89e0717c03a8527d5341d0d0dfdd271f99b3330bd9d7e490c98840a3f3f526b633f7a2997fd69796dc3d3f8437c5f78aa7dea41852dfe9071243d1a354a279e761e29f0227e567b320cdbfdc86479dd8c10bd726a86bf2a047f108f1b47a5bbaed3efee1253ae11c802148c673479dd8c10bd726a86bf2a047f108f1b47a5bbaed3efee1253ae11c802148c67380fb60618a8fffae219fae589b2fdbd204f6bc7548e2a64ecc8e843fcc2f7eb680fb60618a8fffae219fae589b2fdbd204f6bc7548e2a64ecc8e843fcc2f7eb646de1956d27cde001aeeabd39cd19f3e2035da15812e8d470555be82de70e2ce46de1956d27cde001aeeabd39cd19f3e2035da15812e8d470555be82de70e2ce06d11a2514bc74bac57572b32679b735aaf205e772ebf792447abf0b4810b71e06d11a2514bc74bac57572b32679b735aaf205e772ebf792447abf0b4810b71ed7630995ccf82a97ca37a5e6ef031e8dd2f7ba6fa29281b971f432ef6c45ada0d7630995ccf82a97ca37a5e6ef031e8dd2f7ba6fa29281b971f432ef6c45ada01e5a10f8a34d35bad9bea53096483911118e3af675b0494bbc6bcdf9f8af71051e5a10f8a34d35bad9bea53096483911118e3af675b0494bbc6bcdf9f8af7105b56e4e8f010e22c81e85e20c17daf03ddfab42be557d5e759cfc6d5b97c9162a0b78aaaf083913ef433b17676a1e7af99877bdf8f9b2f1fbebeaf06cb36dead22f548b8ec0c18616c0f0b4652a824ef8fd6a8c15ad12a5e49a31ce742e139fbc0d036ab05932b881b3abcb53af1974619564fe87ae87b7d5f406e5b7e5c026d4d21554b02ef6dbafe5c55d756a4260acdcfb71a7f4435983a222ad57b9f5d31b6b04b374ccf8a8558883407c30990249b64e81dd20a2f175bb8cd18bc6760395364e84bdaa680bd147c3a7b0ca72151ee398d3075161b1144868110cc5705324364e84bdaa680bd147c3a7b0ca72151ee398d3075161b1144868110cc5705324cc97735220eaab3a1b4a08dff012d8063854d8bbdd2125a2c8d239ae0a8cdbb1cc97735220eaab3a1b4a08dff012d8063854d8bbdd2125a2c8d239ae0a8cdbb11bbde89e65339415db23720229577bea099e8c20410d0c26883050cc96cc5b1b1bbde89e65339415db23720229577bea099e8c20410d0c26883050cc96cc5b1b9467f2a818e42c2648d25c05c2c67e609124a5e8595a866490a4b2cbc6511dc99467f2a818e42c2648d25c05c2c67e609124a5e8595a866490a4b2cbc6511dc956751df0a83da3fdec9eded1ad2ede25ae0aa4ef1f0c49ec86e92435233a548c5e9db195c13b8567745ab6a4a3ec833969af00c3bb8ed6b873cfed478ae2cf5621e1ad17ac536a1c130515e449f9e31a714d7d45d951f3dd37fdbc0326489be87e3511d8ab799cb25df13e0498becd82002d26007461d3c84eb29490038d575ada75591f5d6cde833774489fc9e1ff7d03c8e2bb0828c6e664429442b9b8a5ed1699ed82b10fa7dd1bef4f3c25af31be8811b658bb4898004feff76a0b290bb61699ed82b10fa7dd1bef4f3c25af31be8811b658bb4898004feff76a0b290bb61d361a41fdb8cf24af96d25aa9dd61d36b8f79b67b46840f571496e0a4e6036c4dfaf4066f5cb61041b78794e777cf8a4fe540301c2948e3dbc33d1e87caebfdbebe466dbe594f0c1598cf03d1bf968ea409498a0da78cf9af0a4b257a8206fabebe466dbe594f0c1598cf03d1bf968ea409498a0da78cf9af0a4b257a8206fa460b984974e64deda395bfaf8cf924b883e45400a097718474fa7f5888b935e9460b984974e64deda395bfaf8cf924b883e45400a097718474fa7f5888b935e9fc9e77e34d2d7ca5b3d2000cc8d10c6f9d948217470b0da4fa0fd8191856e344fc9e77e34d2d7ca5b3d2000cc8d10c6f9d948217470b0da4fa0fd8191856e344879683f2085c8cd2fb009fc0e42fb4335037ade3f9e2a1707f4855dc1e32e6a6facc513e4a369ff1e803f8e56fa0e4269307203e5c02c8434b38018f6ec8de6a09c3fd163d698d07aa86491fa076ce923e8d49bc4fae0ec4aeabedc3d3c7c28ba4c30f5431da4a7662af1b79ee3a7468edb2b3d917474d8e305b05228f1bb098f73a94c8c11d0436560c2fec9dbc3740e67f2427a13b53a9b1c3f67f5f5debbde7048c6d716d2b09f5cf1002f7a4f30aa0bcac2ef1dfda124853845e891b09d3b5e2bad9cae60b1e15660c5d65af54ad3c9a0ef9dd5f893286246cd6dc05defc37ebea363d98e962cac6371d212f0e3a6f842b3d79c36656ebc552064f445db46e0e4efe5f7988dfbd214c90738817f321d0376fcab2f073524673ce567df5aef90c5a9db15e6199ac9e1120f7e5d2e413fa10ecb848317356c026eb7daabfe4f90c5a9db15e6199ac9e1120f7e5d2e413fa10ecb848317356c026eb7daabfe403a90a2748896f74ed3a7ddc6f0ffa3eb25b7af42ee2cbe6741a526475d1d4b103a90a2748896f74ed3a7ddc6f0ffa3eb25b7af42ee2cbe6741a526475d1d4b152869b5c391a7e0d2769002ab316eaecbc88e41f62b759e419bd67909d9ba17a52869b5c391a7e0d2769002ab316eaecbc88e41f62b759e419bd67909d9ba17a009611304f48907b28a9b972ffe0027ab4082cafbe63d1e86390cf98dabd28c7009611304f48907b28a9b972ffe0027ab4082cafbe63d1e86390cf98dabd28c70b6bab9cf837d120c39c0ef461950449605b81dfe�x�������������X��������X�(
h����$��������������������ute
  * repodata_lookup_num now works like the other lookup_num functions
- new functions:
  * selection_make_matchsolvable
  * selection_make_matchsolvablelist
  * pool_whatmatchessolvable
  * repodata_search_arrayelement
  * repodata_lookup_kv_uninternalized
  * repodata_search_uninternalized
  * repodata_translate_dir
- new repowriter interface to write solv files allowing better
  control over what gets written
- support for filtered file lists with a custom filter
- dropped support of (since a long time unused) REPOKEY_TYPE_U32
- selected bug fixes:
  * fix nasty off-by-one error in repo_write
  * do not autouninstall packages because of forcebest updates
  * fixed a couple of null pointer derefs and potential memory
    leaks
  * made disfavoring recommended packages work if strong recommends
    is enabled
  * no longer disable infarch rules when they don't conflict with
    the job
  * repo_add_rpmdb: do not copy bad solvables from the old solv file
  * fix cleandeps updates not updating all packages
- new features:
  * support rpm's new '^' version separator
  * support set/get_considered_list in bindings
  * new experimental SOLVER_FLAG_ONLY_NAMESPACE_RECOMMENDED flag
  * do favor evaluation before pruning allowing to (dis)favor
    specific package versions
  * bindings: support pool.matchsolvable(), pool.whatmatchessolvable()
    pool.best_solvables() and selection.matchsolvable()
  * experimental DISTTYPE_CONDA and REL_CONDA support- Backport patch to add support for modular updateinfoxml data- Backport patches for: Install of update of nss.x86_64 adds i686 into transaction (RhBug:1663136)- Backport patch: Fix memory leaks, memory access, not used values- Update to 0.6.35
- Backport patch: Make sure that targeted updates don't do reinstalls- Conditionalize the python2 subpackage- Update to 0.6.34- Update to 0.6.33- Update to 0.6.32- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 0.6.31- Use librpm to access rpm headers- Use librpm to access DB- Switch to %ldconfig_scriptlets- Disable librpm from accessing DB- Allow disabling python2 bindings- Switch to ninja-build- Update to latest git version
- Switch to use librpm for accessing headers / rpmdb- Update to latest snapshot- Better error message on DB_VERSION_MISMATCH errors- Update to 0.6.30- Band-aid for DB_VERSION_MISMATCH errors on glibc updates- Update to 0.6.29- Rebuilt after RPM update (№ 3)- Rebuilt for RPM soname bump- Rebuilt for RPM soname bump- Add support for REL_WITHOUT- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Backport patch for fixing yumobs- Update to 0.6.28- Backport few fixes for bindings- Update to 0.6.27- Update to latest snapshot- Enable AppData support (#1427171)- Update to latest git
- Switch to libxml2- Use %{__python3} as PYTHON3_EXECUTABLE- Update to 0.6.26- Update to 0.6.25- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.4- Rebuild for Python 3.6- Use upstream python build options- Update to 0.6.24- Typo fixes in spec: s/MULTI_SYMANTICS/MULTI_SEMANTICS/- Trivial fixes in spec- Enable suserepo on Fedora to enable making openSUSE containers with Zypper- Enable helixrepo on Fedora- Backport patch to fix dnf --debugsolver crash (RHBZ #1361831)- Update to 0.6.23- Backport couple of patches from upstream- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Update to 0.6.22
- Backport patch which will help to not autoremove needed packages
  (RHBZ #1227066, #1284349)- Enable deb/arch support for non-rhel distros- Modify enabled/disabled features- Update to 0.6.21- Backport patch to fix crashing on reading some repos (RHBZ #1318662)
- Backport patch to fix installing multilib packages with weak deps
  (RHBZ #1325471)- Update to 0.6.20- Reorganize spec file
- Enable helixrepo feature
- enable appdata feature- Apply 9 patches from upstream- Update to 0.6.19- Explicitly add rubypick and�x��������������������X�(
xH������F��$V����������������F�G�E��bf468a94106b2c8e384a11ae342979c3571ce9db8834861aa48569ebfa007ae5519b79f5714beb93d57795820e76375bd2199f1c75d43573fc99289e09b58c3fb5e2304de546e8edf4203153f3327ac83e18dea1c18f13b510e61e5340e754ef29011e137fdc6d282b8695fbfe65ee750e04e8415e8d14866b9c4ca02d8100008d3fdfc2c8de9635cd3f586b463cc3c17f727b01a7f6b247f4dab610e50c60be66d802d9ba9a562824d1a0fd976ae88298eb8ff24db76cf632abd4bff86b8bcb5dc3a8ccc215445a6c7791051ed7a8f608b32985e068a6d3169396353a0a916a57f21fc78f7b8498a7cf82d64b2664645c80ca890885c9c0921904510e47118dfba8a01583468de50cc8983c37922ebb3e12166dbcb9d38aa45219722a17917a10c4e243544a4deb246ff8c599540a82d32b1e835dc7b10e21bb9431bc8c41ed6c311e13392af57e99c4580d3ec867b3778e62fdd916acf49d3687d22a25ffd243de24326610c8ae3afb606f9758c33492d40531482f4a670b7a915b35e4595bd8d07881b94e18afaac95a5ecadbca4c38be38e2e2e5c994824efca2e9025c8ecefb4c11157c2a2015f6dfb4a2792214fa5e2bf3ac404c9a915001a649413535d656d4781c68c5ead9e1b838f025fec45288b25c97261113aee643b664feca2c9d14cfc90d3527fc0bf6931c75000cf941d1f8c914e83dfb21ba348d5d80248e1d0d8ba0dea782af869b4a87d7553436e4c3128790787bfa66a42971002221d7020a6c43f41efba9b68c497e04bef8b7cb1b9cef63e520635a2096d57d44e8096b1b9f5ef4c5bfb7ad1ac6c5da21c2324d980fa6ec042971774615e5a90a0d31555578a7f431518afb464756dd444f0fbf4d2f116c461fe15b77474f54a7792cd752f9226bebc8cc1dec441ba17cf8f071a6beb1a5e7981524d97a3643abdef1bba6bd7f41d47dec02402b5a0136b84f7c782de93ad9fc1fc0631e3a2b0e07f61fa1c4cc98590e6855154f1b44f76a73478fd97fbc7fa8de924cc073858ba7efbbb73f07b70ed14e38c667f24dfcfab9969d20815e73e3a53497ab5ea8fc6f36eb8d13e68896db391141028bae80feac3af524af64c50bd078e14649f2b75b50b551eaf5bd3b67b2df831644740e43ae32d8dde91517f1676f294b82191a38b945e4cb1012943b2b919fff04c30592ff83665735da4a223d2766fe75be79e03ad90ac24294ffd2639011c8611c30407ecac8d9d964df251b988af35060e3f14f51e58c62fe97252a5c1795da769dfefc6356793b083c9e449eb2df413b86ac2de3588f7b7c0355495ad4c54d3c330c69ad12090d0ca6628362e9b202fbf831d1b983a7d6041fddb681ca59b33fd008e9f80a8942d94a1203885110181cc5a9d6b0b1954be791e07036b89fc68cd45f6c540c5d4c6a63bf22006d61e0c2880f8db58e2f12efd1fad0184806bd112c6abed02539dfec0d5fdadfa63ff8142bd12cb6d132d4df87c5ecc7781fdd74541cfa55a5f3285d15aaa952f7aeece21d736b8b9345626c9bebfa1265a44edc86ccd1b694d16e97f13e79d9f9a9f5b5587954a107abe0490c7cdd562cb537a8b6af8f348527cba8d075ba747cf4afa9c5d2dc16bbcbfd1b45832647332c1132f6a75df5a0cebc45386075eb8c3969071819a488f8578038c6531de2a622f168e8b57c10140632972b997fdc9877ec60181f2efa625197c38b466b4819879672630bd849ed8acec502e6555e1913525f3f1d9b34fc94e634623e82414f72ed8fe613b82acfe800cb66ad80a816b951b99c894f701eac08b79265ff2ccbede0954f97a537d03fb78801ed645861219ec21cc059ecfeb3bc7c6e349734dd0344a06a724781a54c17811d69ed77da685153447312b3322627a7f28b432e1a9ab202bf89a0352309f274b039a4339eb0d7a98b14de828e10c92d697d1b7c7ab1870bc08f00569e2e5e66395de86ff7bd8e984ee828638d9d17515c406d093eb28723dfb6b0f12dc61926e59bf5ea4a0d97316fa237eede5fbd98ab28c7838229423df1a7adaf7ba3503fd8f5ad3d856fa6967cc7b2ad72eec3c2c627120e8396be9223522d733f57c9d1c5ad14a3cf820b437281f5592dea7f198797868b7206960af9124b51455cd92fd1929595f1d1a3234f91d7e4ba0e4018fb822bece4981c6baabe33846da19b179beace0f3fa15263f2fbaab6927932fbdf5dc7be936cc2e577120783a36a4992c15314f0aa12e565ea59a4a3a332d8fefa40a654f9482014c145f165bef3d065a59daee55a64d7bc642e1bdbcd01b125a860cfcc0f3f4700ef7a635655b0a7e2eae6cb78c55fab9bbf77aead9fb466b79a143dd37334541d900974380dd06eb8e2f924eb19d9bda096d077878654f000befe314c2890c3a4be204d7b8703b6a4dfcb40867ab4579d859f98e4fed714e0aa2dad96f28e9207a696f9f308a89a286a3b0958bbd3207217dce4917df140c21d3ed0f408882bf70d7bc8a49a2589e0f23d61d03c8795727c40beef761eb78c1d76d334c5c7e4d32bdf1a56c9213b061568d1fe2698e1dc6f8cea0074f746bb775fc9422c2b53279da9f23f9ecc4e932629fb8c401e44c71d66a4ee043692d225d9bbc01be51f0e5051b0cdc057cbfe3af4cfd2cc899d9399b809be16d0797decabe63cc647f7985a605ae60de860be1a439c30563d90f60be77f44dea803ca765001cbcbe92d7e0044c7ebbbd120893410ce7bd76a0455c3421938496dbb924cc00a8a562a42c8c69b0894067c6ce1a9403ba07bbd502edcaa7b047c864d9a83f566ec30488�x�������������8�������X4�(
X������������$e����������������������e8770719455ee501345fd0a71adbbeab364b5fea991d839142ecf18b17b036a0814ee751fcba1dd748974a939abb5a003d6331842eff56c63da9496534f6df5f449852b8b127c1623e31c59d62a56b6bff0207d78e54e6f6e61276211e2301d183b6e28eecc5563cc592df4c34f3d8c19556bebab4ff7bf6bfe2f0d68956f5b0feb080068c7cb5633dbc14b302c5d647884e924264f029914a29945c3fb6e36a05e848ee86b64823785b69f27485365f9c7aaf8c7c57c805f6cd4bae03eff6d148cb5ec88dfdd16fd3ffa3a3608ded031cb994dce5a4f92f94bc8794dae81ba22e7567b12b63440d1318388fb3adf9ee97aaeba0a9c02a5da88931b8c4812373261ea14d0847efca53abdbe7e31b7d6fd1a0d573aa963ca7718aea72efefccb3c6eab2414b94d857a0e91c75e7bc617b6bdbc58b4bcd87c519363a1ddd7b07657452bf4d81ccca42376e0e262ec537ab7ddcbbdb3adfedf0dde5e712523b5539d2c2df7cb71070372587adaf80fdb8102f3c9f87a69ca438e881d94eb39e0bcf1ff1f2b47779973d0807a7389818e16ceceed1ec433e31230b3d72d8fd383d67e28f0e4ea02b420ec660be06d109503c85c7bf21ba5ad9ff7b0e0bb9145db2917091d7feda8f9c4af1536aee32a0b731dc257c051a60f3b13a0fcee557f842065664023e0d38f7eeea8144b68a286e0a16c6ecedbf227adad2c0fd284c685491759e20379d9920bfcf1225e7b9b915695f97a03303e3acd827b7924fcfd13254522f28fc1db1cc62cce6afa01697c71c0f77d8106085c6de76417d748d959f1016cb6160c2fc38177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643285e19b88931d91c5e1e1c744de5d49576ed1712c150bd2fee76b29da643b8df6202c72c65b213a0d44f4f087abac42e9178713ca84b85c5b0c0849601568ad8460ad539bcee1d5b40bfabb69ab97bc9698378063b0263e9280133b0904aeec03a8963ac9dcde1779df85dbf889881a6e08bd105375cc6d68f6208adb53b8e7b090d675c89cc62adac800cfb6992d7154a8f3e7f1ebd74f8ce115c0a5a1ecf9bdb738296e3c2fa7a50c1cfbf81877f32df75e8ba267d5b765afa39c5a3e24bdaef2701d12391f700edd6f7d0681f8ee4956781c21eca3473ab2638778177700784387ea857e88ab79b6631b5f3ea9fa1fcab1b12ed44e5ce22cd666aba2ac449a7c976cf18fa58df8602202b960e686b15754e2fea2fba32d3e29cbe6d551442d3b2696b4e1dd9e986f85af30afe0e325f7d21d1170000916212cc5a8336a4e9@�x���������������������X�(
��������������d�$Y�����������������d�d�d�g��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng�ng��g��g�ng�ng�ng�`\�`\�`\�g��g��g�qg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�qg��g��g��g��g��g��g��g�rg��g�rg��g�rg��g��g��g��g��g��g��g�rg�rg��g�rg��g��g��g��g��g��g��g��g��g��g��g��g�rg��g��g��g��g��g�rg��g��g��g��g��g��g��g��g��g��g��g�qg��g��g��g��g��g��g��g��g��g�rg��g��g��g��g��g��g��g��g�rg��g��g��g��g��g��g��g��g��g��g��g�rg��g��g��g�rg�rg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�rg�rg��g��g��g��g��g��g��g��g��g��g��g�rg�rg�rg�rg�rg�sg�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�sg��g�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�sg��g��g��g��g��g��g��g��g��g��g��g�sg�sg��g��g��g��g��g��g��g��g��g��g��g��g�sg��g��g�sg��g�sg��g�sg��g��g��g��g��g�sg�sg�sg�sg�sg�sg�sg��g�sg��g��g��g��g��g��g��g��g�sg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g�tg��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g�tg�tg��g�tg��g��g��g��g��g��g��g��g�tg�tg��g��g��g��g��g��g��g��g��g�tg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�tg��g�tg�tg��g��g��g��g��g��g��g�tg��g��g��g�tg��g��g��g��g��g��g��g�tg��g��g��g��g�tg�tg��g��g��g��g�tg��g��g��g��g��g��g�tg��g��g��g�ug��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�ug��g��g��g��g��g�ug�ug�ug�ug�ug�ug�ug�ug��g��g��g�ug�ug��g��g��g�ug�ug�ug�ug�ug��g�ug��g�ug��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g�ug��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g�vg��g��g��g��g�vg��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg�vg��g��g��g��g��g�vg��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g�vg�vg��g��g�x�������������(��������X��(
T�������b�$r����������������bac�util-linux/v2.28/v2.28.1-ReleaseNotes- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- fix #1234317 - CD / DVD are rarely automounted- refresh login-lastlog-create.patch- upgrade to stable v2.28- fix libblkid- upgrade to v2.28-rc2- upgrade to v2.28-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28-ReleaseNotes
- add patch to fix broken swapon
- add subpackage util-linux-user (utils with dependence on libuser)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- fix #1299255 - boot.iso (from 20160117 Rawhide compose) incorrectly detected as minix FS- fix #1259745 - Can't start installation in Rawhide or F23 recent development images- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- upgrade to v2.27.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27.1-ReleaseNotes- upgrade to v2.27- upgrade to v2.27-rc2- improve version usage in source url- fix #1251320 - rfe: please change login to not add /bin:/sbin to $PATH
- apply patches from Lokesh Mandvekar to make spec file more portable- upgrade to v2.27-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.27/v2.27-ReleaseNotes
- add lsipc- fix dates in the spec file- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- upgrade to stable release 2.26.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.26/v2.26.2-ReleaseNotes- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- upgrade to stable release 2.26- fix setarch build on PPC- upgrade to 2.26-rc2- fix 1182778 - remount causes ro / and /home on boot- upgrade to 2.26-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.26/v2.26-ReleaseNotes
- build with -pie for uuidd
- new command zramctl- fix #1168490 - CVE-2014-9114 util-linux: command injection flaw in blkid- upgrade to stable 2.25.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.2-ReleaseNotes- upgrade to stable 2.25.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.1-ReleaseNotes- upgrade to release 2.25.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25.1-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- remove fstrim unit files from uuidd subpackage- upgrade to stable release 2.25- upgrade to release 2.25-rc2- Fix libblkid's squashfs probe return checking.
  Related: rhbz#1112315- upgrade to release 2.25-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.25/v2.25-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Changes/Python_3.4- fix #1094935 - script and/or trigger should not directly enable systemd units- fix #1090638 - remove pam_securetty.so from .pamd files- use systemd macroized scriptlets (#850355)- upgrade to stable release 2.24.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.24/v2.24.2-ReleaseNotes- use rpm autosetup- upgrade to stable release 2.24.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.24/v2.24.1-ReleaseNotes- fix #1031262 - lsblk -D segfault- upgrade to upstream release v2.24
- remove nologin (merged upstream)
- fix #1022217 - fdisk mishandles GPT corruption- upgrade to upstream release v2.24-rc1
- add python3 libmount binding- fix #1005566 - recount_geometry: Process /usr/sbin/fdisk was killed by signal 8 (SIGFPE)
- fix #1005194 - su generates incorrect log entries- refresh and rename patches
- fix #987787 - Remove lastlogin from su
- fix #950497 - problem umounting loop device
- fix #921498 - multiple internal testsuite failures- fix 990083 - su doesn't work with pam_ecryptfs- upgrade to stable release 2.23.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.23/v2.23.2-ReleaseNotes- fix #972457 - agetty idle I/O polling causes elevated CPU usage- fix #962145 - in.telnetd immediately closes connection- upgrade to 2.23.1
- backport agetty --local-line path- upgrade to 2.23
- add --wit�x����������������������X�(
��������������X�$H����������������XWY�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootutil-linux-2.32.1-46.el8.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x���������������������X ��(
����$c�������������������	sor input, ASCII text (gzip compressed data, max compression, from Unix)C source, ASCII text (gzip compressed data, max compression, from Unix)	
#@AB
RRRRRRRRRRRRRRRRRRR*RR2R-R%RRRRRRRRR$R+RR2R,RR"R#R RRRRRRRRRRRR(R.R)R&RR
RRR+R'R!RR2RRRRRRR$R+RR2utf-8a6c6fe72bf799f0f5c48bc07f8b5dc47d24c1e0ce2941a98f795a24ceb1bebbc?���`9��3!�^���P,��*����%�f�~�
	*����%��͑�֭B-��,2��`����݋
�2/Y����˸1CqZ�=%d�fފ��W*��P����Qm#ˣ""��#@Wb��5�J��Dd7��C�(�Qvv���g2-��.���a�"E���Tiu`���E?��9�g�H������@{n����\�P�]/�Q����Z� 9�K���^w�2�B��f
�N�p�q7}"��%
&K�_�'9in�$��+�q���/Ȉb���[������f:�4Y�d�҆tō$��0"��xm`%�
)G�Ľ[�5{�aFY�q
�Y�%����n�<�N��r�� U9�3<�}����������Ֆ�lZ�����v ����xr"�5��@���Aw�n����Џ5Uj����ⷚ)jU�\� o4
�2���	���1zw/��H0χ�4/�JI8@�W/�4ɱ�G���U�hp�}��ˢ�ELJ���g������ت�����6�4z�"��ًd,ұybc�,��"w��c*Gn�Pn�'���]x��W�3!�^���P,��*����%�f�~�
	*����%�i��o
oU��Jpth�������$c��5�!��yƝ�f�"ƥ����˦��oE�$`��ò�KD������Df˵tưQa5���6xv3��
�G�Z$-_fk��W��fзHTV��K�;R5�Z�gG��< ��nŐ��#+�5`�K�~�ֈD���$�C�ܓ����J�Z���n�E�q
'�G�i�,uf�8��)�f�!���~���m^�L���jp�![K��I���a�l���=�'��W�/t9/���3��d�G>���'o�.��=ێ`�o�d'{���4�zf�e?x1g[��5���&k}k���������|Z�ĥD�9gm�����pi�k_eBkD��rL;� ������R\	��?+�/��w�w��\V>�����tt�D�~���wE�샹V�. �Z��
j�K�9�~� �З@LT�N�q+��:��?��7u�����ﮌB:3�*	�$L�͕i�1gI
��)����,�1B�'����ѽ2558e633a43a3e86cd4cbf06f993ff3f8878740181dafefe330c31eac000959f0fe76e63d35c2a77cd0871ecf439cf70ca32ec37f��`�f� Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: fix spelling mistake: "missign" -> "missing" (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: Mediatek: MT8183: Add machine driver with DA7219 (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: Mediatek: MT8183: Add machine driver with TS3A227 (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: rt5677-spi: Add ACPI ID (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: cs42l51: add multi endpoint support (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: tlv320aic32x4: Fix Common Pins (Jaroslav Kysela) [1683051]
- [sound] ALSA: us122l: Use alloc_pages_exact() (Jaroslav Kysela) [1683051]
- [sound] ALSA: Replace snd_malloc_pages() and snd_free_pages() with standard helpers, take#2 (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Make snd_timer_close() really kill pending actions (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Check ack_list emptiness instead of bit flag (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Make sure to clear pending ack list (Jaroslav Kysela) [1683051]
- [sound] ALSA: timer: Unify timer callback process code (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl_audmix: Fix kbuild failure (Jaroslav Kysela) [1683051]
- [sound] ALSA: emux: Add support of loading GUS-patch (Jaroslav Kysela) [1683051]
- [sound] ALSA: hda/realtek - Fix speakers on Acer Predator Helios 500 Ryzen laptops (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: Add Audio Mixer machine driver (Jaroslav Kysela) [1683051]
- [sound] ALSA: ASoC: fsl: Add Audio Mixer CPU�x����������������������X!~�(
��#
hd�$x����������������hdidgd�e.3ssl.gzSSL_CTX_set_session_id_context.3ssl.gzSSL_CTX_set_session_ticket_cb.3ssl.gzSSL_CTX_set_split_send_fragment.3ssl.gzSSL_CTX_set_ssl_version.3ssl.gzSSL_CTX_set_stateless_cookie_generate_cb.3ssl.gzSSL_CTX_set_stateless_cookie_verify_cb.3ssl.gzSSL_CTX_set_timeout.3ssl.gzSSL_CTX_set_tlsext_max_fragment_length.3ssl.gzSSL_CTX_set_tlsext_servername_arg.3ssl.gzSSL_CTX_set_tlsext_servername_callback.3ssl.gzSSL_CTX_set_tlsext_status_arg.3ssl.gzSSL_CTX_set_tlsext_status_cb.3ssl.gzSSL_CTX_set_tlsext_status_type.3ssl.gzSSL_CTX_set_tlsext_ticket_key_cb.3ssl.gzSSL_CTX_set_tlsext_use_srtp.3ssl.gzSSL_CTX_set_tmp_dh.3ssl.gzSSL_CTX_set_tmp_dh_callback.3ssl.gzSSL_CTX_set_verify.3ssl.gzSSL_CTX_set_verify_depth.3ssl.gzSSL_CTX_up_ref.3ssl.gzSSL_CTX_use_PrivateKey.3ssl.gzSSL_CTX_use_PrivateKey_ASN1.3ssl.gzSSL_CTX_use_PrivateKey_file.3ssl.gzSSL_CTX_use_RSAPrivateKey.3ssl.gzSSL_CTX_use_RSAPrivateKey_ASN1.3ssl.gzSSL_CTX_use_RSAPrivateKey_file.3ssl.gzSSL_CTX_use_cert_and_key.3ssl.gzSSL_CTX_use_certificate.3ssl.gzSSL_CTX_use_certificate_ASN1.3ssl.gzSSL_CTX_use_certificate_chain_file.3ssl.gzSSL_CTX_use_certificate_file.3ssl.gzSSL_CTX_use_psk_identity_hint.3ssl.gzSSL_CTX_use_serverinfo.3ssl.gzSSL_CTX_use_serverinfo_ex.3ssl.gzSSL_CTX_use_serverinfo_file.3ssl.gzSSL_SESSION_dup.3ssl.gzSSL_SESSION_free.3ssl.gzSSL_SESSION_get0_alpn_selected.3ssl.gzSSL_SESSION_get0_cipher.3ssl.gzSSL_SESSION_get0_hostname.3ssl.gzSSL_SESSION_get0_id_context.3ssl.gzSSL_SESSION_get0_peer.3ssl.gzSSL_SESSION_get0_ticket.3ssl.gzSSL_SESSION_get0_ticket_appdata.3ssl.gzSSL_SESSION_get_compress_id.3ssl.gzSSL_SESSION_get_ex_data.3ssl.gzSSL_SESSION_get_id.3ssl.gzSSL_SESSION_get_master_key.3ssl.gzSSL_SESSION_get_max_early_data.3ssl.gzSSL_SESSION_get_max_fragment_length.3ssl.gzSSL_SESSION_get_protocol_version.3ssl.gzSSL_SESSION_get_ticket_lifetime_hint.3ssl.gzSSL_SESSION_get_time.3ssl.gzSSL_SESSION_get_timeout.3ssl.gzSSL_SESSION_has_ticket.3ssl.gzSSL_SESSION_is_resumable.3ssl.gzSSL_SESSION_new.3ssl.gzSSL_SESSION_print.3ssl.gzSSL_SESSION_print_fp.3ssl.gzSSL_SESSION_print_keylog.3ssl.gzSSL_SESSION_set1_alpn_selected.3ssl.gzSSL_SESSION_set1_hostname.3ssl.gzSSL_SESSION_set1_id.3ssl.gzSSL_SESSION_set1_id_context.3ssl.gzSSL_SESSION_set1_master_key.3ssl.gzSSL_SESSION_set1_ticket_appdata.3ssl.gzSSL_SESSION_set_cipher.3ssl.gzSSL_SESSION_set_ex_data.3ssl.gzSSL_SESSION_set_max_early_data.3ssl.gzSSL_SESSION_set_protocol_version.3ssl.gzSSL_SESSION_set_time.3ssl.gzSSL_SESSION_set_timeout.3ssl.gzSSL_SESSION_up_ref.3ssl.gzSSL_accept.3ssl.gzSSL_add0_chain_cert.3ssl.gzSSL_add1_chain_cert.3ssl.gzSSL_add1_host.3ssl.gzSSL_add1_to_CA_list.3ssl.gzSSL_add_client_CA.3ssl.gzSSL_add_dir_cert_subjects_to_stack.3ssl.gzSSL_add_file_cert_subjects_to_stack.3ssl.gzSSL_alert_desc_string.3ssl.gzSSL_alert_desc_string_long.3ssl.gzSSL_alert_type_string.3ssl.gzSSL_alert_type_string_long.3ssl.gzSSL_alloc_buffers.3ssl.gzSSL_allow_early_data_cb_fn.3ssl.gzSSL_build_cert_chain.3ssl.gzSSL_bytes_to_cipher_list.3ssl.gzSSL_callback_ctrl.3ssl.gzSSL_check_chain.3ssl.gzSSL_check_private_key.3ssl.gzSSL_clear.3ssl.gzSSL_clear_chain_certs.3ssl.gzSSL_clear_mode.3ssl.gzSSL_clear_options.3ssl.gzSSL_client_hello_cb_fn.3ssl.gzSSL_client_hello_get0_ciphers.3ssl.gzSSL_client_hello_get0_compression_methods.3ssl.gzSSL_client_hello_get0_ext.3ssl.gzSSL_client_hello_get0_legacy_version.3ssl.gzSSL_client_hello_get0_random.3ssl.gzSSL_client_hello_get0_session_id.3ssl.gzSSL_client_hello_get1_extensions_present.3ssl.gzSSL_client_hello_isv2.3ssl.gzSSL_client_version.3ssl.gzSSL_config.3ssl.gzSSL_connect.3ssl.gzSSL_ct_is_enabled.3ssl.gzSSL_ctrl.3ssl.gzSSL_dane_clear_flags.3ssl.gzSSL_dane_enable.3ssl.gzSSL_dane_set_flags.3ssl.gzSSL_dane_tlsa_add.3ssl.gzSSL_disable_ct.3ssl.gzSSL_do_handshake.3ssl.gzSSL_dup.3ssl.gzSSL_enable_ct.3ssl.gzSSL_export_keying_material.3ssl.gzSSL_export_keying_material_early.3ssl.gzSSL_extension_supported.3ssl.gzSSL_free.3ssl.gzSSL_free_buffers.3ssl.gzSSL_get0_CA_list.3ssl.gzSSL_get�x�����p<�y�������X+�(
�;	��������$��������������������om> - 0.6.21-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.20-2Igor Gnatenko <ignatenko@redhat.com> - 0.6.20-1Igor Gnatenko <ignatenko@redhat.com> - 0.6.19-3Jaroslav Mracek <jmracek@redhat.com> - 0.6.19-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.19-1Peter Robinson <pbrobinson@fedoraproject.org> 0.6.15-6Vít Ondruch <vondruch@redhat.com> - 0.6.15-5Dan Horák <dan[at]danny.cz> - 0.6.15-4Jaroslav Mracek <jmracek@redhat.com> - 0.6.15-3Michal Luscon <mluscon@redhat.com> - 0.6.15-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.15-1Jaroslav Mracek <jmracek@redhat.com> - 0.6.14-7Adam Williamson <awilliam@redhat.com> - 0.6.14-6Adam Williamson <awilliam@redhat.com> - 0.6.14-5Adam Williamson <awilliam@redhat.com> - 0.6.14-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.14-3Michal Luscon <mluscon@redhat.com> - 0.6.14-2Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.14-1Igor Gnatenko <i.gnatenko.brain@gmail.com> - 0.6.12-1Jan Silhan <jsilhan@redhat.com> - 0.6.11-3Adam Williamson <awilliam@redhat.com> - 0.6.11-2Jan Silhan <jsilhan@redhat.com> - 0.6.11-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.10-2Jan Silhan <jsilhan@redhat.com> - 0.6.10-1Jan Silhan <jsilhan@redhat.com> - 0.6.8-3Vít Ondruch <vondruch@redhat.com> - 0.6.8-2Richard Hughes <richard@hughsie.com> - 0.6.8-2Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.4-3Jan Silhan <jsilhan@redhat.com> - 0.6.4-2Aleš Kozumplík <akozumpl@redhat.com> - 0.6.4-1Jan Silhan <jsilhan@redhat.com> - 0.6.4-0.git2a5c1c4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.6.1-2.git6d968f1Aleš Kozumplík <ales@redhat.com> - 0.6.1-1.git6d968f1Jan Silhan <jsilhan@redhat.com> - 0.6.1-0.gitf78f5deVít Ondruch <vondruch@redhat.com> - 0.6.0-0.git05baf54.1Jan Silhan <jsilhan@redhat.com> - 0.6.0-0.git05baf54Aleš Kozumplík <akozumpl@redhat.com> - 0.4.1-1.gitbcedc98Aleš Kozumplík <akozumpl@redhat.com> - 0.4.1-0.gita8e47f1Zdenek Pavlas <zpavlas@redhat.com> - 0.4.0-2.git4442b7fAleš Kozumplík <akozumpl@redhat.com> - 0.4.0-1.gitd49d319Petr Pisar <ppisar@redhat.com> - 0.3.0-9.gita59d11dAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-8.gita59d11dAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-7.git228d412Petr Pisar <ppisar@redhat.com> - 0.3.0-6.git228d412Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-5.git228d412Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-4.git209e9cbAleš Kozumplík <akozumpl@redhat.com> - 0.3.0-3.git7399ad1Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-2.git7399ad1Aleš Kozumplík <akozumpl@redhat.com> - 0.3.0-1.gite372b78Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.2.3-2.gitf663ca2Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-17.git6c9d3ebAleš Kozumplík <akozumpl@redhat.com> - 0.0.0-16.git1617994Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-15.git1617994Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.0.0-14.git1617994Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-13.git1617994.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-12.git1617994.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-11.gitd39a42b.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-9.git8cf7650.el8Aleš Kozumplik <akozumpl@redhat.com> - 0.0.0-7.gitaf1465a2.el8Karel Klíč <kklic@redhat.com> - 0.0.0-6.git80afaf7.el8Karel Klíč <kklic@redhat.com> - 0.0.0-5.git80afaf7.el8Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-4.git80afaf7.el8Aleš Kozumplík <akozumpl@redhat.com> - 0.0.0-3.git80afaf7.el8Karel Klíč <kklic@redhat.com> - 0.0.0-2.git857fe28.el8Karel Klíč <kklic@redhat.com> - 0.0.0-1.git857fe28- Backport Allow to break arch lock-step on erase operations (RhBug:2172288,2172292)- Backport Treat condition both as positive and negative literal in pool_add_pos_literals_complex_dep
  (RhBug:2185061,2190136)- Drop patch to fix pick of old build (RhBug:2150300,RhBug:2151551)- Allow accessing toolversion at runtime and increase it- Add support for storing user data in a solv file
- Improve choice rule generati�x�������������pi�������X#y�(
��������x���$p��������������������ngfan Liu <piliu@redhat.com> - 2.0.20-43Pingfan Liu <piliu@redhat.com> - 2.0.20-42Pingfan Liu <piliu@redhat.com> - 2.0.20-41Pingfan Liu <piliu@redhat.com> - 2.0.20-40Pingfan Liu <piliu@redhat.com> - 2.0.20-39Pingfan Liu <piliu@redhat.com> - 2.0.20-38Pingfan Liu <piliu@redhat.com> - 2.0.20-37Pingfan Liu <piliu@redhat.com> - 2.0.20-36Pingfan Liu <piliu@redhat.com> - 2.0.20-35Pingfan Liu <piliu@redhat.com> - 2.0.20-34Pingfan Liu <piliu@redhat.com> - 2.0.20-33Pingfan Liu <piliu@redhat.com> - 2.0.20-32Pingfan Liu <piliu@redhat.com> - 2.0.20-31Pingfan Liu <piliu@redhat.com> - 2.0.20-30Pingfan Liu <piliu@redhat.com> - 2.0.20-29Pingfan Liu <piliu@redhat.com> - 2.0.20-28Pingfan Liu <piliu@redhat.com> - 2.0.20-27Pingfan Liu <piliu@redhat.com> - 2.0.20-26Pingfan Liu <piliu@redhat.com> - 2.0.20-25Pingfan Liu <piliu@redhat.com> - 2.0.20-24Pingfan Liu <piliu@redhat.com> - 2.0.20-23Pingfan Liu <piliu@redhat.com> - 2.0.20-22Pingfan Liu <piliu@redhat.com> - 2.0.20-21Pingfan Liu <piliu@redhat.com> - 2.0.20-20Pingfan Liu <piliu@redhat.com> - 2.0.20-19Pingfan Liu <piliu@redhat.com> - 2.0.20-18Pingfan Liu <piliu@redhat.com> - 2.0.20-17Pingfan Liu <piliu@redhat.com> - 2.0.20-16Pingfan Liu <piliu@redhat.com> - 2.0.20-15Pingfan Liu <piliu@redhat.com> - 2.0.20-14Pingfan Liu <piliu@redhat.com> - 2.0.20-13Pingfan Liu <piliu@redhat.com> - 2.0.20-12Pingfan Liu <piliu@redhat.com> - 2.0.20-11Pingfan Liu <piliu@redhat.com> - 2.0.20-10Pingfan Liu <piliu@redhat.com> - 2.0.20-9Pingfan Liu <piliu@redhat.com> - 2.0.20-8Pingfan Liu <piliu@redhat.com> - 2.0.20-7Pingfan Liu <piliu@redhat.com> - 2.0.20-6Pingfan Liu <piliu@redhat.com> - 2.0.20-5Pingfan Liu <piliu@redhat.com> - 2.0.19-12.4Pingfan Liu <piliu@redhat.com> - 2.0.19-12.3Pingfan Liu <piliu@redhat.com> - 2.0.19-12.2Pingfan Liu <piliu@redhat.com> - 2.0.19-12Pingfan Liu <piliu@redhat.com> - 2.0.19-11Pingfan Liu <piliu@redhat.com> - 2.0.19-10Pingfan Liu <piliu@redhat.com> - 2.0.19-9Pingfan Liu <piliu@redhat.com> - 2.0.19-8Kairui Song <kasong@redhat.com> - 2.0.19-7Pingfan Liu <piliu@redhat.com> - 2.0.19-6Pingfan Liu <piliu@redhat.com> - 2.0.19-5Pingfan Liu <piliu@redhat.com> - 2.0.19-4Pingfan Liu <piliu@redhat.com> - 2.0.19-3Pingfan Liu <piliu@redhat.com> - 2.0.19-2Pingfan Liu <piliu@redhat.com> - 2.0.19-1Pingfan Liu <piliu@redhat.com> - 2.0.17-30Pingfan Liu <piliu@redhat.com> - 2.0.17-29Pingfan Liu <piliu@redhat.com> - 2.0.17-28Pingfan Liu <piliu@redhat.com> - 2.0.17-27Pingfan Liu <piliu@redhat.com> - 2.0.17-26Pingfan Liu <piliu@redhat.com> - 2.0.17-25Pingfan Liu <piliu@redhat.com> - 2.0.17-24Pingfan Liu <piliu@redhat.com> - 2.0.17-23Lianbo Jiang <lijiang@redhat.com> - 2.0.17-22Pingfan Liu <piliu@redhat.com> - 2.0.17-21Pingfan Liu <piliu@redhat.com> - 2.0.17-20Pingfan Liu <piliu@redhat.com> - 2.0.17-19Pingfan Liu <piliu@redhat.com> - 2.0.17-18Pingfan Liu <piliu@redhat.com> - 2.0.17-17Pingfan Liu <piliu@redhat.com> - 2.0.17-16Pingfan Liu <piliu@redhat.com> Kairui Song <kasong@redhat.com> - 2.0.17-14Florian Weimer <fweimer@redhat.com> - 2.0.17-9Dave Young <dyoung@redhat.com> - 2.0.17-1Dave Young <dyoung@redhat.com> - 2.0.17-1Dave Young <dyoung@redhat.com> - 2.0.16-6Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 2.0.16-5Dave Young <dyoung@redhat.com> - 2.0.16-4Dave Young <dyoung@redhat.com> - 2.0.16-3Dave Young <dyoung@redhat.com> - 2.0.16-2Dave Young <dyoung@redhat.com> - 2.0.16-1Dave Young <dyoung@redhat.com> - 2.0.15-15Dave Young <dyoung@redhat.com> - 2.0.15-14Dave Young <dyoung@redhat.com> - 2.0.15-13Dave Young <dyoung@redhat.com> - 2.0.15-12Dave Young <dyoung@redhat.com> - 2.0.15-11Dave Young <dyoung@redhat.com> - 2.0.15-10Dave Young <dyoung@redhat.com> - 2.0.15-9Fedora Release Engineering <releng@fedoraproject.org> - 2.0.15-8Florian Weimer <fweimer@redhat.com> - 2.0.15-7Dave Young <dyoung@redhat.com> - 2.0.15-6Fedora Release Engineering <releng@fedoraproject.org> - 2.0.15-5Dave Young <dyoung@redhat.com> - 2.0.15-4Dave Young <dyoung@redhat.com> - 2.0.15-3Dave Young <dyoung@redhat.com�x��������������X�������X$��(
������� *�W�$h�����������������W�W�W�rtld(GNU_HASH)systemdsystemdsystemd3.0.4-14.6.0-14.0-15.2-14.14.3^p��[�t�Z�m�Z}�@Z|;�Zs@Zp^@Z	�Y�@Yx�@X��@X�A�W�%�W֘�V���V�n@V�=@U�@U�K@U�a@U/�@Ts�Tm�T3�T.��S�@S�@S���S��@S���S9X�R�@R��R�1@R��R�R�Rs��RV��RN��R@-@R/	�R' �R' �Q��Q��@Qy�Q�P�[�P���P�*�P���Pmz@Pi��PW�PG>�PG>�P4�P4�P	H@O�@O�@O�i�O�\@O"��O�O
y�O��N�U@N��N���N�
@N�j@N���Nw.�NT�N�@M�A�M��@M�V�M�@M��Mt�MQ0@MK�@M9u@M!�@M	�@M	�@L��LΫ�L�*@L��L��La?@L�K�s�K?5@K/c@K�@J�l�J�J�H@J��Jj�JT�@I�2�H�,�H�}@H|�@HsV�G�9�G­�G��F�v�FiD�FR�@F	@E�5@E݅�Eّ@E�3@E�`@E#�@E �@D�+@D��@D���Dm�@D`�@DWI�D?��D>=@D5�D+�@DS@C���C�@C�@C�C�:@C��@C��@C��C�q�CP�@B�B�<�B�R�B�:�Bn-@BR}�BJ��B8�B$Y@B#�B5�B	�@BX@A�n@A�U@A��@A�T@A��A�v�AZ��A<Q@A8\�A3�A3�A!�@A�A,�@�}@@��@���@�(�@~y@@ia@@`&�@4�@@,�@?I�@?I�@?B@?B@>��>��>��@>��@>�
@>̻�>̻�>�j@>��>x[�>C��>5@>.��=��=�?�=O�@=@<��<��@;f��;��:݁�:�R�:�i�:�@:yO�:I�9�@9l]�9<�8�Y�8��@8�@8�8}�@7� �7��7h�@7bK�7 `�6�%@6��@6�<@6��6vO@6i @6J�5�3@5���5�5I�@4���4���4M�4L�@4
Q@3�@Michal Ruprich <michalruprich@gmail.com> - 2.0-0.52.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.51.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.50.20160912gitIgor Gnatenko <ignatenkobrain@fedoraproject.org> - 2.0-0.49.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.48.20160912gitFlorian Weimer <fweimer@redhat.com> - 2.0-0.47.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.46.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.45.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.44.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.43.20160912gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.42.20160912gitMichal Ruprich <mruprich@redhat.com> - 2.0-0.41.20160912gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.40.20160912gitmruprich <mruprich@redhat.com> - 2.0-0.39.20160912gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.38.20160329gitZdenek Dohnal <zdohnal@redhat.com> - 2.0-0.37.20160329gitFedora Release Engineering <releng@fedoraproject.org> - 2.0-0.36.20150915gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.35.20150915gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.34.20150715gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.33.20150416gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.32.20150416gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.31.20141124gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.30.20141007gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.29.20141007gitLubomir Rintel <lkundrak@v3.sk> - 2.0-0.28.20140707gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.27.20140707gitTom Callaway <spot@fedoraproject.org> - 2.0-0.26.20140707gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.25.20140707gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.24.20131119gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.23.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.22.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.21.20131119gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.20.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.19.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.18.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.17.20131119gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.16.20131004gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.15.20131004gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.14.20131004gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.13.20130910gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.12.20130910gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.11.20130607gitJaromír Končický <jkoncick@redhat.com> - 2.0-0.10.20130607gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.9.20130607gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.8.20130607gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.7.20130425gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0-0.6.20130109gitJiri �x������@H�������X%��(
@��h������d�$t����������������dce�-ChangeLog- upgrade to the release 2.19-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc2-ChangeLog
- fix #671893 - SELinux is preventing /bin/chown from 'setattr' accesses
  on the file mounts.- clean up specfile (review #667416)- upgrade to the release 2.19-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes- fix #645640 - new "-s" parameter parsing in agetty does not work
- add -l (lock) support to fsck- fix #623685 - please extend agetty to not require a baud rate to be specified- fix #620924 - /sbin/mount.tmpfs uses not available /usr/bin/id- fix #615719 - tmpfs mount fails with 'user' option.
- fix #598631 - shutdown, reboot, halt and C-A-D don't work
- fix #618957 - ISO images listed in fstab are mounted twice at boot- upgrade to the final 2.18
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes- upgrade to 2.18-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc2-ChangeLog- upgrade to the release 2.18-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.18/v2.18-rc1-ChangeLog- fix #581252 - remounting tmpfs fails because of hidden rootcontext=
- fix #580296 - "rtcwake" does miss the "off" option
- fix #575734 - use microsecond resolution for blkid cache entries
- upgrade to the bugfix release 2.17.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.2-ChangeLog
- minor fixed in spec file- fix #533874 - libblkid should allow scanning of slow devices (eg. cdroms)- upgrade to the final 2.17.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.1-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17.1-ChangeLog- upgrade to 2.17.1-rc1- fix uuidd init script- fix #541402 - uuidd initscript lsb compliance- remove Provides: lib{uuid,blkid}-static (thanks to Michael Schwendt)
- remove useless URL to sf.net- upgrade to the final 2.17
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-ChangeLog
- fix #545147 - util-linux-ng : Violation of the Packaging Guidelines
  (remove uuid and blkid static libs)- minor fixes in spec file (fix URL, add Requires, add LGPLv2+)- upgrade to 2.17-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-rc2-ChangeLog- add clock.8 man page (manlink to hwclock)
- add --help to mount.tmpfs- upgrade to 2.17-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.17/v2.17-rc1-ChangeLog- upgrade to pre-release snapshot (official changelog not available yet, see
  http://git.kernel.org/?p=utils/util-linux-ng/util-linux-ng.git for now)- upgrade to pre-release snapshot (official changelog not available yet, see
  http://git.kernel.org/?p=utils/util-linux-ng/util-linux-ng.git for now)  
- new commands: fallocate, unshare, wipefs
- libblkid supports topology and partitions probing
- remove support for --rmpart[s] from blockdev(8) (util-linux-ng-2.14-blockdev-rmpart.patch)
- merged upstream:
  util-linux-ng-2.14-sfdisk-dump.patch
  util-linux-ng-2.16-blkid-swsuspend.patch
  util-linux-ng-2.16-libblkid-compression.patch
  util-linux-ng-2.16-libblkid-ext2.patch
  util-linux-ng-2.16-switchroot-tty.patch- fix spec file- release++- fix #519237 - bash: cannot set terminal process group (-1): Inappropriate ioctl for device- use password-auth common PAM configuration instead of system-auth and
  drop pam_console.so call from the remote PAM config file- fix #522718 - sfdisk -d /dev/xxx | sfdisk --force /dev/yyy fails when LANG is set
- fix typo in swsuspend detection- rebuilt with new audit- fix #518572 - blkid requires ext2.ko to be decompressed on installation media- fix #513104 - blkid returns no fstype for ext2 device when ext2 module not loaded- set conflict with versions of e2fsprogs containing fsck- remove the mount.conf support (see #214�x��������������7�������X&D�(
������������$��������������������			
		emptyASCII textdirectoryBourne-Again shell script, ASCII text executablepython 3.6 byte-compiledPython script, ASCII text executableAlgol 68 source, ASCII textXML 1.0 document, ASCII textUTF-8 Unicode texttroff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)POSIX shell script, UTF-8 Unicode text executable	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP�x�������������@'�������X'��(
@��F������`�$p����������������`_a�>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq
- fix RHEL-18451 - logger: initialize socket credentials control union
- fix RHEL-16070 - util-linux: issues in libblkid
- fix RHEL-6274 - lslogins incorrect account expiration field- increment release number- fix RHEL-13741 - lscpu: avoid EBUSY on cpuinfo_max_freq- fix #2117355 - Add additional documentation for fstab
- fix #2184728 - libuuid - downport cache related patch
- fix #2188894 - The swapon man page of -p(priority) option shows incorrect.
- fix #2227097 - wall(1) fail when trying to use seat0- fix #2180413 - Backport hint about systemd daemon-reload- improve #2160321 - [last] ut->ut_user is not null terminated- fix #2121699 - fstrim -av fails to trim root filesystem on Red Hat Coreos 
- fix #2142496 - update upstream tests
- fix #2149394 - umount outputs inaccurate error message when umount() fails with EACCES
- fix #2159544 - lslogins "Password is locked" status changed in util-linux-2.32.1-38
- fix #2160321 - [last] ut->ut_user is not null terminated- fix #2141969 - Add --cont-clock feature for libuuid and uuidd- improve tmpfiles.d use in spec file (related to #2059241)- update atari partition tests (related to #2060030)- fix #2060030 - Please backport patches for atari partition detection to RHEL 8
- fix #2069187 - Internal testsuite for lscpu failed on aarch64
- fix #2093166 - lslogins reports incorrect "Password is locked" status
- fix #2059241 - rpm -V / --verify reports bad user/group/mtime for /run/uuidd
- fix #2044592 - Move /var/log/lastlog ownership to systemd- fix #2058176 - losetup Retry LOOP_SET_STATUS64 on EAGAIN- rebuild after revert- change bug number (#2016229 to #2041498)- improve #2026511 fix - blkid fails to complete when targeting non-block devices
- fix #1950187 - Ambient capabilities failed to applied to non-root user- update lib-sys-add-sysfs_chrdev_devno_to_devname.patch (#2026511)- fix #1988955 - script command continues without stopping.
- fix #2041498 - incorrect partition size calculation for BLKPG_* ioctls
- fix #2011602 - logger from util-linux incorrectly handles long messages
- fix #1916151 - [RFE] spread fstrim.timer across time
- fix #1894192 - Update or backport setpriv --pdeathsig
- fix #2026511 - blkid fails to complete when targeting  non-block devices- fix #1906157 - after su from root to a normal user mesg is unable to show current status
- fix #1917852 - findmnt: add option to list all fs-independent flags
- fix #1922299 - throws error using /sbin/nologin: invalid option -- 'c'
- fix #1940607 - lsblk sometimes returns block devices in wrong order with --pairs
- fix #1919529 - [RFE] RHEL-8: Support option flags with mount(8) --bind
- fix #1946921 - RHEL8: mount --rbind -o rprivate doesn't do recursive bind mount- update lscpu-show-physical-socket-on-aarch64-without-ACPI-P.patch (#1882740)- update regression tests (related to #1900498)- fix #1884194 - RHEL-8: chrt command does not support the -R option
- fix #1855759 - mount.8: clarify (no)suid behavior on file capabilities
- fix #1861670 - lsblk can not show serial information for virtio disk
- fix #1883783 - lscpu: avoid segfault on PowerPC systems with valid hardware configurations
- fix #1900498 - libfdisk/libmount: backport two patches for upstream systemd
- fix #1883056 - lscpu support for Fujitsu A64FX
- fix #1882740 - lscpu: use SMBIOS Type 4 strings for CPU vendor and model on ARM- fix #1848919 - Update losetup man page to fix "--direct-io" defaults- fix #1826251 - remove MD metadata 0.90 based tests from util-linux CI
- fix #1812576 - RFE: Bitlocker detection for RHEL 8.3
- fix #1817726 - add libblkid BLOCK_SIZE
- fix #1803753 - RHEL-8: col struct char_str c_column field should be of unsigned type and/or larger than 16 bit
- fix #1812118 - mount -a always tries to mount smb3 share subdir despite being already mounted
- fix #1824727 - util-linux: Include python3-libmount package in th�x���������������������X(��(
p	���������$X��������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~����������������������������������������������������������������������������������������bebebgbgcacacscsdadadedeelelen@boldquoten@boldquoten@quoten@quoteoeseseteteufififrfrgaglglhrhuididititjajakokonbnbnlnlnnnnpaplplptptptptrororuruskskslslsrsrsvsvtrtrukukvivizhzhzhzhzh0.19.8.1-17.el80.19.8.1-17.el8	


         !!!!!!"##$$%%&&''(())**++,--../00112334566778899::;;<<=>>??@@AABBCCDDEEFFGGHHIIJJKLLMMMMMMMMMMMMMMMMMMMMenvsubstgettextgettext.shmsgattribmsgcatmsgcmpmsgcommmsgconvmsgenmsgexecmsgfiltermsgfmtmsggrepmsginitmsgmergemsgunfmtmsguniqngettextrecode-sr-latinxgettext.build-id041a454fb24bb87f4a680a9e44e4210f7aff9b30076deb60a2f2af66db58bc601bafe5745115b9fe72c98b0f3d47f44fd5e5360553af0301a899e913a25f4d93acfe31e6de5bce53ec18b4e4d1c9ba1b2939ffbcd5d3cbc720b8185126b8c52bf8d167245354ef87a746eb3951f578a1e74ce4a5ca73bc2b77967f6069c312b906edcd699b8e115de3a5d12e4e511446305fac8274d5928a72d82fd53e3285329c3c540de0f517c3b2b225395228963f1f1874c1394bd094b3d348d5c499c7e0a469c30d254b3f5368b93c48850b3784102c00e29ef0bd8bb9e24228317a64d4bb4e1b6f0cc92871d721acb06a3e4478e1c8a7aab31a8c380ff33b1d0e6acb9730384ea2eb1b5eafd4590247827e9bee85b22ecc2f3d53f8dfae4a9ac79e2becec15072a7fa74191eac46d7ac15733fdf04b4463c0468b684acdc39a7e737e9ab2694d74d7806909a3870baeb6eae6ec032984c3b7489b9214a19a5004c01c72d6305e44af458f493b78bb8c2a6c9ec3871bb0f664c3bb01c128c5e7f6997f3c09f1a6c06e7250b74015b5361179cf985a1ded20cf35f4d74d8e2ab1e09449881623f6572773f4194d29b93fadc7d1bb88c4300fd721gettextcldr-pluralshostnameproject-idurlgetuser-emailgettextAUTHORSBUGSCOPYINGCOPYING.LIBDISCLAIMNEWSREADMETHANKSenvsubst.1.htmlgettext.1.htmlngettext.1.htmlgettextgettext-0.19.8itsappdata.itsappdata.locglade.locglade1.itsglade2.itsgsettings.itsgsettings.locgtkbuilder.itsABOUT-NLSitspoMakefile.in.inMakevars.templateRules-quotboldquot.seden@boldquot.headeren@quot.headerinsert-header.sinqu�x���������������������X)ߛ(
���������D
aX�$q����������������aX`XbX� fixfiles to prompt before deleteing /tmp files- have restorecon ingnore <<none>>
- Hand matchpathcon the file status- Update to match NSA- Move location of log file to /var/tmp- Better grep command for bind- Eliminate bind and context mounts- update to match NSA- Log fixfiles to the /tmp directory- Add patch to fall back to authenticating via uid if
  the current user's SELinux user identity is the default
  identity
- Add BuildRequires pam-devel- Add man page, thanks to Richard Halley- Upgrade to latest from NSA- Update with latest from gentoo and NSA- Check return codes in sestatus.c- Fix sestatus to not double free
- Fix sestatus.conf to be unix format- Warn on setfiles failure to relabel.- Updated version of sestatus- Fix fixfiles to checklabel properly- add sestatus- Change free call to freecon
- Cleanup- Remove setfiles-assoc patch
- Fix restorecon to not crash on missing dir- Eliminate trailing / in restorecon- Add Verbosity check- Change restorecon to not follow symlinks.  It is too difficult and confusing
- to figure out the file context for the file pointed to by a symlink.- Fix restorecon- Read restorecon patch- Change genhomedircon to take POLICYSOURCEDIR from command line- Add checkselinux
- move fixfiles and restorecon to /sbin- Restore patch of genhomedircon- Add setfiles-assoc patch to try to freeup memory use- Add fixlabels- Update to latest from NSA- Increase the size of buffer accepted by setfiles to BUFSIZ.- genhomedircon should complete even if it can't read /etc/default/useradd- fix restorecon to relabel unlabled files.- Add genhomedircon from tresys
- Fixed patch for restorecon- exit out when selinux is not enabled- Fix minor bugs in restorecon- Add restorecon c program- Update to latest tarball from NSA- Add sort patch- rebuilt- remove mods to run_init since init scripts don't require it anymore- fix genhomedircon not to return and error- add setfiles quiet patch- add checkcon to verify context match file_context- fix command parsing restorecon- Add restorecon- Update to latest NSA 1.4- Change run_init.console to run as run_init_t- Remove dietcc since load_policy is not in mkinitrd
- Change to use CONSOLEHELPER flag- Don't authenticate run_init when used with consolehelper- Add run_init consolehelper link- Add russell spead up patch to deal with file path stems- Build load_policy with diet gcc in order to save space on initrd- Update with NSA latest- remove i18n
- Temp remove gtk support- Remove wnck requirement- Add gtk support to run_init- Add internationalization- Initial version/bin/sh/bin/shpolicycoreutils	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~�������������������������������������afamarasbalbebgbnbnbrbscacscydadedeeleneset�x����������������������X*
�(
��������u�$e����������������utv�ed, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=294a1d143ea2871f3e2ed5bc2e04db32ea290e36, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2d39ebe7f4ca2cdb365cc5a9aa9e356b3c96a85e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ce34def152f881519c765b46024774fb683e6b8d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6a6192bd2f4c30996dcb35762ecf1c698cdff89d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5ef5ac1ac892946bc8cadb66581180a4347370a0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dd2260f83c64d31340e6ff303536baeee3ad3d6e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d28b3f9244508ae76bc04688df8f87b9a3d5920b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1d9b4e45afe837c7eb4c53548b75df2f8d0705cb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c404a72a5e288660385fe49b742944655db6d74b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c486b11b07132b49f87c7e7602328c0a83d2bb5e, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5a939fcd2197a7cb8e3ccee3cb41b0992027c77e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e9877f48f78170c2497b43896d06a8651763c62, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=816283987d0b228cec0ba938a9b9e4859f0b9dbc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ff01a3c56d3a7efabd91adc77e85ffe263f4657b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c26d5789f1d97e366f0433bbe17df5dd6a2a50f7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5c808cf19b002989ce568c9557a920e439e27225, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=be996082d88f066ec094fae776c071f390bcee01, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ad7cf017285518aa5a8c533f25dc88710d6f5442, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=be8bfd55776adcead76028863b9f66a824be3db9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4306ce1f6ad3ce18ecc219a303d336ea5f77810e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamical�x�������������p������X+|�(
P�81��������$s��������������������man@redhat.com> - 2.0.0-39David Malcolm <dmalcolm@redhat.com> - 2.0.0-38Lubomir Rintel <lkundrak@v3.sk> - 2.0.0-37Lubomir Rintel <lkundrak@v3.sk> - 2.0.0-36CAI Qian <caiqian@redhat.com> - 2.0.0-35CAI Qian <caiqian@redhat.com> - 2.0.0-34Neil Horman <nhorman@redhat.com> - 2.0.0-33Neil Horman <nhorman@redhat.com> - 2.0.0-32Neil Horman <nhorman@redhat.com> - 2.0.0-31Neil Horman <nhorman@redhat.com> - 2.0.0-30Neil Horman <nhorman@redhat.com> - 2.0.0-29Neil Horman <nhorman@redhat.com> - 2.0.0-28Neil Horman <nhorman@redhat.com> - 2.0.0-27Neil Horman <nhorman@redhat.com> - 2.0.0-26Neil Horman <nhorman@redhat.com> - 2.0.0-25Neil Horman <nhorman@redhat.com> - 2.0.0-24Neil Horman <nhorman@redhat.com> - 2.0,0-23Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.0-22Neil Horman <nhorman@redhat.com> 2.0.0-21Neil Horman <nhorman@redhat.com> 2.0.0-20Neil Horman <nhorman@redhat.com> 2.0.0-19Neil Horman <nhorman@redhat.com> 2.0.0-18Neil Horman <nhorman@redhat.com> 2.0.0-17Neil Horman <nhorman@redhat.com> 2.0.0-16Neil Horman <nhorman@redhat.com> 2.0.0-15Neil Horman <nhorman@redhat.com> 2.0.0-14Neil Horman <nhorman@redhat.com> - 2.0.0-13Neil Horman <nhorman@redhat.com> - 2.0.0-12Lubomir Rintel <lkundrak@v3.sk> - 2.0.0-11Neil Horman <nhorman@redhat.com> - 2.0.0-10Orion Poplawski <orion@cora.nwra.com> - 2.0.0-9Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.0-8Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2.0.0-7Neil Horman <nhorman@redhat.com> - 2.0.0.6Ignacio Vazquez-Abrams <ivazqueznet+rpm@gmail.com> - 2.0.0-5Neil Horman <nhorman@redhat.com> - 2.0.0-3Neil Horman <nhorman@redhat.com> - 2.0.0-2Neil Horman <nhorman@redhat.com> - 2.0.0-2Neil Horman <nhorman@redhat.com> - 2.0.0-1Neil Horman <nhorman@redhat.com> - 1.102pre-16Tom "spot" Callaway <tcallawa@redhat.com> - 1.102pre-15Neil Horman <nhorman@redhat.com> - 1.102pre-14Neil Horman <nhorman@redhat.com> - 1.102pre-13Neil Horman <nhorman@redhat.com> - 1.102pre-12Neil Horman <nhorman@redhat.com> - 1.102pre-11Neil Horman <nhorman@redhat.com> - 1.102pre-10Neil Horman <nhorman@redhat.com> - 1.102pre-9Neil Horman <nhorman@redhat.com> - 1.102pre-8Neil Horman <nhorman@redhat.com> - 1.102pre-7Neil Horman <nhorman@redhat.com> - 1.102pre-6Neil Horman <nhorman@redhat.com> - 1.102pre-5Neil Horman <nhorman@redhat.com> - 1.102pre-4Neil Horman <nhorman@redhat.com> - 1.102pre-3Neil Horman <nhorman@redhat.com> - 1.102pre-2Neil Horman <nhorman@redhat.com> - 1.102pre-1Neil Horman <nhorman@redhat.com> - 1.101-81Neil Horman <nhorman@redhat.com> - 1.101-80Neil Horman <nhorman@redhat.com> - 1.101-79Neil Horman <nhorman@redhat.com> - 1.101-78Neil Horman <nhorman@redhat.com> - 1.101-77Neil Horman <nhorman@redhat.com> - 1.101-76Neil Horman <nhorman@redhat.com> - 1.101-75Neil Horman <nhorman@redhat.com> - 1.101-74Neil Horman <nhorman@redhat.com> - 1.101-73Neil Horman <nhorman@redhat.com> - 1.101-72Neil Horman <nhorman@redhat.com> - 1.101-71Neil Horman <nhorman@redhat.com> - 1.101-70Neil Horman <nhorman@redhat.com> - 1.101-69Neil Horman <nhorman@redhat.com> - 1.101-68Neil Horman <nhorman@redhat.com> - 1.101-67Neil Horman <nhorman@redhat.com> - 1.101-66Neil Horman <nhorman@redhat.com> - 1.101-65Neil Horman <nhorman@redhat.com> - 1.101-64Neil Horman <nhorman@redhat.com> - 1.101-63Neil Horman <nhorman@redhat.com> - 1.101-62Neil Horman <nhorman@redhat.com> - 1.101-61Neil Horman <nhorman@redhat.com> - 1.101-60Neil Horman <nhorman@redhat.com> - 1.101-59Neil Horman <nhorman@redhat.com> - 1.101-58Neil Horman <nhorman@redhat.com> - 1.101-56Neil Horman <nhorman@redhat.com> - 1.101-55Neil Horman <nhorman@redhat.com> - 1.101-54Neil Horman <nhorman@redhat.com> - 1.101-53Neil Horman <nhorman@redhat.com> - 1.101-52Neil Horman <nhorman@redhat.com> - 1.101-51Neil Horman <nhorman@redhat.com> - 1.101-50Neil Horman <nhorman@redhat.com> - 1.101-49Neil Horman <nhorman@redhat.com> - 1.101-48Jarod Wilson <jwilson@redhat.com> - 1.101-47Jarod Wilson <jwilson@redhat.com> - 1.101-46Neil Horman�x���������������������X,��(
��������P�����4��$$����������������4�5�3��
- Fix regular expression matching (RT#130307)- Fix crash in Storable when deserializing malformed code reference
  (RT#68348, RT#130098)
- Fix crash on explicit return from regular expression substitution (RT#130188)
- Tighten dependencies between architecture specific sub-packages to ISA
- Fix assigning split() return values to an array
- Fix const correctness in hv_func.h (bug #1242980)- Tie perl-Errno release to interpreter build because of kernel version check
  (bug #1393421)- Fix crash in "evalbytes S" (RT#129196)
- Fix crash in splice (RT#129164, RT#129166, RT#129167)
- Fix string overrun in Perl_gv_fetchmethod_pvn_flags (RT#129267)
- Fix crash when matching UTF-8 string with non-UTF-8 substrings (RT#129350)
- Fix parsing perl options in shell bang line (RT#129336)
- Fix firstchar bitmap under UTF-8 with prefix optimization (RT#129950)
- Avoid infinite loop in h2xs tool if enum and type have the same name
  (RT130001)
- Fix stack handling when calling chdir without an argument (RT#129130)- perl-core depends on Parse::CPAN::Meta module instead of package name to allow
  upgrading perl-CPAN-Meta to 2.150010 (bug #1370681)- Avoid loading of modules from current directory, CVE-2016-1238, (bug #1360425)- Fix handling \N{} in tr for characters in range 128--255 (RT#128734)- Fix building without perl in the build root
- Own systemtap directories by perl-devel- Fix a crash in lexical scope warnings (RT#128597)- Fix a crash in "Subroutine redefined" warning (RT#128257)- Fix a crash when vivifying a stub in a deleted package (RT#128532)- Do not let XSLoader load relative paths (CVE-2016-6185)- Fix line numbers with perl -x (RT#128508)- Do not crash when inserting a non-stash into a stash (RT#128238)- Do not use unitialized memory in $h{\const} warnings (RT#128189)
- Fix precedence in hv_ename_delete (RT#128086)
- Do not treat %: as a stash (RT#128238)- Fix compiling regular expressions like /\X*(?0)/ (RT#128109)- Do not mangle errno from failed socket calls (RT#128316)- Fix a memory leak when compiling a regular expression with a POSIX class
  (RT#128313)- Remove reflexive dependencies
- Use pregenerated dependencies on bootstrapping
- Specify more build-time dependencies- Stop providing old perl(MODULE_COMPAT_5.22.*)
- Update license tags- 5.24.0 bump (see <http://search.cpan.org/dist/perl-5.24.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages; Update or remove patches- 5.22.2 bump (see <http://search.cpan.org/dist/perl-5.22.2/pod/perldelta.pod>
  for release notes)- Weak perl-Encode-devel dependency on perl-devel to Recommends level
  (bug #1129443)
- Remove perl-ExtUtils-ParseXS dependency on perl-devel (bug #1129443)
- Require perl-devel by perl-ExtUtils-MakeMaker
- Provide MM::maybe_command independently (bug #1129443)
- Replace ExtUtils::MakeMaker dependency with ExtUtils::MM::Utils in IPC::Cmd
  (bug #1129443)
- Remove perl-ExtUtils-Install dependency on perl-devel (bug #1129443)
- Remove perl-ExtUtils-Manifest dependency on perl-devel (bug #1129443)- Do not filter FCGI dependency, CGI is non-core now- Remove bundled perl-IPC-SysV (bug #1308527)- Fix CVE-2016-2381 (ambiguous environment variables handling) (bug #1313702)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Remove bundled Math-BigInt (bug #1277203)- 5.22.1 bump (see <http://search.cpan.org/dist/perl-5.22.1/pod/perldelta.pod>
  for release notes)- Rebuild to utilize perl(:VERSION) dependency symbol- Do not own IO::Socket::IP manual page by perl-IO- Sub-package Attribute-Handlers
- Sub-package Devel-Peek
- Sub-package Devel-SelfStubber
- Sub-package SelfLoader
- Sub-package IO
- Sub-package Errno
- Correct perl-Digest-SHA dependencies
- Correct perl-Pod-Perldoc dependencies
- Move utf8 and dependencies to perl-libs
- Correct perl-devel and perl-CPAN dependencies
- Sub-package IPC-SysV
- Sub-package Test
- Sub-package utilities (splain) into perl-utils
- Provide perl version in perl(:VERSION) dependency symbol- Sub-package Memoize
- Sub-package Net-Ping
- Sub-package �x�������������`�������X--�(
����������d�$)�����������������d�d�d�BN_bn2bin.3ssl.gzBN_add.3ssl.gzBN_mod_mul_reciprocal.3ssl.gzBN_add_word.3ssl.gzBN_copy.3ssl.gzBN_add.3ssl.gzBN_new.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_add.3ssl.gzBN_generate_prime.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzDH_get_1024_160.3ssl.gzBN_zero.3ssl.gzBN_bn2bin.3ssl.gzBN_set_bit.3ssl.gzBN_cmp.3ssl.gzBN_cmp.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime.3ssl.gzBN_cmp.3ssl.gzBN_cmp.3ssl.gzBN_bn2bin.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_bn2bin.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_add.3ssl.gzBN_num_bytes.3ssl.gzBN_num_bytes.3ssl.gzBN_zero.3ssl.gzBN_bn2bin.3ssl.gzBN_bn2bin.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_rand.3ssl.gzBN_set_bit.3ssl.gzBN_set_bit.3ssl.gzBN_new.3ssl.gzBN_zero.3ssl.gzBN_add.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_cmp.3ssl.gzBN_zero.3ssl.gzBN_copy.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzX509_dup.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzX509_dup.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_add1_signer.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add1_recipient_cert.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_cert.3ssl.gzCMS_get0_type.3ssl.gzCMS_get0_type.3ssl.gzCMS_verify.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_cert.3ssl.gzCMS_get0_type.3ssl.gzCONF_modules_free.3ssl.gzCONF_modules_load_file.3ssl.gzCONF_modules_free.3ssl.gzX509_dup.3ssl.gzX509_dup.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzOPENSSL_secure_malloc.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzOPENSSL_malloc.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_STORE_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCTLOG_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_EVAL_CTX_new.3ssl.gzCT_POLICY_�x�������������س�������X.�(
@�(��������$?��������������������6- 623908 fix fd leak in anacron, which caused denail of prelink
  and others- remove sendmail from requirements. If it's not installed, it will
 log into (r)syslog.- update to new release- update to new release- 564894 FTBFS DSOLinking- 533189 pam needs add a line and selinux needs defined one function- 531963 and 532482 creating noanacron package- 529632 service crond stop returns appropriate value- new release- rebuilt with new audit- create the anacron timestamps in correct post script- update to 1.4.1
- create and own /var/spool/anacron/cron.{daily,weekly,monthly} to
 remove false warning about non existent files
- Resolves: 517398- 515762 move anacron provides and obsoletes to the anacron subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- merge cronie and anacron in new release of cronie
- obsolete/provide anacron in spec- 506560 check return value of access- new release- 496973 close file descriptors after exec- rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- 477100 NO_FOLLOW was removed, reload after change in symlinked
  crontab is needed, man updated.- update init script- add sendmail file into requirement, cause it's needed some MTA- 462252  /etc/sysconfig/crond does not need to be executable- update to 1.2- fix setting keycreate context
- unify logging a bit
- cleanup some warnings and fix a typo in TZ code
- 450993 improve and fix inotify support- 49864 upgrade/update problem. Syntax error in spec.- release 1.1- 446360 check for lock didn't call chkconfig- upgrade from less than cronie-1.0-4 didn't add chkconfig- 431366 after reboot wasn't cron in chkconfig- 431366 trigger part => after update from vixie-cron on cronie will
  be daemon running.- change the provides on higher version than obsoletes- packaging cronie
- thank's for help with packaging to my reviewers/bin/sh/bin/sh/bin/shcronie-sysvinit/bin/sh/bin/sh/bin/sh	

1.5.2-10.el81.5.2-10.el81.5.2-10.el8	



cron.d0hourlycron.denycrondcrondcrond.servicecronnextcrontab.build-id4d3dddeacec65e1a9392128f48a9b9f928c84d1b77afc4d38904aed0da78db3ea75771291e04f28bfe2f8563d3ec9b2c7d348e260c015eb237574379crondcronieAUTHORSChangeLogREADMEcronieCOPYINGcronnext.1.gzcrontab.1.gzcrontab.5.gzcron.8.gzcrond.8.gzcron/etc//etc/cron.d//etc/pam.d//etc/sysconfig//lib/systemd/system//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/4d//usr/lib/.build-id/77//usr/lib/.build-id/fe//usr/sbin//usr/share/doc//usr/share/doc/cronie//usr/share/licenses//usr/share/licenses/cronie//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8//var/spool/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	directoryASCII textemptyELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=77afc4d38904aed0da78db3ea75771291e04f28b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fe2f8563d3ec9b2c7d348e260c015eb2�x�������������P��������X/œ(
U
x�������|!�$l����������������|!{!}!�se bytes" (RT#130703)
- Fix a buffer overflow when studying some regexps repeatedly
  (RT#129281, RT#129061)- Fix UTF-8 string handling in & operator (RT#129287)
- Fix recreation of *:: (RT#129869)
- Fix a memory leak in B::RHE->HASH method (RT#130504)
- Fix parsing goto statements in multicalled subroutine (RT#113938)
- Fix a heap overlow in parsing $# (RT#129274)- Fix a buffer overflow in split in scalar context (RT#130262)
- Fix a heap overflow with pack "W" (RT129149)
- Fix a use-after-free when processing scalar variables in forms (RT#129125)
- Fix a heap overflow if invalid octal or hexadecimal number is used in
  transliteration expression (RT#129342)
- Fix out-of-bound read in case of unmatched regexp backreference (RT#129377)- 5.24.1 bump (see <http://search.cpan.org/dist/perl-5.24.1/pod/perldelta.pod>
  for release notes)- Rebuild for readline 7.x- Remove bundled Math-BigInt-FastCalc (bug #1408463)
- Remove bundled Math-BigRat (bug #1408467)
- Remove bundled bignum (bug #1409585)- Fix a crash in optimized evaluation of "or ((0) x 0))" (RT#130247)
- Fix a memory leak in IO::Poll (RT#129788)
- Fix regular expression matching (RT#130307)- Fix crash in Storable when deserializing malformed code reference
  (RT#68348, RT#130098)
- Fix crash on explicit return from regular expression substitution (RT#130188)
- Tighten dependencies between architecture specific sub-packages to ISA
- Fix assigning split() return values to an array
- Fix const correctness in hv_func.h (bug #1242980)- Tie perl-Errno release to interpreter build because of kernel version check
  (bug #1393421)- Fix crash in "evalbytes S" (RT#129196)
- Fix crash in splice (RT#129164, RT#129166, RT#129167)
- Fix string overrun in Perl_gv_fetchmethod_pvn_flags (RT#129267)
- Fix crash when matching UTF-8 string with non-UTF-8 substrings (RT#129350)
- Fix parsing perl options in shell bang line (RT#129336)
- Fix firstchar bitmap under UTF-8 with prefix optimization (RT#129950)
- Avoid infinite loop in h2xs tool if enum and type have the same name
  (RT130001)
- Fix stack handling when calling chdir without an argument (RT#129130)- perl-core depends on Parse::CPAN::Meta module instead of package name to allow
  upgrading perl-CPAN-Meta to 2.150010 (bug #1370681)- Avoid loading of modules from current directory, CVE-2016-1238, (bug #1360425)- Fix handling \N{} in tr for characters in range 128--255 (RT#128734)- Fix building without perl in the build root
- Own systemtap directories by perl-devel- Fix a crash in lexical scope warnings (RT#128597)- Fix a crash in "Subroutine redefined" warning (RT#128257)- Fix a crash when vivifying a stub in a deleted package (RT#128532)- Do not let XSLoader load relative paths (CVE-2016-6185)- Fix line numbers with perl -x (RT#128508)- Do not crash when inserting a non-stash into a stash (RT#128238)- Do not use unitialized memory in $h{\const} warnings (RT#128189)
- Fix precedence in hv_ename_delete (RT#128086)
- Do not treat %: as a stash (RT#128238)- Fix compiling regular expressions like /\X*(?0)/ (RT#128109)- Do not mangle errno from failed socket calls (RT#128316)- Fix a memory leak when compiling a regular expression with a POSIX class
  (RT#128313)- Remove reflexive dependencies
- Use pregenerated dependencies on bootstrapping
- Specify more build-time dependencies- Stop providing old perl(MODULE_COMPAT_5.22.*)
- Update license tags- 5.24.0 bump (see <http://search.cpan.org/dist/perl-5.24.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages; Update or remove patches- 5.22.2 bump (see <http://search.cpan.org/dist/perl-5.22.2/pod/perldelta.pod>
  for release notes)- Weak perl-Encode-devel dependency on perl-devel to Recommends level
  (bug #1129443)
- Remove perl-ExtUtils-ParseXS dependency on perl-devel (bug #1129443)
- Require perl-devel by perl-ExtUtils-MakeMaker
- Provide MM::maybe_command independently (bug #1129443)
- Replace ExtUtils::MakeMaker dependency with ExtUtils::MM::Utils in IPC::Cmd
  (bug #1129443)
- Remove perl-ExtUtils-Install dependency on �x�������������Ȓ�������X0��(
��������(�������]�$M����������������]\^�1-0.1Karel Zak <kzak@redhat.com> 2.13-4Karel Zak <kzak@redhat.com> 2.13-3Karel Zak <kzak@redhat.com> 2.13-2Karel Zak <kzak@redhat.com> 2.13-1Karel Zak <kzak@redhat.com> 2.13-0.59Jesse Keating <jkeating@redhat.com>  2.13-0.58Karel Zak <kzak@redhat.com>  2.13-0.57Karel Zak <kzak@redhat.com> 2.13-0.56Karel Zak <kzak@redhat.com> 2.13-0.55Karel Zak <kzak@redhat.com> 2.13-0.54Karel Zak <kzak@redhat.com> 2.13-0.53Karel Zak <kzak@redhat.com> 2.13-0.52Karel Zak <kzak@redhat.com> 2.13-0.51David Zeuthen <davidz@redhat.com> 2.13-0.50Karel Zak <kzak@redhat.com> 2.13-0.49Karel Zak <kzak@redhat.com> 2.13-0.48Karel Zak <kzak@redhat.com> 2.13-0.47Karel Zak <kzak@redhat.com> 2.13-0.46Karel Zak <kzak@redhat.com> 2.13-0.45Karel Zak <kzak@redhat.com> 2.13-0.44Jesse Keating <jkeating@redhat.com> - 2.13-0.43Karel Zak <kzak@redhat.com> 2.13-0.42Karel Zak <kzak@redhat.com> 2.13-0.41Karel Zak <kzak@redhat.com> 2.13-0.40Karel Zak <kzak@redhat.com> 2.13-0.39Dan Walsh <dwalsh@redhat.com> 2.13-0.38Karel Zak <kzak@redhat.com> 2.13-0.37Karel Zak <kzak@redhat.com> 2.13-0.36Steve Dickson <steved@redhat.com> 2.13-0.35Karel Zak <kzak@redhat.com> 2.13-0.34Karel Zak <kzak@redhat.com> 2.13-0.33Karel Zak <kzak@redhat.com> 2.13-0.32Jesse Keating <jkeating@redhat.com> - 2.13-0.31.1Karel Zak <kzak@redhat.com> 2.13-0.31Karsten Hopp <karsten@redhat.de> 2.13-0.30Karel Zak <kzak@redhat.com> 2.13-0.29 Florian La Roche <laroche@redhat.com> 2.13-0.28Dan Walsh <dwalsh@RedHat.com> 2.13-0.27Steve Dickson <steved@redhat.com> 2.13-0.26Karel Zak <kzak@redhat.com> 2.13-0.25Dan Walsh <dwalsh@RedHat.com> 2.13-0.24Steve Dickson <steved@redhat.com> 2.13-0.23Steve Dickson <steved@redhat.com> 2.13-0.22Steve Dickson <steved@redhat.com> 2.13-0.21Jesse Keating <jkeating@redhat.com> 2.13-0.20Jesse Keating <jkeating@redhat.com> 2.13-0.19Karel Zak <kzak@redhat.com> 2.13-0.17Karel Zak <kzak@redhat.com> 2.13-0.16Jesse Keating <jkeating@redhat.com> - 2.13-0.15.1Peter Jones <pjones@redhat.com> 2.13-0.15Jesse Keating <jkeating@redhat.com> - 2.13-0.14.1Steve Dickson <steved@redhat.com> 2.13-0.14Karel Zak <kzak@redhat.com> 2.13-0.13Karel Zak <kzak@redhat.com> 2.13-0.12Jesse Keating <jkeating@redhat.com>Karel Zak <kzak@redhat.com> 2.13-0.11.pre6Karel Zak <kzak@redhat.com> 2.13-0.10.pre5Karel Zak <kzak@redhat.com> 2.13-0.9.pre5Karel Zak <kzak@redhat.com> 2.13-0.8.pre5Karel Zak <kzak@redhat.com> 2.13-0.7.pre5Karel Zak <kzak@redhat.com> 2.13-0.6.pre5Karel Zak <kzak@redhat.com> 2.13-0.5.pre4Karel Zak <kzak@redhat.com> 2.13-0.4.pre4Steve Dickson <steved@redhat.com> 2.13-0.3.pre3Karel Zak <kzak@redhat.com> 2.13-0.3.pre2Karel Zak <kzak@redhat.com> 2.13-0.2.pre2Karel Zak <kzak@redhat.com> 2.12p-9.7Karel Zak <kzak@redhat.com> 2.12p-9.5Jeremy Katz <katzj@redhat.com> - 2.12p-9.3Karel Zak <kzak@redhat.com> 2.12p-9.2Karel Zak <kzak@redhat.com> 2.12p-9Karel Zak <kzak@redhat.com> 2.12p-8Karel Zak <kzak@redhat.com> 2.12p-7Steve Dickson <SteveD@RedHat.com> 2.12p-5Karel Zak <kzak@redhat.com> 2.12p-4Elliot Lee <sopwith@redhat.com> 2.12p-3Steve Dickson <SteveD@RedHat.com> 2.12p-2Elliot Lee <sopwith@redhat.com> 2.12p-1Elliot Lee <sopwith@redhat.com> 2.12j-1Steve Dickson <SteveD@RedHat.com> 2.12a-20Elliot Lee <sopwith@redhat.com> 2.12a-19Steve Dickson <SteveD@RedHat.com> 2.12a-18Elliot Lee <sopwith@redhat.com> 2.12a-16Stephen C. Tweedie <sct@redhat.com> - 2.12a-15John (J5) Palmieri <johnp@redhat.com> 2.12a-14Stephen C. Tweedie <sct@redhat.com> 2.12a-13Phil Knirsch <pknirsch@redhat.com> 2.12a-12Steve Dickson <SteveD@RedHat.com>Elliot Lee <sopwith@redhat.com> 2.12a-10Steve Dickson <SteveD@RedHat.com>Nalin Dahybhai <nalin@redhat.com> 2.12a-8Phil Knirsch <pknirsch@redhat.com> 2.12a-7Elliot Lee <sopwith@redhat.com> 2.12a-6Steve Dickson <SteveD@RedHat.com>Alasdair Kergon <agk@redhat.com>Alasdair Kergon <agk@redhat.com>Steve Dickson <SteveD@RedHat.com>Jindrich Novy <jnovy@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12a-1Dan Walsh�x�������������@��������X1��(
��������=
�V�$d�����������������V�V�V�of a key-id arg.
- Add per-UID get_persistent keyring function.- Fix the request-key.conf.5 manpage.
- Fix the max depth of key tree dump (keyctl show).
- The input buffer size for keyctl padd and pinstantiate should be larger.
- Add keyctl_invalidate.3 manpage.- Fix a Makefile error.- Fix the keyctl padd command and similar to handle binary input.
- Make keyctl show able to take a keyring to dump.
- Make keyctl show able to take a flag to request hex key IDs.
- Make keyctl show print the real ID of the root keyring.- Allow /sbin/request-key to have multiple config files.- Adjust the manual page for 'keyctl unlink' to show keyring is optional.
- Add --version support for the keyutils version and build date.- Make the keyutils rpm depend on the same keyutils-libs rpm version.- Use correct format spec for printing pointer subtraction results.- Fix unread variables.
- Licence file update.- Disable RPATH setting in Makefile.
- Add -I. to build to get this keyutils.h.
- Make CFLAGS override on make command line work right.
- Make specfile UTF-8.
- Support KEYCTL_REJECT.
- Support KEYCTL_INSTANTIATE_IOV.
- Add AFSDB DNS lookup program from Wang Lei.
- Generalise DNS lookup program.
- Add recursive scan utility function.
- Add bad key reap command to keyctl.
- Add multi-unlink variant to keyctl unlink command.
- Add multi key purge command to keyctl.
- Handle multi-line commands in keyctl command table.
- Move the package to version to 1.5.- Make build guess at default libdirs and word size.
- Make program build depend on library in Makefile.
- Don't include $(DESTDIR) in MAN* macros.
- Remove NO_GLIBC_KEYSYS as it is obsolete.
- Have Makefile extract version info from specfile and version script.
- Provide RPM build rule in Makefile.
- Provide distclean rule in Makefile.- Fix local linking and RPATH.- Fix prototypes in manual pages (some char* should be void*).
- Rename the keyctl_security.3 manpage to keyctl_get_security.3.- Fix the library naming wrt the version.
- Move the package to version to 1.4.- Fix spelling mistakes in manpages.
- Add an index manpage for all the keyctl functions.- Fix rpmlint warnings.- Fix compiler warnings in request-key.
- Expose the kernel function to get a key's security context.
- Expose the kernel function to set a processes keyring onto its parent.
- Move libkeyutils library version to 1.3.- Remove syscall manual pages (section 2) to man-pages package [BZ 203582]
- Don't write to serial port in debugging script- Call ldconfig during (un)installation.- Don't include the release number in the shared library filename
- Don't build static library- More bug fixes from Fedora reviewer.- Fix rpmlint errors- Add build dependency on glibc-kernheaders with key management syscall numbers- Add data pipe-in facility for keyctl request2- Rename library and header file "keyutil" -> "keyutils" for consistency
- Fix shared library version naming to same way as glibc.
- Add versioning for shared library symbols
- Create new keyutils-libs package and install library and main symlink there
- Install base library symlink in /usr/lib and place in devel package
- Added a keyutils archive library
- Shorten displayed key permissions list to just those we actually have- Add data pipe-in facilities for keyctl add, update and instantiate- Added stdint.h inclusion in keyutils.h
- Made request-key.c use request_key() rather than keyctl_search()
- Added piping facility to request-key- Added timeout keyctl option
- request_key auth keys must now be assumed
- Fix keyctl argument ordering for debug negate line in request-key.conf- Must invoke initialisation from perror() override in libkeyutils
- Minor UI changes- Bump version to permit building in main repositories.- Don't attempt to define the error codes in the header file.
- Pass the release ID through to the makefile to affect the shared library name.- Build in the perror() override to get the key error strings displayed.- Need a defattr directive after each files directive.- Package creation.�x��������������q�������X2�(
��������������m�$}����������������mln�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()cacsdadeeseteufifrglhrhuiditjanlplptruslsvtrukvizhzh2.32.1-46.el82.1.60.52.32.1-46.el82.32.1-46.el82.32.1-46.el8

2.1.50.52.19�x�������������0a�������X3�(
������������������$����������������������� terminal does not support UTF-8 (RhBug:1332012)
  (Michal Luscon)
- Revert "spec: follow new packaging guidelines & make compatible with el7"
  (Michal Luscon)
- move autoglob feature directly to filterm() and filter() (Michael Mraka)
- group: treat mandatory pkgs as mandatory if strict=true (RhBug:1292892)
  (Michal Luscon)
- locks: fix lock paths in tmpfsd config since cachedir has been changed
  (Michal Luscon)
- remove formating from translation strings (Michal Luscon)
- base: set diskspace check filter before applying the filters (RhBug:1328674)
  (Michal Luscon)
- order repos by priority and cost (Michael Mraka)
- spec: follow new packaging guidelines & make compatible with el7 (Igor
  Gnatenko)
- bash-completion: first try to set fallback to BASH_COMPLETION_COMPATDIR (Igor
  Gnatenko)
- updated copyrights for files changed this year (Michael Mraka)
- cli: fix warning from re.split() about non-empty pattern (RhBug:1286556)
  (Igor Gnatenko)
- update authors file (Michal Luscon)
- Define __hash__ method for YumHistoryPackage (RhBug:1245121) (Max Prokhorov)- refactor: repo: add md_expired property (Michal Domonkos)
- test: fix cachedir usage in LocalRepoTest (Michal Domonkos)
- clean: operate on all cached repos (RhBug:1278225) (Michal Domonkos)
- refactor: repo: globally define valid repoid chars (Michal Domonkos)
- RepoPersistor: only write to disk when requested (Michal Domonkos)
- clean: remove dead subcommands (Michal Domonkos)
- doc: --best in case of problem (RhBug:1309408) (Jan Silhan)
- Added fix for correct error message for group info (RhBug:1209649) (Abhijeet
  Kasurde)
- repo: don't get current timeout for librepo (RhBug:1272977) (Igor Gnatenko)
- doc: fix default timeout value (Michal Luscon)
- cli: inform only about nonzero md cache check interval (Michal Luscon)
- base: report errors in batch at the end of md downloading (Michal Luscon)
- repo: produce more sane error if md download fails (Michal Luscon)
- zanata update (RhBug:1322226) (Jan Silhan)
- doc: Fixed syntax of `assumeyes` and `defaultyes` ref lables in
  `conf_ref.rst` (Matt Sturgeon)
- Fix output headers for dnf history command (Michael Dunphy)
- doc: change example of 'dnf-command(repoquery)' (Jaroslav Mracek)
- makacache.service: shorten journal logs (RhBug:1315349) (Michal Luscon)
- config: improve UX of error msg (Michal Luscon)
- Added user friendly message for out of range value (RhBug:1214562) (Abhijeet
  Kasurde)
- doc: prefer repoquery to list (Jan Silhan)
- history: fix empty history cmd (RhBug:1313215) (Michal Luscon)
- Very minor tweak to the docs for `--assumeyes` and `--assumeno` (Matt
  Sturgeon)- Add `/etc/distro.repos.d` as a path owned by the dnf package (Neal Gompa
  (ニール・ゴンパ))
- Change order of search and add new default repodirs (RhBug:1286477) (Neal
  Gompa (ニール・ゴンパ))
- group: don't mark available packages as installed (RhBug:1305356) (Jan
  Silhan)
- history: adjust demands for particular subcommands (RhBug:1258503) (Michal
  Luscon)
- Added extension command for group list (RhBug:1283432) (Abhijeet Kasurde)
- perf: dnf repository-packages <repo> upgrade (RhBug:1306304) (Jan Silhan)
- sack: Pass base.conf.substitutions["arch"] to sack in build_sack() function.
  (Daniel Mach)
- build: make python2/3 binaries at build time (Michal Domonkos)
- fix dnf history traceback (RhBug:1303149) (Jan Silhan)
- cli: truncate expiration msg (RhBug:1302217) (Michal Luscon)- history: don't fail if there is no history (RhBug:1291895) (Michal Luscon)
- Allow dnf to use a socks5 proxy, since curl support it (RhBug:1256587)
  (Michael Scherer)
- output: do not log rpm info twice (RhBug:1287221) (Michal Luscon)
- dnf owns /var/lib/dnf dir (RhBug:1294241) (Jan Silhan)
- Fix handling of repo that never expire (RhBug:1289166) (Jaroslav Mracek)
- Filter out .src packages when multilib_proto=all (Jeff Smith)
- Enable string for translation (RhBug:1294355) (Parag Nemade)
- Let logging format messages on demand (Ville Skyttä)
- clean: include metadata of local repos (RhBug:12�x��������������P�������X4��(
��x�f�$v����������������feg�2.13-pre7)
- more than 70 Fedora/RHEL patches have been merged to upstream code- fix #150493 - hwclock --systohc sets clock 0.5 seconds slow
- fix #220873 - starting RPC idmapd: Error: RPC MTAB does not exist.
		(added rpc_pipefs to util-linux-2.13-umount-sysfs.patch)
- fix #227903 - mount -f does not work with NFS-mounted- include ConsoleKit session module by default (#229172)- fix #222293 - undocumented partx,addpart, delpart- fix paths in po/Makefile.in.in- fix #217240 - namei ignores non-directory components instead of saying "Not a directory"
- fix #217241 - namei enforces symlink limits inconsistently- fix leaking file descriptor in the more command (patch by Steve Grubb)- use ncurses only
- fix #218915 - fdisk -b 4K
- upgrade to -pre7 release
- fix building problem with raw0 patch
- fix #217186 - /bin/sh: @MKINSTALLDIRS@: No such file or directory 
  (port po/Makefile.in.in from gettext-0.16)
- sync with FC6 and RHEL5:
- fix #216489 - SCHED_BATCH option missing in chrt
- fix #216712 - issues with raw device support ("raw0" is wrong device name)
- fix #216760 - mount with context or fscontext option fails
  (temporarily disabled the support for additional contexts -- not supported by kernel yet)
- fix #211827 - Can't mount with additional contexts
- fix #213127 - mount --make-unbindable does not work
- fix #211749 - add -r option to losetup to create a read-only loop- fix #209911 - losetup.8 updated (use dm-crypt rather than deprecated cryptoloop)
- fix #210338 - spurious error from '/bin/login -h $PHONENUMBER' (bug in IPv6 patch)
- fix #208634 - mkswap "works" without warning on a mounted device- rebuilt for unwind info generation, broken in gcc-4.1.1-21- remove obsolete NFS code and patches (we use /sbin/mount.nfs
  and /sbin/umount.nfs from nfs-utils now)
- move nfs.5 to nfs-utils- fix #205038 - mount not allowing sloppy option (exports "-s"
  to external /sbin/mount.nfs(4) calls) 
- fix minor bug in util-linux-2.13-mount-twiceloop.patch
- fix #188193- util-linux should provide plugin infrastructure for HAL- fix Makefile.am in util-linux-2.13-mount-context.patch
- fix #201343 - pam_securetty requires known user to work
		(split PAM login configuration to two files)
- fix #203358 - change location of taskset binary to allow for early affinity work- fix #199745 - non-existant simpleinit(8) mentioned in ctrlaltdel(8)- Change keycreate line to happen after pam_selinux open call so it gets correct context- fix #176494 - last -i returns strange IP addresses (patch by Bill Nottingham)- fix #198300, #199557 - util-linux "post" scriptlet failure- Added the -o fsc flag to nfsmount.- rebuild- add Requires(post): libselinux- add IPv6 support to the login command (patch by Milan Zazrivec)
- fix #198626 - add keyinit instructions to the login PAM script 
  (patch by David Howells)- rebuild- cleanup dependences for post and preun scriptlets- silence install in minimal buildroot without /var/log- include the raw command for RHELs- move install-info parts from postun to preun- Only execute chcon on machines with selinux enabled- Remove unneeded header files from nfsmount.c- fix #187014 - umount segfaults for normal user
- fix #183446 - cal not UTF-8-aware
- fix #186915 - mount does not translate SELIinux context options though libselinux
- fix #185500 - Need man page entry for -o context= mount option
- fix #152579 - missing info about /etc/mtab and /proc/mounts mismatch
- fix #183890 - missing info about possible ioctl() and fcntl() problems on NFS filesystem
- fix #191230 - using mount --move results in wrong data in /etc/mtab
- added mount subtrees support
- fdisk: wrong number of sectors for large disks (suse#160822)
- merge fdisk-xvd (#182553) with new fdisk-isfull (#188981) patch 
- fix #181549 - raw(8) manpage has old information about dd
- remove asm/page.h usage- Remove requirement on restorecon, since we can do the same thing
- with chcon/matchpathcon, and not add requirement on policycoreutils- Fixed bug in patch for bz183713 which cause nfs4 mounts to fail.- Ad�x������������� @�������X5�(
���������Z������c�$s����������������cbd�ix #177331 - login omits pam_acct_mgmt & pam_chauthtok when authentication is skipped.
- fix #177523 - umount -a should not unmount sysfs
- fix #182553 - fdisk -l inside xen guest shows no disks- bump again for double-long bug on ppc(64)- add "blockdev --rmpart N <device>" and "blockdev --rmparts <device>"- rebuilt for new gcc4.1 snapshot and glibc changes- Updated the gssd_check() and idmapd_check(), used with
  nfsv4 mounts, to looked for the correct file in /var/lock/subsys
  which stops bogus warnings.- fix #174676 - hwclock audit return code mismatch
- fix #176441: col truncates data
- fix #174111 - mount allows loopback devices to be mounted more than once to the same mount point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
		is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only use reserve ports when necessary
  (bz# 141773)- Update to util-linux-2.12p. This changes swap header format
  from - you may need to rerun mkswap if you did a clean install of
  FC3.- Upda�x��������������/�������X6n�(
xp�xd�$h����������������xdydwd�.gzBIO_meth_set_destroy.3ssl.gzBIO_meth_set_gets.3ssl.gzBIO_meth_set_puts.3ssl.gzBIO_meth_set_read.3ssl.gzBIO_meth_set_read_ex.3ssl.gzBIO_meth_set_write.3ssl.gzBIO_meth_set_write_ex.3ssl.gzBIO_method_type.3ssl.gzBIO_new.3ssl.gzBIO_new_CMS.3ssl.gzBIO_new_accept.3ssl.gzBIO_new_bio_pair.3ssl.gzBIO_new_buffer_ssl_connect.3ssl.gzBIO_new_connect.3ssl.gzBIO_new_fd.3ssl.gzBIO_new_file.3ssl.gzBIO_new_fp.3ssl.gzBIO_new_mem_buf.3ssl.gzBIO_new_socket.3ssl.gzBIO_new_ssl.3ssl.gzBIO_new_ssl_connect.3ssl.gzBIO_next.3ssl.gzBIO_parse_hostserv.3ssl.gzBIO_pending.3ssl.gzBIO_pop.3ssl.gzBIO_printf.3ssl.gzBIO_ptr_ctrl.3ssl.gzBIO_push.3ssl.gzBIO_puts.3ssl.gzBIO_read.3ssl.gzBIO_read_ex.3ssl.gzBIO_read_filename.3ssl.gzBIO_reset.3ssl.gzBIO_retry_type.3ssl.gzBIO_rw_filename.3ssl.gzBIO_s_accept.3ssl.gzBIO_s_bio.3ssl.gzBIO_s_connect.3ssl.gzBIO_s_fd.3ssl.gzBIO_s_file.3ssl.gzBIO_s_mem.3ssl.gzBIO_s_null.3ssl.gzBIO_s_secmem.3ssl.gzBIO_s_socket.3ssl.gzBIO_seek.3ssl.gzBIO_set_accept_bios.3ssl.gzBIO_set_accept_ip_family.3ssl.gzBIO_set_accept_name.3ssl.gzBIO_set_accept_port.3ssl.gzBIO_set_bind_mode.3ssl.gzBIO_set_buffer_read_data.3ssl.gzBIO_set_buffer_size.3ssl.gzBIO_set_callback.3ssl.gzBIO_set_callback_arg.3ssl.gzBIO_set_callback_ex.3ssl.gzBIO_set_cipher.3ssl.gzBIO_set_close.3ssl.gzBIO_set_conn_address.3ssl.gzBIO_set_conn_hostname.3ssl.gzBIO_set_conn_ip_family.3ssl.gzBIO_set_conn_port.3ssl.gzBIO_set_data.3ssl.gzBIO_set_ex_data.3ssl.gzBIO_set_fd.3ssl.gzBIO_set_fp.3ssl.gzBIO_set_info_callback.3ssl.gzBIO_set_init.3ssl.gzBIO_set_md.3ssl.gzBIO_set_mem_buf.3ssl.gzBIO_set_mem_eof_return.3ssl.gzBIO_set_nbio.3ssl.gzBIO_set_nbio_accept.3ssl.gzBIO_set_next.3ssl.gzBIO_set_read_buffer_size.3ssl.gzBIO_set_retry_reason.3ssl.gzBIO_set_shutdown.3ssl.gzBIO_set_ssl.3ssl.gzBIO_set_ssl_mode.3ssl.gzBIO_set_ssl_renegotiate_bytes.3ssl.gzBIO_set_ssl_renegotiate_timeout.3ssl.gzBIO_set_write_buf_size.3ssl.gzBIO_set_write_buffer_size.3ssl.gzBIO_should_io_special.3ssl.gzBIO_should_read.3ssl.gzBIO_should_retry.3ssl.gzBIO_should_write.3ssl.gzBIO_shutdown_wr.3ssl.gzBIO_snprintf.3ssl.gzBIO_socket.3ssl.gzBIO_ssl_copy_session_id.3ssl.gzBIO_ssl_shutdown.3ssl.gzBIO_tell.3ssl.gzBIO_up_ref.3ssl.gzBIO_vfree.3ssl.gzBIO_vprintf.3ssl.gzBIO_vsnprintf.3ssl.gzBIO_wpending.3ssl.gzBIO_write.3ssl.gzBIO_write_ex.3ssl.gzBIO_write_filename.3ssl.gzBN_BLINDING_convert.3ssl.gzBN_BLINDING_convert_ex.3ssl.gzBN_BLINDING_create_param.3ssl.gzBN_BLINDING_free.3ssl.gzBN_BLINDING_get_flags.3ssl.gzBN_BLINDING_invert.3ssl.gzBN_BLINDING_invert_ex.3ssl.gzBN_BLINDING_is_current_thread.3ssl.gzBN_BLINDING_lock.3ssl.gzBN_BLINDING_new.3ssl.gzBN_BLINDING_set_current_thread.3ssl.gzBN_BLINDING_set_flags.3ssl.gzBN_BLINDING_unlock.3ssl.gzBN_BLINDING_update.3ssl.gzBN_CTX_end.3ssl.gzBN_CTX_free.3ssl.gzBN_CTX_get.3ssl.gzBN_CTX_new.3ssl.gzBN_CTX_secure_new.3ssl.gzBN_CTX_start.3ssl.gzBN_GENCB_call.3ssl.gzBN_GENCB_free.3ssl.gzBN_GENCB_get_arg.3ssl.gzBN_GENCB_new.3ssl.gzBN_GENCB_set.3ssl.gzBN_GENCB_set_old.3ssl.gzBN_MONT_CTX_copy.3ssl.gzBN_MONT_CTX_free.3ssl.gzBN_MONT_CTX_new.3ssl.gzBN_MONT_CTX_set.3ssl.gzBN_RECP_CTX_free.3ssl.gzBN_RECP_CTX_new.3ssl.gzBN_RECP_CTX_set.3ssl.gzBN_add.3ssl.gzBN_add_word.3ssl.gzBN_bin2bn.3ssl.gzBN_bn2bin.3ssl.gzBN_bn2binpad.3ssl.gzBN_bn2dec.3ssl.gzBN_bn2hex.3ssl.gzBN_bn2lebinpad.3ssl.gzBN_bn2mpi.3ssl.gzBN_clear.3ssl.gzBN_clear_bit.3ssl.gzBN_clear_free.3ssl.gzBN_cmp.3ssl.gzBN_copy.3ssl.gzBN_dec2bn.3ssl.gzBN_div.3ssl.gzBN_div_recp.3ssl.gzBN_div_word.3ssl.gzBN_dup.3ssl.gzBN_exp.3ssl.gzBN_free.3ssl.gzBN_from_montgomery.3ssl.gzBN_gcd.3ssl.gzBN_generate_prime.3ssl.gzBN_generate_prime_ex.3ssl.gzBN_get0_nist_prime_192.3ssl.gzBN_get0_nist_prime_224.3ssl.gzBN_get0_nist_prime_256.3ssl.gzBN_get0_nist_prime_384.3ssl.gzBN_get0_nist_prime_521.3ssl.gzBN_get_rfc2409_prime_1024.3ssl.gzBN_get_rfc2409_prime_768.3ssl.gzBN_get_rfc3526_prime_1536.3ssl.gzBN_get_rfc3526_prime_2048.3ssl.gzBN_get_rfc3526_prime_3072.3ssl.gzBN_get_rfc3526_prime_409�x��������������������X7m�(
@���������yd�$i����������������ydzdxd�TIME_to_tm.3ssl.gzASN1_TYPE_cmp.3ssl.gzASN1_TYPE_get.3ssl.gzASN1_TYPE_pack_sequence.3ssl.gzASN1_TYPE_set.3ssl.gzASN1_TYPE_set1.3ssl.gzASN1_TYPE_unpack_sequence.3ssl.gzASN1_UTCTIME_adj.3ssl.gzASN1_UTCTIME_check.3ssl.gzASN1_UTCTIME_cmp_time_t.3ssl.gzASN1_UTCTIME_print.3ssl.gzASN1_UTCTIME_set.3ssl.gzASN1_UTCTIME_set_string.3ssl.gzASN1_add_oid_module.3ssl.gzASN1_generate_nconf.3ssl.gzASN1_generate_v3.3ssl.gzASN1_tag2str.3ssl.gzASRange_free.3ssl.gzASRange_new.3ssl.gzASYNC_WAIT_CTX_clear_fd.3ssl.gzASYNC_WAIT_CTX_free.3ssl.gzASYNC_WAIT_CTX_get_all_fds.3ssl.gzASYNC_WAIT_CTX_get_changed_fds.3ssl.gzASYNC_WAIT_CTX_get_fd.3ssl.gzASYNC_WAIT_CTX_new.3ssl.gzASYNC_WAIT_CTX_set_wait_fd.3ssl.gzASYNC_block_pause.3ssl.gzASYNC_cleanup_thread.3ssl.gzASYNC_get_current_job.3ssl.gzASYNC_get_wait_ctx.3ssl.gzASYNC_init_thread.3ssl.gzASYNC_is_capable.3ssl.gzASYNC_pause_job.3ssl.gzASYNC_start_job.3ssl.gzASYNC_unblock_pause.3ssl.gzAUTHORITY_INFO_ACCESS_free.3ssl.gzAUTHORITY_INFO_ACCESS_new.3ssl.gzAUTHORITY_KEYID_free.3ssl.gzAUTHORITY_KEYID_new.3ssl.gzBASIC_CONSTRAINTS_free.3ssl.gzBASIC_CONSTRAINTS_new.3ssl.gzBF_cbc_encrypt.3ssl.gzBF_cfb64_encrypt.3ssl.gzBF_decrypt.3ssl.gzBF_ecb_encrypt.3ssl.gzBF_encrypt.3ssl.gzBF_ofb64_encrypt.3ssl.gzBF_options.3ssl.gzBF_set_key.3ssl.gzBIO_ADDR.3ssl.gzBIO_ADDRINFO.3ssl.gzBIO_ADDRINFO_address.3ssl.gzBIO_ADDRINFO_family.3ssl.gzBIO_ADDRINFO_free.3ssl.gzBIO_ADDRINFO_next.3ssl.gzBIO_ADDRINFO_protocol.3ssl.gzBIO_ADDRINFO_socktype.3ssl.gzBIO_ADDR_clear.3ssl.gzBIO_ADDR_family.3ssl.gzBIO_ADDR_free.3ssl.gzBIO_ADDR_hostname_string.3ssl.gzBIO_ADDR_new.3ssl.gzBIO_ADDR_path_string.3ssl.gzBIO_ADDR_rawaddress.3ssl.gzBIO_ADDR_rawmake.3ssl.gzBIO_ADDR_rawport.3ssl.gzBIO_ADDR_service_string.3ssl.gzBIO_accept_ex.3ssl.gzBIO_append_filename.3ssl.gzBIO_bind.3ssl.gzBIO_callback_ctrl.3ssl.gzBIO_callback_fn.3ssl.gzBIO_callback_fn_ex.3ssl.gzBIO_closesocket.3ssl.gzBIO_connect.3ssl.gzBIO_ctrl.3ssl.gzBIO_ctrl_get_read_request.3ssl.gzBIO_ctrl_get_write_guarantee.3ssl.gzBIO_ctrl_pending.3ssl.gzBIO_ctrl_reset_read_request.3ssl.gzBIO_ctrl_wpending.3ssl.gzBIO_debug_callback.3ssl.gzBIO_destroy_bio_pair.3ssl.gzBIO_do_accept.3ssl.gzBIO_do_connect.3ssl.gzBIO_do_handshake.3ssl.gzBIO_eof.3ssl.gzBIO_f_base64.3ssl.gzBIO_f_buffer.3ssl.gzBIO_f_cipher.3ssl.gzBIO_f_md.3ssl.gzBIO_f_null.3ssl.gzBIO_f_ssl.3ssl.gzBIO_find_type.3ssl.gzBIO_flush.3ssl.gzBIO_free.3ssl.gzBIO_free_all.3ssl.gzBIO_get_accept_ip_family.3ssl.gzBIO_get_accept_name.3ssl.gzBIO_get_accept_port.3ssl.gzBIO_get_bind_mode.3ssl.gzBIO_get_buffer_num_lines.3ssl.gzBIO_get_callback.3ssl.gzBIO_get_callback_arg.3ssl.gzBIO_get_callback_ex.3ssl.gzBIO_get_cipher_ctx.3ssl.gzBIO_get_cipher_status.3ssl.gzBIO_get_close.3ssl.gzBIO_get_conn_address.3ssl.gzBIO_get_conn_hostname.3ssl.gzBIO_get_conn_ip_family.3ssl.gzBIO_get_conn_port.3ssl.gzBIO_get_data.3ssl.gzBIO_get_ex_data.3ssl.gzBIO_get_ex_new_index.3ssl.gzBIO_get_fd.3ssl.gzBIO_get_fp.3ssl.gzBIO_get_info_callback.3ssl.gzBIO_get_init.3ssl.gzBIO_get_md.3ssl.gzBIO_get_md_ctx.3ssl.gzBIO_get_mem_data.3ssl.gzBIO_get_mem_ptr.3ssl.gzBIO_get_new_index.3ssl.gzBIO_get_num_renegotiates.3ssl.gzBIO_get_peer_name.3ssl.gzBIO_get_peer_port.3ssl.gzBIO_get_read_request.3ssl.gzBIO_get_retry_BIO.3ssl.gzBIO_get_retry_reason.3ssl.gzBIO_get_shutdown.3ssl.gzBIO_get_ssl.3ssl.gzBIO_get_write_buf_size.3ssl.gzBIO_get_write_guarantee.3ssl.gzBIO_gets.3ssl.gzBIO_hostserv_priorities.3ssl.gzBIO_info_cb.3ssl.gzBIO_int_ctrl.3ssl.gzBIO_listen.3ssl.gzBIO_lookup.3ssl.gzBIO_lookup_ex.3ssl.gzBIO_lookup_type.3ssl.gzBIO_make_bio_pair.3ssl.gzBIO_meth_free.3ssl.gzBIO_meth_get_callback_ctrl.3ssl.gzBIO_meth_get_create.3ssl.gzBIO_meth_get_ctrl.3ssl.gzBIO_meth_get_destroy.3ssl.gzBIO_meth_get_gets.3ssl.gzBIO_meth_get_puts.3ssl.gzBIO_meth_get_read.3ssl.gzBIO_meth_get_read_ex.3ssl.gzBIO_meth_get_write.3ssl.gzBIO_meth_get_write_ex.3ssl.gzBIO_meth_new.3ssl.gzBIO_meth_set_callback_ctrl.3ssl.gzBIO_meth_set_create.3ssl.gzBIO_meth_set_ctrl.3ssl�x���������������������X8ɚ(
���������l��$u��������������������o@packit.dev> - 305-1Packit <hello@packit.dev> - 304-1Packit <hello@packit.dev> - 303-1Packit <hello@packit.dev> - 302-1Packit <hello@packit.dev> - 301-1Packit <hello@packit.dev> - 300-1Packit <hello@packit.dev> - 299-1Packit <hello@packit.dev> - 297-1Packit <hello@packit.dev> - 296-1Packit <hello@packit.dev> - 295-1Python Maint <python-maint@redhat.com> - 294.1-2Packit <hello@packit.dev> - 294.1-1Python Maint <python-maint@redhat.com> - 294-2Packit <hello@packit.dev> - 294-1Packit <hello@packit.dev> - 293-1Packit <hello@packit.dev> - 292-1Packit <hello@packit.dev> - 291-1Packit <hello@packit.dev> - 290-1Packit <hello@packit.dev> - 289-1Packit <hello@packit.dev> - 288.1-1Packit <hello@packit.dev> - 288-1Packit <hello@packit.dev> - 287-1Packit <hello@packit.dev> - 286-1Packit <hello@packit.dev> - 285-1Packit <hello@packit.dev> - 284-1Fedora Release Engineering <releng@fedoraproject.org> - 283-2Packit <hello@packit.dev> - 283-1Packit <hello@packit.dev> - 282-1Packit <hello@packit.dev> - 281-1Packit <hello@packit.dev> - 280.1-1Packit <hello@packit.dev> - 280-1Packit <hello@packit.dev> - 279-1Packit <hello@packit.dev> - 278-1Packit <hello@packit.dev> - 277-1Packit <hello@packit.dev> - 276.1-1Packit <hello@packit.dev> - 276-1Packit <hello@packit.dev> - 275-1Packit <hello@packit.dev> - 274.1-1Packit <hello@packit.dev> - 274-1Fedora Release Engineering <releng@fedoraproject.org> - 273-2Packit <hello@packit.dev> - 273-1Packit <hello@packit.dev> - 272-1Packit <hello@packit.dev> - 271-1Packit <hello@packit.dev> - 270-1Cockpit Project <cockpituous@gmail.com> - 269-1Cockpit Project <cockpituous@gmail.com> - 268.1-1Cockpit Project <cockpituous@gmail.com> - 268-1Cockpit Project <cockpituous@gmail.com> - 267-1Cockpit Project <cockpituous@gmail.com> - 266-1Cockpit Project <cockpituous@gmail.com> - 265-1Cockpit Project <cockpituous@gmail.com> - 264-1Cockpit Project <cockpituous@gmail.com> - 263-1Cockpit Project <cockpituous@gmail.com> - 262-1Cockpit Project <cockpituous@gmail.com> - 261-1Fedora Release Engineering <releng@fedoraproject.org> - 260-2Martin Pitt <mpitt@redhat.com> - 260-1Marius Vollmer <mvollmer@redhat.com> - 259-1Allison Karlitskaya <allison.karlitskaya@redhat.com> - 258-1Katerina Koukiou <kkoukiou@redhat.com> - 257-1Jelle van der Waa <jvanderwaa@redhat.com> - 256-1Martin Pitt <mpitt@redhat.com> - 255.1-1Martin Pitt <mpitt@redhat.com> - 255-1Matej Marusak <mmarusak@redhat.com> - 254-1Katerina Koukiou <kkoukiou@redhat.com> - 253-1Simon Kobyda <skobyda@redhat.com> - 252-1Marius Vollmer <mvollmer@redhat.com> - 251-1Martin Pitt <mpitt@redhat.com> - 250-1Fedora Release Engineering <releng@fedoraproject.org> - 249-2Matej Marusak <mmarusak@redhat.com> - 249-1Allison Karlitskaya <allison.karlitskaya@redhat.com> - 248-1Katerina Koukiou <kkoukiou@redhat.com> - 247-1Marius Vollmer <mvollmer@redhat.com> - 246-1Martin Pitt <mpitt@redhat.com> - 245-1Martin Pitt <mpitt@redhat.com> - 244.1-1Katerina Koukiou <kkoukiou@redhat.com> - 244-1Martin Pitt <mpitt@redhat.com> - 243-1Matej Marusak <mmarusak@redhat.com> - 242-1Simon Kobyda <skobyda@redhat.com> - 241-1Marius Vollmer <mvollmer@redhat.com> - 240-1Martin Pitt <mpitt@redhat.com> - 239-1Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 238.1-2Martin Pitt <mpitt@redhat.com> - 238.1-1Katerina Koukiou <kkoukiou@redhat.com> - 238-1Matej Marusak <mmarusak@redhat.com> - 237-1Fedora Release Engineering <releng@fedoraproject.org> - 236-2Martin Pitt <mpitt@redhat.com> - 236-1Martin Pitt <mpitt@redhat.com> - 235-1Marius Vollmer <mvollmer@redhat.com> - 234-1Katerina Koukiou <kkoukiou@redhat.com> - 233.1-1Cockpit Project <cockpituous@gmail.com> - 233-1Katerina Koukiou <kkoukiou@redhat.com> - 232-1Matej Marusak <mmarusak@redhat.com> - 231-1Sanne Raymaekers <sanne.raymaekers@gmail.com> - 230-1Marius Vollmer <mvollmer@redhat.com> - 229-1Katerina Koukiou <kkoukiou@redhat.com> - 228-1Martin Pitt <mpitt@redhat.com> - 227-1Marius Vollmer <mvollmer@redhat.com> - 226-1Matej Marusak <mmaru�x���������������������X9ۜ(
���������������P��$@����������������P�Q�O�� ~
��6���~E�`!�	�;�6
�OG;�*p9�l�!
���	�j`}�H/k�p�*A��4�7�.b��	�q!�bU�H(p)bm-������#2�4�I`<"B<��"w���	y[�2P4E�8q* �H#MKE=��2�nm���|�/��B�sR}~SI
�@�If*�0���
%
�%�����n�X�
�`	��bm�

�	����&��&���,$
��
�1�
7�5�����
�B�c�f��g�
L	+�y�����*���	I�
�&	�
C
��^[
�[��
�b�"k	Ee�
�
�
�	�jL';
�
�D	�
g
:=�L���y1tO^NI�81VQ��	D��:��M&
��+'+��?�d'^���"Rm��p��2<
I����
�(�8a�
4��6�� _��.�j��]Dv	�	.��o�V&����*�&��Q�J^<��B�%�
��E�B��?�۰�����p\�'�%�X3��P�
�
�҇��"��*�0�$���*1U!l�� ,���������)����v��+ �b�Ҍ��O�u�ďKUb �&0z݂9
�%�S1j?��u��V��Z�F�W�)dI	�L4+@�J����5� A����	��*w-��,��Vg���+a/�c�F%l�/f�1�*�X/��+ ���h�<�$�l�=:��R��V�|dV28�Ev~|I����If���HA9�٩��.fHt~�!�;���b�{��
��x&&)|!,}B;c�5O��Zz2Ƈ��4Hï]���P	n�����A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A�A���A�A�A�A�A�A�A�A�A�A�A�A�A큤��������������������A큤����A�A큤��A큤A큤����������A큤��������A큤A�A큤����A�A큤����������������������������������������������A��A��A�A��A��A��A�A�A���A�A��A��A��A��A��A�A��A��A��A��A��A�A��A�A�A��A��A��A��A큤����������������������������������������������������������A큤��������������������������������������������������A큤����A큤����A큤����������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤������A큤A큤��A큤����������������A�A큤����������A큤��������������A큤A큤A큤����A큤������A큤��������A큤��A큤����A큤��A큤A큤��A큤����������������A큤������A큤A큤����������������������A큤��������������A큤������A큤������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤�x�������������������XC�(
)��������������9������$)����������������9�:�8��r <ppisar@redhat.com> - 4:5.16.2-257Petr Pisar <ppisar@redhat.com> - 4:5.16.2-256Petr Pisar <ppisar@redhat.com> - 4:5.16.2-255Petr Pisar <ppisar@redhat.com> - 4:5.16.2-254Petr Pisar <ppisar@redhat.com> - 4:5.16.2-253Petr Pisar <ppisar@redhat.com> - 4:5.16.2-252Petr Pisar <ppisar@redhat.com> - 4:5.16.2-251Petr Pisar <ppisar@redhat.com> - 4:5.16.2-250Petr Pisar <ppisar@redhat.com> - 4:5.16.2-249Petr Pisar <ppisar@redhat.com> - 4:5.16.2-248Petr Pisar <ppisar@redhat.com> - 4:5.16.2-247Petr Pisar <ppisar@redhat.com> - 4:5.16.2-246Petr Pisar <ppisar@redhat.com> - 4:5.16.2-245Petr Pisar <ppisar@redhat.com> - 4:5.16.2-244Petr Pisar <ppisar@redhat.com> - 4:5.16.2-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.2-242Petr Pisar <ppisar@redhat.com> - 4:5.16.1-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.1-240Petr Pisar <ppisar@redhat.com> - 4:5.16.1-239Petr Pisar <ppisar@redhat.com> - 4:5.16.1-238Petr Pisar <ppisar@redhat.com> - 4:5.16.1-237Petr Pisar <ppisar@redhat.com> - 4:5.16.1-236Petr Pisar <ppisar@redhat.com> - 4:5.16.1-235Petr Pisar <ppisar@redhat.com> - 4:5.16.1-234Petr Pisar <ppisar@redhat.com> - 4:5.16.1-233Petr Pisar <ppisar@redhat.com> - 4:5.16.1-232Petr Pisar <ppisar@redhat.com> - 4:5.16.1-231Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-230Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-229Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.1-228Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.16.0-227Paul Howarth <paul@city-fan.org> 4:5.16.0-226Jitka Plesnikova <jplesnik@redhat.com> 4:5.16.0-225Petr Pisar <ppisar@redhat.com> - 4:5.16.0-224Petr Pisar <ppisar@redhat.com> - 4:5.16.0-223Petr Pisar <ppisar@redhat.com> - 4:5.16.0-222Petr Pisar <ppisar@redhat.com> - 4:5.16.0-221Petr Pisar <ppisar@redhat.com> - 4:5.16.0-220Petr Pisar <ppisar@redhat.com> - 4:5.16.0-219Jitka Plesnikova <jplesnik@redhat.com> - 4:5.16.0-218Petr Pisar <ppisar@redhat.com> - 4:5.16.0-218Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-217Marcela Mašláňová <mmaslano@redhat.com> - 4:5.16.0-RC2-217Petr Pisar <ppisar@redhat.com> - 4:5.14.2-216Petr Pisar <ppisar@redhat.com> - 4:5.14.2-215Petr Pisar <ppisar@redhat.com> - 4:5.14.2-214Petr Pisar <ppisar@redhat.com> - 4:5.14.2-213Petr Pisar <ppisar@redhat.com> - 4:5.14.2-212Petr Pisar <ppisar@redhat.com> - 4:5.14.2-211Paul Howarth <paul@city-fan.org> - 4:5.14.2-210Iain Arnell <iarnell@gmail.com> -4:5.14.2-209Paul Howarth <paul@city-fan.org> - 4:5.14.2-208Petr Pisar <ppisar@redhat.com> - 4:5.14.2-207Petr Pisar <ppisar@redhat.com> - 4:5.14.2-206Petr Pisar <ppisar@redhat.com> - 4:5.14.2-205Ville Skyttä <ville.skytta@iki.fi> - 4:5.14.2-204Petr Pisar <ppisar@redhat.com> - 4:5.14.2-203Petr Pisar <ppisar@redhat.com> - 4:5.14.2-202Petr Pisar <ppisar@redhat.com> - 4:5.14.2-201Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-200Petr Pisar <ppisar@redhat.com> - 4:5.14.2-199Petr Pisar <ppisar@redhat.com> - 4:5.14.2-198Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-197Petr Pisar <ppisar@redhat.com> - 4:5.14.2-196Petr Pisar <ppisar@redhat.com> - 4:5.14.2-195Iain Arnell <iarnell@gmail.com> 4:5.14.2-194Petr Pisar <ppisar@redhat.com> - 4:5.14.2-193Petr Pisar <ppisar@redhat.com> - 4:5.14.1-192Petr Pisar <ppisar@redhat.com> - 4:5.14.1-191Petr Pisar <ppisar@redhat.com> - 4:5.14.1-190Petr Pisar <ppisar@redhat.com> - 4:5.14.1-189Petr Pisar <ppisar@redhat.com> - 4:5.14.1-188Petr Pisar <ppisar@redhat.com> - 4:5.14.1-187Iain Arnell <iarnell@gmail.com> 4:5.14.1-186Petr Sabata <contyk@redhat.com> - 4:5.14.1-185Iain Arnell <iarnell@gmail.com> 4:5.14.1-184Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-183Paul Howarth <paul@city-fan.org> - 4:5.14.1-182Petr Sabata <contyk@redhat.com> - 4:5.14.1-181Iain Arnell <iarnell@gmail.com> 4:5.14.1-180Iain Arnell <iarnell@gmail.com> 4:5.14.1-179Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-178Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-175Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-174Iain Ar�x���������������������X;��(
������������$U��������������������ttps://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- apply patch to workaround msgfmt bug that counts warnings as errors- update to 0.19 release
- remove upstreamed -Wformat-security patch- update to 0.18.3.2 release
- apply patch to suppress -Wformat-security warnings in gnulib-tests- update to 0.18.3.1 release- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- update to 0.18.3 release- add a man page for msghack
- fix bogus date in %changelog- update to 0.18.2.1 release (not really necessary though)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- update to 0.18.2 release (based on the spec patch by Jens Petersen)- move gettextize to the devel subpackage with its source data files
- update msghack to GPL v3- patch gnulib since glibc and C11 dropped gets- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- add upstream patch from debian to fix xgettext segfault in
  remember_a_message_plural (#826138)- base package now provides bundled(gnulib) to make it clear that
  gettext is built with bundled gnulib (#821757)- add filesystem guard- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- rebuild for gcc 4.7- correct the configure --with-pic option syntax (Gilles Espinasse)- add gettext-readlink-einval.patch to fix build on kernel >= 2.6.39 (#739188)
- add optional buildrequires suggested in the DEPENDENCIES file- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- remove internal libgettextlib.so and libgettextsrc.so (#650471)- fix license field of gettext-libs since libgettextpo is GPLv3+ (#640158)- subpackage archive.git.tar.gz to avoid multilib conflicts (#631733)
- update msghack.py header- merge autopoint subpackage into devel to simplify deps (#625325)
- have ABOUT-NLS only in the base package datadir- correct license tag from GPLv3 to GPLv3+
- subpackage autopoint which requires git (#574031)
- no longer require cvs (#606746)
- add bcond for git- update to 0.18.1.1 release (#591044)
- gettext-0.17-autopoint-CVS-441481.patch, gettext-0.17-long-long-int-m4.patch
  gettext-0.17-open-args.patch, and
  gettext-xgettext-python-unicode-surrogate-473946.patch are upstream
- move libintl.jar to lib subpackage to avoid multilib problems
  (reported by Jim Radford in #595922)
- disable java for now
- use chrpath to get us out of rpath hell instead of complicated libtool hacks
- enable git support- create emacs subpackages for po-mode.el (thanks for patch from
  Jonathan Underwood, #579452)
- provide emacs-po-mode
- move libgettextlib and libgettextsrc from base to libs subpackage
  (requested by Peter Robinson for blender, #579388)- fix FTBFS by removing openmp.m4 which conflicts with recent autoconf (#539211)
- cleanup gettext-0.17-rpathFix.patch
  - separate gl_AC_TYPE_LONG_LONG replacement to another patch
  - use trailing ':' for tests LD_LIBRARY_PATH
- run autogen.sh with --quick and --skip-gnulib- bring back autopoint requires cvs (#517361)
- requires info rather than /sbin/install-info
- drop install_info and remove_install_info macros- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- buildrequire automake (#507275)
- run autogen- move intl/ and po/ to base package for gettextize
  (reported by Serge Pavlovsky, #496902)- use bcond's for build switches- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add buildjava switch to allow turning off the java bits completely
- add buildcheck to allow turning off make check
- drop cvs requires for autopoint (Karl Lattimer, #469555)
- add upstream gettext-xgettext-python-unicode-surrogate-473946.patch by
  Bruno Haible to fix xgettext handling of utf16 surrogates in python (#473946)- Fix the build failure with koji.- Remove the gettext-libs docs, as they are talking about autoconf, libtool, 
  which are not directly related to the gettext-libs.
- Remove unused definition and trailing space.
- Fix the build failure with mock .- Fixed Bug 456666 msghack doesn't check for mandatory cmd line �x������!�������X<9�(
��
 ����������$j�����������������������olves: rhbz#1896717- bootloader: do not hardcode device to initrd
  resolves: rhbz#2050246- openshift/atomic: increased nf_conntrack_hashsize
  resolves: rhbz#2052886- new release
  - rebased tuned to latest upstream
    related: rhbz#2003833
  - tuned-gui: fixed creation of new profile- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2003833
  - profiles: fix improper parsing of include directive
    resolves: rhbz#2017924
  - disk: added support for the nvme
    resolves: rhbz#1854816
  - cpu: extended cstate force_latency syntax to allow skipping zero latency
    resolves: rhbz#2002744
  - net: added support for the txqueuelen
    resolves: rhbz#2015044
  - bootloader: on s390(x) remove TuneD variables from the BLS
    resolves: rhbz#1978786
  - daemon: don't do full rollback on systemd failure
    resolves: rhbz#2011459- new release
  - rebased tuned to latest upstream
    related: rhbz#1936426- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1936426
  - realtime: "isolate_managed_irq=Y" should be mentioned in
    "/etc/tuned/realtime-virtual-*-variables.conf"
    resolves: rhbz#1817827
  - realtime: changed tuned default to "isolcpus=domain,managed_irq,X-Y"
    resolves: rhbz#1820626
  - applying a profile with multiple inheritance where parents include a common
    ancestor fails
    resolves: rhbz#1825882
  - failure in moving i40e IRQ threads to housekeeping CPUs from isolated CPUs
    resolves: rhbz#1933069
  - sort network devices before matching by regex
    resolves: rhbz#1939970
  - net: fixed traceback while adjusting the netdev queue count
    resolves: rhbz#1943291
  - net: fixed traceback if the first listed device returns netlink error
    resolves: rhbz#1944686
  - realtime: improve verification
    resolves: rhbz#1947858
  - bootloader: add support for the rpm-ostree
    resolves: rhbz#1950164
  - net: fixed traceback if a device channel contains n/a
    resolves: rhbz#1974071
  - mssql: updated the profile
    resolves: rhbz#1942733- updated mssql profile
  resolves: rhbz#1942733- realtime: added support for netdev_queue_count and extended plugin_net
  resolves: rhbz#1951992- new release
  - rebased tuned to latest upstream
    related: rhbz#1874052- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1874052
  - added plugin service for linux services control
    resolves: rhbz#1869991
  - scheduler: added default_irq_smp_affinity option
    resolves: rhbz#1896348
  - bootloader: skip boom managed BLS snippets
    resolves: rhbz#1901532
  - scheduler: added perf_process_fork option to enable processing of fork
    resolves: rhbz#1894610
  - scheduler: added perf_mmap_pages option to set perf buffer size
    resolves: rhbz#1890219
  - bootloader: fixed cmdline duplication with BLS and grub2-mkconfig
    resolves: rhbz#1777874- realtime-virtual-host: remove lapic advancement calculation and
  related qemu-kvm-tools-rhev requirement
  Resolves: rhbz#1845717- scheduler: fixed isolated_cores to work with cgroups
  related: rhbz#1784648- throughput-performance: fix performance regression on AMD platforms
  related: rhbz#1746957- new release
  - rebased tuned to latest upstream
    related: rhbz#1792264- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1792264
  - oracle: turned off NUMA balancing
    resolves: rhbz#1782233
  - man: documented the possibility to apply multiple profiles
    resolves: rhbz#1794337
  - cpu-partitioning: disabled kernel.timer_migration
    resolves: rhbz#1797629
  - profiles: new profile optimize-serial-console
    resolves: rhbz#1840689
  - added support for a post-loaded profile
    resolves: rhbz#1798183
  - plugins: new irqbalance plugin
    resolves: rhbz#1784645
  - throughput-performance: added architecture specific tuning for Marvell ThunderX
    resolves: rhbz#1746961
  - throughput-performance: added architecture specific tuning for AMD
    resolves: rhbz#1746957
  - scheduler: added support for cgroups
    resolves: rhbz#1784648- realtime: added condi�x��������������������X=��(
�������� ���������$z��������������������fix infinite loop caused by running under bash- enable makedumpfile for arm64- rebase kexec-tools-2.0.15- kexec-tools.spec: Fix whitespace errors
- dracut-module-setup: Fix test for inclusion of DRM modules
- kdump.conf.5: clarify the fence_kdump_nodes option- kdumpctl: for fence_kdump, the ipaddr of this node should be excluded- kdumpctl: change the shebang header to use /bin/bash
- kdumpctl: call strip_comments only when necessary to speedup
- Revert "kdumpctl: improve "while read" time for /etc/kdump.conf" (rhbz1449801)- kdumpctl: improve "while read" time for /etc/kdump.conf
- kdumpctl: update check_dump_fs_modified() to use "lsinitrd -f"
- kdumpctl: improve check_wdt_modified()
- kdumpctl: remove is_mode_switched()
- kdumpctl: bail out earlier in case of no reserved memory- kdump: Introduce 'force_no_rebuild' option
- kdump-lib-initramfs.sh: ignore the failure of echo
- kdump.sysconfig/x86_64: Add nokaslr to kdump kernel cmdline- kdumpctl: fix status check when CONFIG_CRASH_DUMP is not enabled in kernel
- kdumpctl: fix a bug in remove_cmdline_param()
- kdumpctl: remove "root=X" for kdump boot
- Revert "kdumpctl: filter 'root' kernel parameter when running in live images"- kdump-emergency: fix "Transaction is destructive" emergency failure
- mkdumprd: reduce lvm2 memory under kdump- Fix kernel kaslr caused regressions (kexec -p and makedumpfile --mem-usage)- kdump-lib.sh: fix incorrect usage with pipe as input for grep -q in is_pcs_fence_kdump()
- Document: fix incorrect link in fadump-how.txt- drop kdump script rhcrashkernel-param in kexec-tools repo
- kdumpctl: sanity check of nr_cpus for x86_64 in case running out of vectors
- kdumpctl: change prepare_cmdline() to operate KDUMP_COMMANDLINE directly
- use --hostonly-i18n for dracut- Rebase makedumpfile 1.6.1
- Delete unused patches- rebase upstream kexec-tools 2.0.14
- update kdump anaconda addon
- cleanup sources file- kexec-tools 2.0.14-1- rename function kdump_to_udev_name
- Raw dump: use by-id as persistent policy in 2nd kernel
- drop dracut duplicate functions
- dracut-kdump: use POSIX shell syntax
- Correct two typos in kdumpctl and kdump.conf- kexec/arch/i386: Add support for KASLR memory randomization
- Update kdump anaconda addon
- fadump: restore default initrd when fadump mode is disabled
- kdump/fadump: fix network interface name when switching from fadump to kdump
- kdumpctl: filter 'root' kernel parameter when running in live images
- Documentation: step by step guide on confiuring kdump in live images- fix wrong page_offset added in 2.0.13-6- add kexec support for arm64
- support x86 kaslr which is enabled by default in F25 kernel- Fix bug 1373958 for system boot without initrd
- Do not depend on /etc/fstab in kdumpctl in case it does not exist- Add special dump target "--mount" in dracut_args- Fix armv7 build failure- Drop old patches for 2.0.12- Rebase kexec-tools 2.0.13- kdump.conf manpage and kdump.conf comments fixes.
- kdump watchdog support.- Update kdump anaconda addon
- makedumpfile: Support _count -> _refcount rename in struct page
- module-setup: Don't handle iBFT in kdump- Rebase makedumpfile 1.6.0- Fix date format in spec file.- get_persistent_dev(): fix name contention with dracut's similar function- kdump-lib: Add get_ifcfg_filename() to get the proper ifcfg file
- module-setup: Use get_ifcfg_filename() to get the proper ifcfg file- update kdump anaconda addon to add mem range in tui 
- .gitignore: Update to make it more generic
- kdumpctl: check_rebuild improvement 
- kdumpctl: Do not rebuild initramfs when $KDUMP_BOOTDIR is read only- update kdump anaconda addon to adapt to blivet-2.0 API- Release 2.0.12-2
- ppc64le: fix kexec hang due to ppc64 elf abi breakage- Rebase kexec-tools to 2.0.12- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- use "systemctl reboot -f" for reboot action
- Remove kernel param "quiet" from kdump kernel cmdline
- kdump.sysconfig: add KDUMP_COMMANDLINE_REMOVE
- Add missing prefixes in default sysconfig file
- fix bogus date in ch�x�������������X��������X>��(
pM
��
��$W��������������������ve java stuff to gettext-devel (#132239)
- add BuildRequires: gcc-c++ (#132518)
- add some missing install-info and ldconfig (#131272)
- fix dir ownership (#133696)
- run autotools for 1.9- rebuilt- use --without-included-gettext to avoid the need of libintl.so (#125497)
- remove preloadable_libintl.so- moved some of the shared lib to main pkg
- added more build requires- add conditionals for patch and requires auto* (#125216)- packaged lib files for devel
- moved some of the files to different sub-pkg
- fix problem on x86_64 build- rebuilt- rebuilt- rebuilt to 0.14.1- rebuilt 0.12.1
- fix including files and excludes some patches- rebuilt- 0.11.5- rebuilt- add online help for msghack replacement- add patch to fix gettextize (#78720)- remove unpackaged files from the buildroot- Use %{_libdir} instead of /usr/lib (#72524)- install ulonglong.m4, which is required by uintmax_t.m4, which is already
  being installed- 0.11.4- automated rebuild- automated rebuild- 0.11.2
- include some new files- Add patch to make it compile with C99 compilers (#62313)- 0.11.1- update gettext to 0.11
- disable patch4- automated rebuild- improve automake handling- Add URL
- Add automake workaround (#56081)- 0.10.40 - libintl is now LGPLed (it was GPLed). Note that RHL
  uses the glibc version, and don't include libintl from gettext.
- include new man pages
- don't include the elisp mode - bundle it into the main emacs package,
  like we do for XEmacs.
- README-alpha no longer exists, so don't list it as a doc file- Rebuild - this should fix #52463- Fix handling of multiline entries (rest of #50065)
- don't use the references of the last entry in a po file
- remove duplicates when inverting
- Own the en@quot and en@boldquot locale dirs (#52164)
- Handle entries with a first line of "" as identical to those
  without- Added "--append" and "-o" to msghack, which should address 
  initial concerns in #50065- New msghack - from scratch, in python- msghack is back- Include some docfiles- 0.10.38
- do not include charset.alias- Build statically.- 0.10.37
- Disable all but two patches- Initialize proper fonts when entering po-mode (#29152)- More fix about msgmerge.- Fix for msgmerge not to break multibyte strings
  at Japanese locale.- fixed the %lang generator to not have "./" in the lang- add an init file for the emacs po-mode
- update source URL- put gettext in /bin for initscripts use
- %langify- prereq /sbin/install-info- Added patch from Ulrich Drepper- update DESTDIR patch (#12072)- automatic rebuild- fix problems wrt to DESTDIR (#12072)- use FHS paths
- add buildroot patch for .../intl/Makefile.in, was using abs. install path- minor configure tweaks for ia64- add --comments to msghack- fix bug #9240 - gettextize has the right aclocal patch- add the --diff and --dummy options- add the --missing option to msghack- updated msghack not to merge in fuzzies in the master catalogs- updated msghack to understand --append- updated msghack to correctly deal with sorting files- msghack updates- auto rebuild in the new build environment (release 8)- added patch for misc hacks to facilitate rpm translations- patch to allow to build on ARM- add Emacs po-mode.el files.- include the aclocal support files- remove devel package (functionality is in glibc)- update to 0.10.35.- add gettextize.
- create devel package for libintl.a and libgettext.h.- translations modified for de, fr, tr- added info handling
- added misc-patch (skip emacs-lisp modofications)- removed locale.aliases as we get it from glibc now
- uses a buildroot- Built against glibc/bin/sh/bin/sh�x��������������������X?��(
`8���$a��������������������operly do ssh and scp
- updating mkdumprd to use new kcp syntax- Bumping revision number- ppc64 no-more-platform fix- ppc64 fixups:
  - actually build ppc64 binaries (bug 203407)
  - correct usage output
  - avoid segfault in command-line parsing
- install kexec man page
- use regulation Fedora BuildRoot- fixed typo in mkdumprd for bz 202983
- fixed typo in mkdumprd for bz 203053
- clarified docs in kdump.conf with examples per bz 203015- updated init script to implement status function/scrub err messages- Misc spec cleanups and macro-ifications- Add %dir /var/crash, so default kdump setup works- fix another silly makefile error for makedumpfile- exclude makedumpfile from build on non-x86[_64] arches- exclude makedumpfile from build on non-x86[_64] arches- updating makedumpfile makefile to use pkg-config on glib-2.0- updating makedumpfile makefile to use pkg-config- Removing unneeded deps after Makefile fixup for makedumpfile- fixing up FC6/RHEL5 BuildRequires line to build in brew- enabling makedumpfile in build- added makedumpfile source to package- added et-dyn patch to allow loading of relocatable kernels- fixing up missing patch to kdump.init- add kexec frontend (bz 197695)- rebuild- Buildrequire zlib-devel- Bumping rev number- Add patch to allow ppc64 to ignore args-linux option- fix scriptlet - call chkconfig --add, change the default in the
  script itself (#183633)- Don't add kdump service by default, let the user manually add it to
  avoid everyone seeing a warning.- Fix kdump.init to call kexec from its new location- proper requires for scriptlets- Move kexec and kdump binaries to /sbin- Fix argument order when stopping kexec- kdump7.patch
   o Remove elf32 core headers support for x86_64
   o Fix x86 prepare elf core header routine
   o Fix ppc64 kexec -p failure for gcc 4.10
   o Fix few warnings for gcc 4.10
   o Add the missing --initrd option for ppc64
   o Fix ppc64 persistent root device bug
- Remove --elf32-core-headers from default configuration, users
  may re-add it via KEXEC_ARGS.
- Remove obsolete KEXEC_HEADERS- Remove wrong quotes around --command-line in kdump.init- Fix the service stop case.  It was previously unloading the wrong kernel.
- Implement the "restart" function.
- Add the "irqpoll" option as a default kdump kernel commandline parameter.
- Create a default kernel command line in the sysconfig file upon rpm install.- rebuilt for new gcc4.1 snapshot and glibc changes- Add patch to enable the kdump binary for x86_64- New kdump patch to support s390 arch + various fixes
- Include kdump in x86_64 builds- New kdump patch to support x86_64 userspace- rebuilt for new gcj- Report missing kdump kernel image as warning- Build for x86_64 as well.  Kdump support doesn't work there, but users
  should be able to use kexec.- Add a kdump sysconfig file and init script
- Spec file additions for pre/post install/uninstall- Initial prototype for RH/FC5/bin/sh/bin/sh/bin/shdiskdumputilskexec-tools-eppicnetdump/bin/sh/bin/sh/bin/sh	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOP2.0.26-14.el8_10.22.0.26-14.el8_10.22.0.26-14.el8_10.2	




�x�������������H��������X@��(
�9��������������fd�$v����������������fdgd8Y�SSL_set1_sigalgs.3ssl.gzSSL_set1_sigalgs_list.3ssl.gzSSL_set1_verify_cert_store.3ssl.gzSSL_set_accept_state.3ssl.gzSSL_set_allow_early_data_cb.3ssl.gzSSL_set_alpn_protos.3ssl.gzSSL_set_bio.3ssl.gzSSL_set_block_padding.3ssl.gzSSL_set_cert_cb.3ssl.gzSSL_set_cipher_list.3ssl.gzSSL_set_ciphersuites.3ssl.gzSSL_set_client_CA_list.3ssl.gzSSL_set_connect_state.3ssl.gzSSL_set_ct_validation_callback.3ssl.gzSSL_set_current_cert.3ssl.gzSSL_set_default_passwd_cb.3ssl.gzSSL_set_default_passwd_cb_userdata.3ssl.gzSSL_set_default_read_buffer_len.3ssl.gzSSL_set_ex_data.3ssl.gzSSL_set_fd.3ssl.gzSSL_set_generate_session_id.3ssl.gzSSL_set_hostflags.3ssl.gzSSL_set_info_callback.3ssl.gzSSL_set_max_cert_list.3ssl.gzSSL_set_max_early_data.3ssl.gzSSL_set_max_pipelines.3ssl.gzSSL_set_max_proto_version.3ssl.gzSSL_set_max_send_fragment.3ssl.gzSSL_set_min_proto_version.3ssl.gzSSL_set_mode.3ssl.gzSSL_set_msg_callback.3ssl.gzSSL_set_msg_callback_arg.3ssl.gzSSL_set_num_tickets.3ssl.gzSSL_set_options.3ssl.gzSSL_set_post_handshake_auth.3ssl.gzSSL_set_psk_client_callback.3ssl.gzSSL_set_psk_find_session_callback.3ssl.gzSSL_set_psk_server_callback.3ssl.gzSSL_set_psk_use_session_callback.3ssl.gzSSL_set_quiet_shutdown.3ssl.gzSSL_set_read_ahead.3ssl.gzSSL_set_record_padding_callback.3ssl.gzSSL_set_record_padding_callback_arg.3ssl.gzSSL_set_recv_max_early_data.3ssl.gzSSL_set_rfd.3ssl.gzSSL_set_security_callback.3ssl.gzSSL_set_security_level.3ssl.gzSSL_set_session.3ssl.gzSSL_set_session_id_context.3ssl.gzSSL_set_shutdown.3ssl.gzSSL_set_split_send_fragment.3ssl.gzSSL_set_ssl_method.3ssl.gzSSL_set_time.3ssl.gzSSL_set_timeout.3ssl.gzSSL_set_tlsext_host_name.3ssl.gzSSL_set_tlsext_max_fragment_length.3ssl.gzSSL_set_tlsext_status_ocsp_resp.3ssl.gzSSL_set_tlsext_status_type.3ssl.gzSSL_set_tlsext_use_srtp.3ssl.gzSSL_set_tmp_dh.3ssl.gzSSL_set_tmp_dh_callback.3ssl.gzSSL_set_verify.3ssl.gzSSL_set_verify_depth.3ssl.gzSSL_set_verify_result.3ssl.gzSSL_set_wfd.3ssl.gzSSL_shutdown.3ssl.gzSSL_state_string.3ssl.gzSSL_state_string_long.3ssl.gzSSL_stateless.3ssl.gzSSL_up_ref.3ssl.gzSSL_use_PrivateKey.3ssl.gzSSL_use_PrivateKey_ASN1.3ssl.gzSSL_use_PrivateKey_file.3ssl.gzSSL_use_RSAPrivateKey.3ssl.gzSSL_use_RSAPrivateKey_ASN1.3ssl.gzSSL_use_RSAPrivateKey_file.3ssl.gzSSL_use_cert_and_key.3ssl.gzSSL_use_certificate.3ssl.gzSSL_use_certificate_ASN1.3ssl.gzSSL_use_certificate_chain_file.3ssl.gzSSL_use_certificate_file.3ssl.gzSSL_use_psk_identity_hint.3ssl.gzSSL_verify_cb.3ssl.gzSSL_verify_client_post_handshake.3ssl.gzSSL_version.3ssl.gzSSL_waiting_for_async.3ssl.gzSSL_want.3ssl.gzSSL_want_async.3ssl.gzSSL_want_async_job.3ssl.gzSSL_want_client_hello_cb.3ssl.gzSSL_want_nothing.3ssl.gzSSL_want_read.3ssl.gzSSL_want_write.3ssl.gzSSL_want_x509_lookup.3ssl.gzSSL_write.3ssl.gzSSL_write_early_data.3ssl.gzSSL_write_ex.3ssl.gzSSLv23_client_method.3ssl.gzSSLv23_method.3ssl.gzSSLv23_server_method.3ssl.gzSSLv3_client_method.3ssl.gzSSLv3_method.3ssl.gzSSLv3_server_method.3ssl.gzSXNETID_free.3ssl.gzSXNETID_new.3ssl.gzSXNET_free.3ssl.gzSXNET_new.3ssl.gzTLS_FEATURE_free.3ssl.gzTLS_FEATURE_new.3ssl.gzTLS_client_method.3ssl.gzTLS_method.3ssl.gzTLS_server_method.3ssl.gzTLSv1_1_client_method.3ssl.gzTLSv1_1_method.3ssl.gzTLSv1_1_server_method.3ssl.gzTLSv1_2_client_method.3ssl.gzTLSv1_2_method.3ssl.gzTLSv1_2_server_method.3ssl.gzTLSv1_client_method.3ssl.gzTLSv1_method.3ssl.gzTLSv1_server_method.3ssl.gzTS_ACCURACY_dup.3ssl.gzTS_ACCURACY_free.3ssl.gzTS_ACCURACY_new.3ssl.gzTS_MSG_IMPRINT_dup.3ssl.gzTS_MSG_IMPRINT_free.3ssl.gzTS_MSG_IMPRINT_new.3ssl.gzTS_REQ_dup.3ssl.gzTS_REQ_free.3ssl.gzTS_REQ_new.3ssl.gzTS_RESP_dup.3ssl.gzTS_RESP_free.3ssl.gzTS_RESP_new.3ssl.gzTS_STATUS_INFO_dup.3ssl.gzTS_STATUS_INFO_free.3ssl.gzTS_STATUS_INFO_new.3ssl.gzTS_TST_INFO_dup.3ssl.gzTS_TST_INFO_free.3ssl.gzTS_TST_INFO_new.3ssl.gzUI.3ssl.gzUI_METHOD.3ssl.gzUI_OpenSSL.3ssl.gzUI_STRING.3ssl.gzUI_UTIL_read_pw.3ssl.gzUI_UTIL_read_pw_string.3ssl.gzUI_UTIL_wrap_read_pem_callba�x��������������y�������XA��(
���������i!�$y����������������i!h!j!���A큤A큤A큤A큤A큤A큤A큤A큤������������������A큤A큤A큤A큤A큤A큤��������������������������A큤��������A큤A큤��������������A큤��������������������������������������������������������������A큤A큤A큤A큤A큤A큤A큤A큤��������������������������������A큤����������������������A큤����������������������������������������A큤��������������������������������A큤��������A큤��������������������������������������A큤A큤A큤��A큤��A큤��A큤��A큤����A큤������������������������������������������������������������������������������������������������A큤A큤A큤������������������������������������������A큤A큤����������������������A큤A큤A큤������������������������������������������������������������������������������������A큤����������������������������������������������������������������������������������������A큤A큤A큤A큤��������������������A큤A큤������A큤h�0+h�0+h�0+h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�0.Z�V�Z���Z���h�0.Z���Z���h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/��x�������������8i�������XBI�(
xUx�fW�$v����������������fWgW�G�?ld����	�	6�������������	:�F�k�qx�	�
���
�(Pl�H�(�8�9P:@G�H�IX$Y<\X]x^�bKd�e�f�l�t�u�vw�x�y��� �&�h|��6F�
�%�hltgxh|Cfstrm0.6.13.el8Frame Streams implementation in CFrame Streams is a light weight, binary clean protocol that allows for the
transport of arbitrarily encoded data payload sequences with minimal framing
overhead -- just four bytes per data frame. Frame Streams does not specify
an encoding format for data frames and can be used with any data serialization
format that produces byte sequences, such as Protocol Buffers, XML, JSON,
MessagePack, YAML, etc.cAg�x64-builder02.almalinux.org�$AlmaLinuxAlmaLinuxMITAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/farsightsec/fstrmlinuxx86_64'��..A�A�����A큤��cAg�cAg�cAg�cAg�cAg�cAg�\��\��dafc94d39efddd3c70921635d71cdc7ecd4ed9e50b63e69e7ca7c9e8217f8bcbfb7b6df23d37e4d9f60ea5e7b8a1ac793f1db07915539d2d201949f30f3aff23fb7b6df23d37e4d9f60ea5e7b8a1ac793f1db07915539d2d201949f30f3aff23../../../../usr/lib64/libfstrm.so.0.1.0libfstrm.so.0.1.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootfstrm-0.6.1-3.el8.src.rpm��������������������������������bundled(libmy)fstrmfstrm(x86-64)libfstrm.so.0()(64bit)libfstrm.so.0(LIBFSTRM_0.2.0)(64bit)libfstrm.so.0(LIBFSTRM_0.4.0)(64bit)@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libpthread.so.0(GLIBC_2.3.3)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3bγ�`pA�`n�@_��@_`��_`��_2�@_��^0"@]�@]9��\R�@[H�@Z�n�Z��Zz�@Y���Yx�@X��@X�@V��U�a@T��@Petr Menšík <pemensik@redhat.com> - 0.6.1-3Petr Menšík <pemensik@redhat.com> - 0.6.1-2Petr Menšík <pemensik@redhat.com> - 0.6.1-1Petr Menšík <pemensik@redhat.com> - 0.6.0-3.1Petr Menšík <pemensik@redhat.com> - 0.6.0-3Petr Menšík <pemensik@redhat.com> - 0.6.0-2Michał Kępień <michal@isc.org> - 0.6.0-1Fedora Release Engineering <releng@fedoraproject.org> - 0.5.0-3Fedora Release Engineering <releng@fedoraproject.org> - 0.5.0-2Tomas Krizek <tomas.krizek@nic.cz> - 0.5.0-1Fedora Release Engineering <releng@fedoraproject.org> - 0.4.0-4Fedora Release Engineering <releng@fedoraproject.org> - 0.4.0-3Fedora Release Engineering <releng@fedoraproject.org> - 0.4.0-2Tomas Krizek <tomas.krizek@nic.cz> - 0.4.0-1Tomas Krizek <tomas.krizek@nic.cz> - 0.3.2-1Fedora Release Engineering <releng@fedoraproject.org> - 0.3.0-5Fedora Release Engineering <releng@fedoraproject.org> - 0.3.0-4Fedora Release Engineering <releng@fedoraproject.org> - 0.3.0-3Fedora Release Engineering <releng@fedoraproject.org> - 0.3.0-2Jan Vcelak <jvcelak@f�x��������������X�������XC��(
���������4+X�$;����������������+X,X*X�directoryC source, ASCII textASCII textpkgconfig fileUTF-8 Unicode texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)C source, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)�x�������������(H�������XD��(
(l@�
g�$w����������������gfh�ded syslog logging to background mounts as suggested
  by a customer.- fix #183713 - foreground mounts are not retrying as advertised
- fix #151549 - Added 'noacl' mount flag
- fix #169042 - Changed nfsmount to try udp before using tcp when rpc-ing
		the remote rpc.mountd (iff -o tcp is not specified).
		This drastically increases the total number of tcp mounts
		that can happen at once (ala autofs).- Better calling of restorecon as suggested by Bill Nottingham
- prereq restorecon to avoid ordering issues- restorecon /var/log/lastlog- fix #181782 - mkswap selinux relabeling (fix util-linux-2.13-mkswap-selinux.patch)- fix #181782 - mkswap should automatically add selinux label to swapfile
- fix #180730 - col is exiting with 1 (fix util-linux-2.12p-col-EILSEQ.patch)
- fix #181896 - broken example in schedutils man pages
- fix #177331 - login omits pam_acct_mgmt & pam_chauthtok when authentication is skipped.
- fix #177523 - umount -a should not unmount sysfs
- fix #182553 - fdisk -l inside xen guest shows no disks- bump again for double-long bug on ppc(64)- add "blockdev --rmpart N <device>" and "blockdev --rmparts <device>"- rebuilt for new gcc4.1 snapshot and glibc changes- Updated the gssd_check() and idmapd_check(), used with
  nfsv4 mounts, to looked for the correct file in /var/lock/subsys
  which stops bogus warnings.- fix #174676 - hwclock audit return code mismatch
- fix #176441: col truncates data
- fix #174111 - mount allows loopback devices to be mounted more than once to the same mount point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
		is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include�x��������������7�������XE��(
�(��������	��$`��������������������ule check file (bz 522486)- update kdump adv conf init script & dracut module- Remove mkdumprd2 and start replacement with dracut- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Fixed build break- Make makedumpfile a dynamic binary- Fix build issue- Updated initscript to use mkdumprd2 if manifest is present
- Updated spec to require dash
- Updated sample manifest to point to correct initscript
- Updated populate_std_files helper to fix sh symlink- Fixed mkdumprd2 tarball creation- Fix up kdump so it works with latest firstboot- Fixed some stat drive detect bugs by E. Biederman (bz505701)- Put early copy of mkdumprd2 out in the wild (bz 466392)- Update makedumpfile to v 1.3.3 (bz 499849)- Simplifed rootfs mounting code in mkdumprd (bz 494416)- Install the correct configuration for i586- Fix problem with quoted CORE_COLLECTOR string (bz 493707)- Add BR glibc-static- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for Python 2.6- adding makedumpfile man page updates (bz 473212)- Rebuild for Python 2.6- Correct source file to use proper lang package (bz 335191)- Fix mkdumprd typo (bz 469001)- Fix sysconfig files to not specify --args-linux on x86 (bz 461615)- Update kexec-tools to latest upstream version- Fix mkdumprd to properly use UUID/LABEL search (bz 455998)- fix license tag- Add video reset section to docs (bz 456572)- Fix mkdumprd to support dynamic busybox (bz 443878)- Added lvm to bin list (bz 443878)- Update to latest makedumpfile from upstream
- Mass import of RHEL fixes missing in rawhide- Fix mkdumprd to properly pull in libs for lvm/mdadm (bz 443878)- Fix cmdline length issue- Fixing ARCH definition for bz 438661- Adding patches for bz 438661- Bringing rawhide up to date with bugfixes from RHEL5
- Adding patch to prevent kexec buffer overflow on ppc (bz 428684)- Modifying mkdumprd to include dynamic executibles (bz 433350)- bumping rev number for rebuild- Fix ARCH placement in kdump init script (bz 427201)
- Fix BuildRequires
- Fix Makedumpfile to build with new libelf- Fix triggerpostun script (bz 308151)- Bumping kexec version to latest horms tree (bz 257201)
- Adding trigger to remove initrds when a kernel is removed- Add xen-syms patch to makedumpfile (bz 250341)- Fix ability to determine space on nfs shares (bz 252170)- Update kdump.init to always create sparse files (bz 253714)- Update init script to handle xen kernel cmdlnes (bz 250803)- Update mkdumprd to suppres notifications /rev makedumpfile (bz 250341)- Fix mkdumprd to suppress informative messages (bz 248797)- Updated fr.po translations (bz 248287)- Fix up add_buff to retry locate_hole on segment overlap (bz 247989)- Fix up language files for kexec (bz 246508)- Fixing up initscript for LSB (bz 246967)- Fixed conflict in mkdumprd in use of /mnt (bz 222911)- Fixed kdump.init to properly read cmdline (bz 244649)- Fixed up kdump.init to enforce mode 600 on authorized_keys2 (bz 235986)- Fix alignment of bootargs and device-tree structures on ppc64- Allow ppc to boot ppc64 kernels (bz 235608)- Reduce rmo_top to 0x7c000000 for PS3 (bz 235030)- Fix spec to own kexec_tools directory (bz 219035)- Add fix for ppc memory region computation (bz 233312)- Adding extra check to avoid oom kills on nfs mount failure (bz 215056)- Updating makedumpfile to version 1.1.1 (bz 2223743)- Adding multilanguage infrastructure to firstboot_kdump (bz 223175)- Fixing up file permissions on kdump.conf (bz 228137)- Adding mkdumprd man page to build- Updating kdump.init and mkdumprd with most recent RHEL5 fixes
- Fixing BuildReq to require elfutils-devel-static- Fix option parsing problem for bzImage files (bz 221272)- Wholesale update of RHEL5 revisions 55-147- integrate default elf format patch- Taking Viveks x86_64 crashdump patch (rcv. via email)- Taking ia64 tools patch for bz 181358- more doc updates
- added patch to fix build break from kernel headers change- repo patch to enable support for relocatable kernels.- rewriting kcp to pr�x�������������'�������XF�(
��������Ht|��$l����������������|�{�}�� (RhBug:1629711)
- Allow enablement on disabled plugin (RhBug:1614539)
- Resolves: rhbz#1622585 - [modularity] dnf should not be proposing distro-sync
- Resolves: rhbz#1614531 - dnf 3.2 does not depsolve correctly
- Bug 1564369 - don't show duplicate errors in dnf output
- Resolves: rhbz#1597257 - dnf should accept localinstall command, at least as an alias
- Resolves: rhbz#1613860 - dnf search behaviour is slightly confusing
- Resolves: rhbz#1625586 - Advise user about alternatives to the non-existing "python" package
- Resolves: rhbz#1614346 - dnf rollback doesn't work after install/downgrade/upgrade
- Resolves: rhbz#1612752 - platform-python should be used in completion_helper
- Resolves: rhbz#1618421 - dnf module install fails to find non-modular dependencies
- Bug 1629655 - not helpful/complete error message when specifying wrong stream or profile
- Bug 1629709 - disabled modules should be identified in the module listing
- Bug 1630761 - [usability] unable to determine if a stream with [d] is enabled or not
- Bug 1625270 - there is ???% [=== when baseurl is wrong
- Resolves: rhbz#1624056 - quoted baseurl is error out- [module] Fixed list and info subcommands (RhBug:1623388) (RhBug:1623535)- New implementation of modularity
- dnf makecache should not fail in red color if no enabled repos (RhBug:1622090)
- [modularity] dnf module profile command doesn't work (RhBug:1622580)
- [modularity] incorrect output in dnf module list (RhBug:1623398)
- [modularity] dnf could be smarter when installing what's already installed (RhBug:1622599)
- [modularity] dnf module install circular error on missing dependency (RhBug:1620233)
- not descriptive output in dnf verbose (RhBug:1612718)
- RFE: provide way to query all packages from module (RhBug:1569068)- [history] Fix 'attempt to write a readonly database' error in addConsoleOutputLine().
- [spec] Improve YUM v3 compat layer.
- [doc] document missing link from yum-rhn-plugin to dnf-plugin-spacewalk (RhBug:1580356)
- [doc] document difference between yum and dnf when listing packages (RhBug:1615834)
- [doc] document missing download functionality after transaction table is displayed (RhBug:1585140)
- [systemd] dnf-makecache.timer: move the ordering after network to .service
- [translations] Update translations from zanata.
- [cli] Fix 'already installed' message output.
- [module] change 'module_nsvp' to 'module_spec'
- [module] show module profiles without ', ...'
- [module] unify usability of RepoModuleDict.get_info*(); fix traceback
- [security] fix update count (RhBug:1585138)
- [cli] enable reposync to use --destdir (RhBug:1582152)
- [repo] Replace dnf.repo.Repo with libdnf implementation.
- [dnf] Limit DeprecationWarning to dnf.* modules only.- [misc] Fallback to os.getuid() if /proc/self/loginuid can't be read (RhBug:1597005)
- [translations] Update translations from zanata.
- [doc] Update module documentation.
- [module] Fix `module provides` output.
- [module] Add `module reset` command.
- [module] Fix module disable command
- [repo] Improve error message on broken repo (RhBug:1595796)
- [doc] Enhance a command documentation (RhBug:1361617)
- [module] Automatically save module persistor in do_transaction().
- [drpm] Fixed setting deltarpm_percentage=0 to switch drpm off
- [repo] Split base.download_packages into two functions
- [output] Use libdnf wrapper for smartcols
- [conf] Do not traceback on empty option (RhBug:1613577)- [sack] Use module_platform_id option.
- [module] Switch module persistor to libdnf implementation.
- [module] Auto-enable module streams based on installed RPMs.
- [transaction] Fix: show packages from the current transaction.
- [conf] Convert any VectorString type to list.
- [module] Replace 'enabled' config option with 'state'.
- [install_specs] Do not exclude groups' packages
- [module] Use module sack filtering from libdnf
- [module] Many UX fixes.- [module] Move 'hotfixes' conf option to libdnf and rename it to 'module_hotfixes'.
- [goal] Exclude @System repo packages from distro_sync.
- [conf] Setup configuration v�x���������������������XG�(
��������8 ������o�$����������������onp�1cb886a6e2c99972edfb226a6192bd2f4c30996dcb35762ecf1c698cdff89d6d73e2035e046c2bbe3b4caad35387ed1c7550dc6f3972e436819a532462d5f62ad0816bca52af7e71b3bc571fe6d7405202c249e49eff69131719c87448517ff53d40df18051ba50ad313e51881cf77782d434196eecba659bcb616010a65ad2fd6e913ecd19fec9be4640f53d9d755f6bbe3173a9e407a0517578d75c9d2926188e6b8717d2bd682beba7f0cde2e3b1b80255577f22b50a1497df5649d61816283987d0b228cec0ba938a9b9e4859f0b9dbcf48c27d66282a04dfe1be7fcabda2847a38dac86850f8fe55fe6305ce17a125cb40fbcaf6157158ac46885133b90b5ac96db282dbd8e23ab1f51ea93f4b11ddf3fae0a72e8593c06493368fd264cd997d0b5268255ba27200ddf72bccb258832c3079ffe06643ca18cf95b7a8d2d832d0d67c550d5349902196839a9d210b6a543f5972ab391b412a2449d98322b1766e1778b5246be23672ad96544052e9f9375a931913c2f05b0717bd331e89920c00338a1288eb1fb957104ca8e6d376e9112386f2c48dca3a3f7a633db84a38c2c31aa5026844ba19adb9df861a1075c1fe1796b0646f5dcb34c69334c3aa7a7d8e00e96d0d9230d12060035a1a78239c92babc92ca53fff204b8c138db0c1875c9b5080b982ad7cf017285518aa5a8c533f25dc88710d6f54428354d972938319b884fb36888e569bdff03022af85288e7b3f9d0ea77c9a06ce208b5a3f4c91cdb231d4062f3875f63ddca0b7b43a8216da8da464b36a99048e84c2a955bee735169f59b039a1ea25b4b4681e4929d5303888ee1615db98ef9828764db5fe79f64199bda21d529cda0cffbe878329f82fb7609384d36cb0303a98f49a56a965714f5fae6eb97c8c466d1ddc6b71e29d259d33c46ad2a24560bbaf61082ea843099d4d4c605f38a644bfcfff58be8bfd55776adcead76028863b9f66a824be3db9996082d88f066ec094fae776c071f390bcee01c26d5789f1d97e366f0433bbe17df5dd6a2a50f7c404a72a5e288660385fe49b742944655db6d74b84531b844a0b317106361c53c3bd908dc1471486b11b07132b49f87c7e7602328c0a83d2bb5eea00b9942cb3728d1c8082cd643518eab69821c5a8e742ea95368b65edd856bf2feb3119654677c6388d29e31b46dbebd8c97d43839130a7d68206c9e12427b5453fd47600be6221f49fbd2c72231dcbb1127ad5c32d0ebd416db5b6050bafed1bbef3ce34def152f881519c765b46024774fb683e6b8d36c791489c85a18ac5e216f149d3d0fe02e7eecf9991e8f9318ae0a27cedd2c50d0050f6bf79b3d25b460efd4edd6e04d182126d575cccc7c4473b8b3f9244508ae76bc04688df8f87b9a3d5920bd5d8db2ff8938bfbbf163e6e6c7eaa5174f21e58da6629069a545035ea5f8aed959c2b35e9b070d5fd9825e1f4ce945d76d3b46af79a3f162e9da1dd2260f83c64d31340e6ff303536baeee3ad3d6e56df3364e0a120316ba13844156f82f2316575d3d00de96d6ab28e8db6587bbc803d3f6b39f6de1ce0c881b70b8795bffa9c5293934ceed7a094df0453255752205f9890f0982d45006e56f14db999eb05d945c091ebfc154d1ed7996830bd7b7fe0854b60cad226cc3ed52f43d4f8203d9042d7afe1b6d36dcac415e99a02207c507582313b3b57eae9233b7b682b460975a18b93bafa64c32f9f9684f0f4940279f64c38e521f600de54375574981886f515c57028e1014b65f84fb1409d7aece221d5a6cc522634a0585e3a3d2b328e7b66a21f0bb4e3fa78e3ef0c2e1b2c11a566b32d7a09c944cb6ea2fc2c0fb1e115d76b511ae38f66c0caaad53e2f58fdc24e50487346c643a9b516c4e14791e54eab94ff01a3c56d3a7efabd91adc77e85ffe263f4657bfstrim.servicefstrim.timer60-raw.rulesaddpartagettyblkdiscardblkidblkzoneblockdevcfdiskchcpuclockctrlaltdeldelpartfdformatfdiskfindfsfsckfsck.cramfsfsck.minixfsfreezefstrimhwclockldattachlosetupmkfsmkfs.cramfsmkfs.minixmkswapnologinpartxpivot_rootreadprofileresizepartrfkillrtcwakerunusersfdisksuloginswaplabelswapoffswaponswitch_rootwipefszramctladdpartblkdiscardblkidblkzoneblockdevcalcfdiskchcpuchmemchrtcolcolcrtcolrmcolumnctrlaltdeldelpartdmesgejectfallocatefdformatfdiskfincorefindfsfindmntflockfsckfsck.cramfsfsck.minixfsfreezefstrimgetopthexdumphwclockioniceipcmkipcrmipcsisosizelastldattachloggerlooklosetuplsblklscpulsipclslockslsloginslsmemlsnsmcookiemesgmkfsmkfs.cramfsmkfs.minixmkswapmoremountpointnameinsenterpartxpivot_rootprlimitrawreadprofilerenamereniceresizepartrevrfkillrtcwakerunuserscriptscriptreplaysetarchsetprivsetsidsettermsfdisksuswaplabelswapoffswapontasksetulunshareutmpdumpuuidgenuuidparsewallwdctlwhereiswipefswritezramctlutil-linuxAUTHORSNEWSREADMEdeprecated.txtgetopt-parse.bashgetopt-parse.tcshutil-linuxCOPYING.BSD�x��������������������XH�(
���������n
{��$k����������������{�z�|��78)
- [doc] Add info of relation update_cache with fill_sack (RhBug:1658694)
- Rename man page from dnf.automatic to dnf-automatic to match command name
- Fix alias list command (RhBug:1666325)
- Fix behavior  of ``--bz`` option when specifying more values
- Add protection of yum package (RhBug:1639363)
- Fix ``list --showduplicates`` (RhBug:1655605)
- Retain order of headers in search results (RhBug:1613860)
- Solve traceback with the "dnf install @module" (RhBug:1688823)
- Fix multilib obsoletes (RhBug:1672947)
- Do not remove group package if other packages depend on it
- Remove duplicates from "dnf list" and "dnf info" outputs
- Fix the installation of completion_helper.py
- Fix formatting of message about free space required
- Fix installation failiure when duplicit RPMs are specified (RhBug:1687286)
- Fix issues with terminal hangs when attempting bash completion (RhBug:1702854)
- Allow plugins to terminate dnf (RhBug:1701807)
- [provides] Enhanced detecting of file provides (RhBug:1702621)
- [provides] Sort the output packages alphabetically- Backport patch to unify --help with man for module-spec (RhBug:1678689)- Backport patch to not allow direct module switch- Backport patch to add support for modular updateinfoxml data- Backport patch: Fix minor problem with suggestion printed to terminal- Backport patches for: RHEL should use --best option by default for dnf / libdnf (RhBug:1670776)
- Add --nobest dnf option to revert the new default behavior from commandline- Print information about skipped packages after the transaction
- Sort reported skipped packages, force ignore_weak
- Allow to enable modules that break default modules (RhBug:1648839)- Updated difference YUM vs. DNF for yum-updateonboot
- Added new command ``dnf alias [options] [list|add|delete] [<name>...]`` to allow the user to
  define and manage a list of aliases
- Enhanced documentation
- Unifying return codes for remove operations
- [transaction] Make transaction content available for commands
- Add hotfix packages to install pool (RhBug:1654738)
- Report group operation in transaction table
- [sack] Change algorithm to calculate rpmdb_version
- Add basic integration with digest (RhBug:1614351)- Added dnf.repo.Repo.get_http_headers
- Added dnf.repo.Repo.set_http_headers
- Added dnf.repo.Repo.add_metadata_type_to_download
- Added dnf.repo.Repo.get_metadata_path
- Added dnf.repo.Repo.get_metadata_content
- Added --changelogs option for check-update command
- [module] Add information about active modules
- Hide messages created only for logging
- Enhanced --setopt option
- [module] Fix dnf remove @<module>
- [transaction] Make transaction content available for plugins- Backport patches for setting cachedir with --setopt- Update to 4.0.4
- Add dnssec extension
- Set termforce to AUTO to automatically detect if stdout is terminal
- Repoquery command accepts --changelogs option (RhBug:1483458)
- Calculate sack version from all installed packages (RhBug:1624291)
- [module] Allow to enable module dependencies (RhBug:1622566)- [module] Improved module commands list, info
- [module] Reports error from module solver
- Fix: Error detected when calling 'RepoCB.fastestMirror' (RhBug:1628056)
- Preserve packages from other installed mod profiles (RhBug:1629841)
- [spec] Postpone conflict with yum to Fedora 30+ (RhBug:1600444)
- [cli] Install command recommends alternative packages (RhBug:1625586)
- [cli] Fix case insensitive hint (1628514)
- Fix installed profiles for module info (RhBug:1629689)
- Fix module provides not having consistent output (RhBug:1623866)
- Enhance label for transaction table (RhBug:1609919)
- Implement C_, the gettext function with a context (RhBug:1305340)
- Actually disambiguate some messages using C_ (RhBug:1305340)
- Restore 'strict' choice for group installs (#1461539)
- [repoquery] More strict queryformat parsing (RhBug:1631458)
- Redirect repo progress to std error (RhBug:1626011)
- Unify behavior of remove and module remove (RhBug:1629848)
- Change behavior of disabled module for module install�x������� ��������X%�(
��������h�d�$t����������������dce�te to util-linux-2.12j- Corrected a buffer overflow problem with nfs mounts.
  (bz# 141733)- Patches for various bugs.- Made NFS mounts adhere to the IP protocol if specified on
  command line as well as made NFS umounts adhere to the
  current IP protocol. Fix #140016- Add include_raw macro, build with it off for Fedora- Add raw patch to allow binding of devices not yet in /dev- Add David Zeuthen's patch to enable the pamconsole flag #133941- Restore raw utils (bugzilla #130016)- Add the missing remote entry in pam.d- Rechecked in some missing NFS mounting code.- Make swaplabel support work with swapon -a -e- Updated the NFS and NFS4 code to the latest CITI patch set
  (in which they incorporate a number of our local patches).- Fix #132196 - turn on SELinux support at build-time.- Fix #91174 with pamstart.patch- Fix #16415, #70616 with rdevman.patch
- Fix #102566 with loginman.patch
- Fix #104321 with rescuept.patch (just use plain lseek - we're in _FILE_OFFSET_BITS=64 land now)
- Fix #130016 - remove raw.
- Re-add agetty (replacing it with mgetty is too much pain, and mgetty is much larger)- Made the NFS security checks more explicit to avoid confusion
  (an upstream fix)
- Also removed a compilation warning- Remove unused mount libdevmapper inclusion.- Add device-mapper mount-by-label support
- Fix segfault in mount-by-label when a device without a label is present.- Updated nfs man page to show that intr are on by
  default for nfs4- modified warning causing heart attack for >16 partitions, #107824- Fix #126623, #126572
- Patch cleanup
- Remove agetty (use mgetty, agetty is broken)- rebuilt- Update to 2.12a
- Fix #122448- Change pam_selinux to run last- Fix #122448 (autofs issues)- Fix #119157 by editing the patch
- Add patch145 to fix #119986- Fix #118803- mkcramfs: use PAGE_SIZE for default blocksize (#118681)- Updated the nfs-mount.patch to correctly 
  handle the mounthost option and to ignore 
  servers that do not set auth flavors- Fix selinux ordering or pam for login- Make RPC error messages displayed with -v argument
- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running
- Ping NFS v4 servers before diving into kernel
- Make v4 mount interruptible which also make the intr option on by default- Reworked how the rpc.idmapd and rpc.gssd checks were
  done due to review comments from upstream.
- Added rpc_strerror() so the '-v' flag will show RPC errors.- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running.- Reworked and updated the nfsv4 patches.- Bump version- Tried to make nfs error message a bit more meaninful
- Cleaned up some warnings- Added pesudo flavors for nfsv4 mounts.
- Added BuildRequires: libselinux-devel and Requires: libselinux
  when WITH_SELINUX is set.- check for 2.6.3 kernel in mount options- Remove /bin/kill for #116100- rebuilt- rebuilt- Final 2.12 has been out for ages - might as well use it.- Added mount patches that have NFS version 4 support- Provides: mount losetup- Add multiple to /etc/pam.d/login for SELinux- 2.12pre-1
- Merge mount/losetup packages into the main package (#112324)
- Lose separate- remove selinux code from login and use pam_selinux- turn on selinux- Add BuildRequires: texinfo (from a bug# I don't remember)
- Fix #90588 with mountman patch142.- turn off selinux- turn on selinux
- remove context selection- Add patch140 (alldevs) to fix #101772. Printing the total size of
  all devices was deemed a lower priority than having all devices
  (e.g. /dev/ida/c0d9) displayed.- turn off selinux- turn on selinux- Fix #103004, #103954- turn off selinux- build with selinux- Use urandom instead for mkcramfs- add SELINUX 2.5 support- #100433 patch- #97381 patch- rebuilt- Change patch128 to improve ipcs -l- Fix #85407- Change patch128 to util-linux-2.11f-ipcs-84243-86285.patch to get all
ipcs fixes- fix last login date display on AMD64 (#88574)- include sfdisk on ppc- add patch from msw �x�����8��������X>^�(
��������`��d�$�����������������d�d�d�lddep on sed- debloat
- fix broken manpage symlinks- fix double-free in 'openssl ca'- update to 0.9.7 final- update to 0.9.7 beta6 (DO NOT USE UNTIL UPDATED TO FINAL 0.9.7)- update to 0.9.7 beta5 (DO NOT USE UNTIL UPDATED TO FINAL 0.9.7)- add configuration stanza for x86_64 and use it on x86_64
- build for linux-ppc on ppc
- start running the self-tests again- Merge fixes from previous hammer packages, including general x86-64 and
  multilib- rebuild- update asn patch to fix accidental reversal of a logic check- update asn patch to reduce chance that compiler optimization will remove
  one of the added tests- rebuild- add patch to fix ASN.1 vulnerabilities- add backport of Ben Laurie's patches for OpenSSL 0.9.6d- own {_datadir}/ssl/misc- automated rebuild- automated rebuild- free ride through the build system (whee!)- rebuild in new environment- merge RHL-specific bits into stronghold package, rename- add support for Chrysalis Luna token- disable AEP random number generation, other AEP fixes- only build subpackages on primary arches- on ia32, only disable use of assembler on i386
- enable assembly on ia64- fix sparcv9 entry- upgrade to 0.9.6c
- bump BuildArch to i686 and enable assembler on all platforms
- synchronise with shrimpy and rawhide
- bump soversion to 3- delete BN_LLONG for s390x, patch from Oliver Paukstadt- update AEP driver patch- adjust RNG disabling patch to match version of patch from Broadcom- disable the RNG in the ubsec engine driver- tweaks to the ubsec engine driver- tweaks to the ubsec engine driver- update ubsec engine driver from Broadcom- move man pages back to %{_mandir}/man?/foo.?ssl from
  %{_mandir}/man?ssl/foo.?
- add an [ engine ] section to the default configuration file- add a patch for selecting a default engine in SSL_library_init()- add patches for AEP hardware support
- add patch to keep trying when we fail to load a cert from a file and
  there are more in the file
- add missing prototype for ENGINE_ubsec() in engine_int.h- actually add hw_ubsec to the engine list- add in the hw_ubsec driver from CVS- update to 0.9.6b- move .so symlinks back to %{_libdir}- move shared libraries to /lib (#38410)- switch to engine code base- add a script for creating dummy certificates
- move man pages from %{_mandir}/man?/foo.?ssl to %{_mandir}/man?ssl/foo.?- add s390x support- change two memcpy() calls to memmove()
- don't define L_ENDIAN on alpha- Add 'stronghold-' prefix to package names.
- Obsolete standard openssl packages.- Add BuildArch: i586 as per Nalin's advice.- Enable assembler on ix86 (using new .tar.bz2 which does
  include the asm directories).- make subpackages depend on the main package- adjust the hobble script to not disturb symlinks in include/ (fix from
  Joe Orton)- drop the m2crypo patch we weren't using- configure using "shared" as well- update to 0.9.6a
- use the build-shared target to build shared libraries
- bump the soversion to 2 because we're no longer compatible with
  our 0.9.5a packages or our 0.9.6 packages
- drop the patch for making rsatest a no-op when rsa null support is used
- put all man pages into <section>ssl instead of <section>
- break the m2crypto modules into a separate package- use BN_LLONG on s390- fix the s390 changes for 0.9.6 (isn't supposed to be marked as 64-bit)- move c_rehash to the perl subpackage, because it's a perl script now- update to 0.9.6
- enable MD2
- use the libcrypto.so and libssl.so targets to build shared libs with
- bump the soversion to 1 because we're no longer compatible with any of
  the various 0.9.5a packages circulating around, which provide lib*.so.0- change hobble-openssl for disabling MD2 again- re-disable MD2 -- the EVP_MD_CTX structure would grow from 100 to 152
  bytes or so, causing EVP_DigestInit() to zero out stack variables in
  apps built against a version of the library without it- disable some inline assembly, which on x86 is Pentium-specific
- re-enable MD2 (see http://www.ietf.org/ietf/IPR/RSA-MD-all)- fix s390 patch- added �x�������������p�������XKќ(
ȶ�������!�$�����������������!�!��wV&�ON�Y;���ʻ��%�_�3!�^���P,��*����%�h�>w
	*����%�g�x��2�+w>������A����*�|�]��/��N~au��5e�6���q��#�?	�E��A�xjC�?�u��f6u'�?�Q�?(���M���T/�A����&A�h�7#�=z�g��g*���#<�7�,�X��''�]�u�)�>:��<yZ�����Ң�gJF^W�S�F���/��pῺ������PE�-��g���f~��qT
�GpZ�P��{�r�ވ��N�C���t�m�Z�[R[T��7�*D����YY��F7�F��r�4����C�B�We&������p�;�|�&�H�21�ߎ oP���KV��8������"��:쟯�d�7�U�M�L�"�;�y��8�G�d�pY851#�BZ�@Y,�\ט�v�o��w���el�1������>�1[��C(�A�*Q�h6�$B���N��=A\+�-HQy���M���d������|D�@u��/���G���{�vc�`4bd1813eaa5852fefce1d5de2c707b76042a628d248985e3532611025c33e82a6eacdc44f85933b465a4b4bccc1fa28a6e576554h�K�^Dh�K�ck (Steve Best) [1638287]
- [powerpc] powerpc/time: Use clockevents_register_device(), fixing an issue with large decrementer (Steve Best) [1638287]
- [hwmon] hwmon: (nct6775) Fix potential Spectre v1 (Dean Nelson) [1637464]
- [vfio] vfio-pci: Disable binding to PFs with SR-IOV enabled (Alex Williamson) [1637871]
- [netdrv] net: hns3: fix page_offset overflow when CONFIG_ARM64_64K_PAGES (Petr Oros) [1638385]
- [netdrv] net: hns: fix skb->truesize underestimation (Petr Oros) [1638385]
- [netdrv] net: hns: fix length and page_offset overflow when CONFIG_ARM64_64K_PAGES (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix get_vector ops in hclgevf_main module (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix warning bug when doing lp selftest (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for mac pause not disable in pfc mode (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for mailbox message truncated problem (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix return value error in hns3_reset_notify_down_enet (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for reset_level default assignment probelm (Petr Oros) [1638385]
- [netdrv] net: hns3: Reset net device with rtnl_lock (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for phy link issue when using marvell phy driver (Petr Oros) [1638385]
- [netdrv] net: hns3: Fix for command format parsing error in hclge_is_all_function_id_zero (Petr Oros) [1638385]
- [net] xprtrdma: Fix disconnect regression (Don Dutile) [1635418]
- [infiniband] RDMA/uverbs: Fix validity check for modify QP (Don Dutile) [1635418]
- [infiniband] IB/srp: Avoid that sg_reset -d $srp_device triggers an infinite loop (Don Dutile) [1635418]
- [infiniband] ucma: fix a use-after-free in ucma_resolve_ip() (Don Dutile) [1635418]
- [infiniband] RDMA/uverbs: Atomically flush and mark closed the comp event queue (Don Dutile) [1635418]
- [infiniband] RDMA/mlx4: Ensure that maximal send/receive SGE less than supported by HW (Don Dutile) [1635418 1623100]
- [infiniband] RDMA/cma: Protect cma dev list with lock (Don Dutile) [1635418]
- [infiniband] IB/ipoib: Avoid a race condition between start_xmit and cm_rep_handler (Don Dutile) [1635418]
- [infiniband] RDMA/ucma: check fd type in ucma_migrate_id() (Don Dutile) [1635418]
- [infiniband] RDMA/rxe: Set wqe->status correctly if an unexpected response is received (Don Dutile) [1635418]
- [infiniband] IB/IPoIB: Set ah valid flag in multicast send flow (Don Dutile) [1635418]
- [infiniband] RDMA/core: Avoid holding lock while initializing fields on stack (Don Dutile) [1635418]
- [infiniband] IB/rxe: Drop QP0 silently (Don Dutile) [1635418]
- [infiniband] RDMA/umem: Don't hold mmap_sem for too long (Don Dutile) [1635418]
- [infiniband] IB/srpt: Fix srpt_cm_req_recv() error path (2/2) (Don Dut�x���������������������XL��(
���������S��$/��������������������4aff62cbb36b4a452ce67eb261c90e35325bf9b6b9562bd0882128ea4650b65c9389b35edf9ff534dc3a48e8bed73e650aeccc3ef0a7c2e1bbab934b0882b61f19569e96e4615d069dc50b6becdd19ab2cc69000c1206f1b8460952857f05d154158da8b89273ac2900a5c80ec09a36cf3e93b6374521c81fa4f302350d3c04b95573f5570717284107689188e6427d138cfba0b64e4090d53031ba5a470589ca0229336c6334e280e5eeadfc84af2491bf39f41b9f7c919ba47ed9ab03f87e943bc3b12417f98e5580d8077bc791731c3e8eefc36254118d8771bea069ec08c33d3e44496fd861a8316e73f6f1eec539275ef2140da652e19102f259ee84ae3432f2c94a862cc22da8957e4b2785cab4eb35c168aa76abbf955e5404008580e264115dc2ec5466373223e0dfa61eff60219165b7a7c6eda22e3b38946fd805408c13229ff88b4b10fc3bfec2f2aeffb4257e2466974f6af0eb1cc8d76345dbdf470748b3d12bb2f6d6b4bdbc8c29d842963a96d305bf7aa2c616f751c216add1be731a1e0f0066b223797a55d3069c4c188fa9dbaeb56026aee5cfd6478487a203455ec7fa32655665177756c5540dd248e77cab6e64ab4f5eca49e60ceb141ab26b240fafc751813806a2f52017c0a3669a0653bded7ae9c0ab80d57155ac9072c2cd8f029db11e4e9eda42c5287273783ae837b0c4a305edbbe89d184cde13eea217c1ddf505642e093000f9dae116c2ae672acfb0a1bec9b1310ef9a16d32b5239e4bb69657a12791af5b70ce568524684789cba926d99c3b0762851196739a345c004419f233f1f6d63f33471241ce10a7ddd389d9b1362eea4fd465368d47f0b39bef7cf06d42a3ae7a4c5eb27de2cd89c6b86dc7d42f1533e8d360da44c4d0ccede67f3abe68675dc2270cc8f0091358ddcc3c035e9f22bc32d26881f2af192b2b51106af9c5856486de0f08a9138e23a5b3486a80cd70071e491585ec3db71a6ca10bbfd747c35d1c0c08c64a0e6f2829acbf7d0c231c69a567370fae017723e3bdf7c084f55fa99818e46d81975f080477d1108f16ab905af6b1aedadcfaf08fa82ef6ce3a81ab5fd42576c3e027fd804e5be5e556edd0cad620fa93d36ca88e49b6e928a39a0ad116151ee9f01c4c167079be5154a6306ef4ecaf33194dcd258f4eac60b57387c0fb3feb38a3f52a644040c40487676f44f3b224e544e358de4bd55ba9fe1f43844624cb67648655eb2b5fc02169682b4c75b6893c4c75ecedf9f321855f76f3d70a878af120b6cd2784cd6e7c06744a2c3e658d822875602ca5e340ccdf1e257f5ac6b994618d955397c9f65fcde13112b7687a36b7348abb735ae01e433061d202bf0fc89e388fd8ec6bbeffec95b4bed7e84c72d5dda294dd0678b0a8bae9fd9b528f0c22b9dac09073d3c6eaa9a2b969a00ac89dcb70f5e80c64867ef1bc0afb0cdc2bee61da7bea7a3926d9c03d2954395af0c29289578d9a0dbd1ebe64b9a5e41a38b26bc33393500a19d0da2258663b97a35752be03dc27c68bd468cfff506704deb1ffbc890823aa6fb665f3e8ef87b67d6735a5e0c89d5364ef87fe739a0df4a2a4e704e77e91d48f8de140623fe8d6a6cc0637233b6c1ae3c1b1ee1a3b5dcd75b89d489ada277ba91d580e9196db3abeba747052c989eebc2861b51016074ab500d78083cb9592b401d16ddde10b1c7ee1b4f7aa0f6a53c001c9027dcf75287aeb4a969eeb6f3d0e50a1447e7642993c3b5ad9f5d115b24863f748c648f3f8209dab67c5f2bca4b1da2e320918634fd56620ac1d57945567902129d285c228c53237348e14e2cd1a8a99bfe13535dfe90ee43721a636adddccc2cd017afdec2bf141c66667991ce9ab6bbd2b7564ee6c2b58c8a7199506111e9996a469ac85475d9a7719345ba6631daf034f24e5ab350624087fcd28a25a03b5b754e99e3e759f0b3fff99671711fb9a36e4b1402209d1bfd3457d212b708770a21b73ee20dad6dc3b95776045f512a583a82184137b010dd8ecaf0ac194813147749ff0cd1d31a160dab7f469318c67e0dbdd84b7c0492d3110f4602978a35280a4b3bf6badb791f0937ce1b36b8fb164b343caeaf8bee248ecbae5fabda69c2a39f1311e1cfe112c62af1daf0b559b9520ccd03a197c5dc632d76f44964ee13301532e273cab5e878ec6260b9c39a682f7b00ebb44cac5a6926c96969551faf464b3f45f6c9252153fb37b2b028a1c142d44003b4103b1b1500ecaf63a4eb30fa4bfd0bfe7f450cecea00db42a58be347babcb52cfd14c27a05b634dfa701e2994048e9e2f54207ba37554d1d18656c6694c0abe68d2a91f32abb87118c8390fb1f493c8f610a08974b9a91af0015a85b7cd4e1fc6298807ba37a5c7d17e351216f0990351cf2e3207dba678570d1de900e60f2550e95e2fb36fc8cbb773dc77ef0ad1e96b750dafd6a9079a0fc65d9be1d8df9fce856094a6e3e6c557f137393c85bcd8e3d5fee6dbbc9d21258bfd099fa4d3eb15d87706bd7933a52c370ab0401c7d205b37f0a6a8bda2fd6ba20a0b20f57c17586719b373a5fadec41646090be8c6f3296e8384b4133e0d25c64bf0557862c1b691201ba7f14c168994ac93d21dd39edcd3e8516156927b6844a37dd8415ecb3a3fecbae6f2933ef7d06ddcb765d9881b672584afa6d10871be7e12aba0c14dc5fe78c9b848cceda9aba5ad4f9acdc3f886fdac5927ff7f065396d622e380f989a7926949e5372dfc2a00ffdfb8d00d4796f466f75860d98ad528403ed6b94fc15c38be06c07a269effb06686fc288de55c684�x�������������`��������XM��(
H�	H�
s!�$c����������������s!r!t!�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������آ�������XN��(
��������0�
%X�$5����������������%X&X$X��x�������������P��������XOޛ(
�(�������j������`X�$p����������������`X_XaX�ixfiles
- Allow restorecon to give an warning on file not found instead of exiting- Upgrade to latest from NSA
        * Merged newrole -l support from Darrel Goeddel (TCS).
- Fix genhomedircon STARTING_UID- Upgrade to latest from NSA
        * Merged fixfiles patch for file_contexts.local from Dan Walsh.- Temp file needs to be created in /etc/selinux/POLICYTYPE/contexts/files/ directory.- Upgrade to latest from NSA
        * Fixed restorecon to not treat errors from is_context_customizable()
          as a customizable context.
        * Merged setfiles/restorecon patch to not reset user field unless
          -F option is specified from Dan Walsh.
        * Merged open_init_pty helper for run_init from Manoj Srivastava.
        * Merged audit2allow and genhomedircon man pages from Manoj Srivastava.- Don't change user componant if it is all that changed unless forced.
- Change fixfiles to concatinate file_context.local for setfiles- Update to latest from NSA- Fix restorecon segfault- Update to latest from NSA
        * Merged fixfiles rewrite from Dan Walsh.
        * Merged restorecon patch from Dan Walsh.- Update to latest from NSA
        * Merged fixfiles and restorecon patches from Dan Walsh.
        * Don't display change if only user part changed.- Fix fixfiles handling of rpm
- Fix restorecon to not warn on symlinks unless -v -v
- Fix output of verbose to show old context as well as new context- Update to latest from NSA
        * Changed restorecon to ignore ENOENT errors from matchpathcon.
        * Merged nonls patch from Chris PeBenito.- Update to latest from NSA
        * Removed fixfiles.cron.
        * Merged run_init.8 patch from Dan Walsh.- Fix run_init.8 to refer to correct location of initrc_context- Upgrade to latest from NSA- Add code to sestatus to output the current policy from config file- Patch audit2allow to return self and no brackets if only one rule- Update to latest from NSA
- Eliminate fixfiles.cron- Only run fixfiles.cron once a week, and eliminate null message- Update with NSA
        * Added -l option to setfiles to log changes via syslog.
        * Merged -e option to setfiles to exclude directories.
        * Merged -R option to restorecon for recursive descent.- Add -e (exclude directory) switch to setfiles
- Add syslog to setfiles- Add -R (recursive) switch to restorecon.- Change to only display to terminal if tty is specified- Only display to stdout if logfile not specified- Add Steve Grubb patch to cleanup log files.- Add optargs
- Update to match NSA- Add fix to get cdrom info from /proc/media in fixfiles.- Add Steve Grub patches for
        * Fix fixfiles.cron MAILTO
        * Several problems in sestatus- Add -q (quiet) qualifier to load_policy to not report warnings- Add requires for libsepol >= 1.1.1- Update to latest from upstream- Update to latest from upstream
- Includes Colin patch for verifying file_contexts- Update to latest from upstream- Update to latest from upstream- Add Man page for load_policy-  new version from NSA uses libsepol- Fix genhomedircon join command- Latest from NSA- Change fixfiles to not change when running a check- Fix restorecon getopt call to stop hang on IBM Arches- Only mail files less than 100 lines from fixfiles.cron
- Add Russell's fix for genhomedircon- Latest from NSA- Add ro warnings- Latest from NSA
- Fix fixfiles.cron to delete outfile- Fix fixfiles.cron to not run on non SELinux boxes
- Fix several problems in fixfiles and fixfiles.cron- Update from NSA
- Add cron capability to fixfiles- Update from NSA- Fix fixfiles to handle no rpm file on relabel- Update latest from NSA
- Add -o option to setfiles to save output of any files with incorrect context.- Add rpm support to fixfiles
- Update restorecon to add file input support- Update with NSA Latest- rebuilt- Fix run_init to use policy formats- Update from NSA- Change location of file_context file- Change to use /etc/sysconfig/selinux to determine location of policy files- Update to latest from NSA
- Change�x����������������������XPŜ(
;��������!�$o����������������!~!�!�s (bug #978233)
- Fix crash with \&$glob_copy (bug #989486)
- Fix coreamp.t's rand test (bug #970567)
- Reap child in case where exception has been thrown (bug #988805)
- Fix using regexes with multiple code blocks (bug #982131)- 5.18.1 bump (see <http://search.cpan.org/dist/perl-5.18.1/pod/perldelta.pod>
  for release notes)
- Disable macro %{rebuild_from_scratch}
- Fix regex seqfault 5.18 regression (bug #989921)
- Fixed interpolating downgraded variables into upgraded (bug #970913)
- SvTRUE returns correct value (bug #967463)
- Fixed doc command in perl debugger (bug #967461)
- Fixed unaligned access in slab allocator (bug #964950)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.16.*)- Perl 5.18 rebuild- Define SONAME for libperl.so and move the libary into standard path
- Link XS modules to libperl.so on Linux (bug #960048)- Do not load system Term::ReadLine::Gnu while running tests
- Disable ornaments on perl5db AutoTrace tests- Update to Perl 5.18.0
- Clean patches, not needed with new version- Edit local patch level before compilation- Do not distribute File::Spec::VMS (bug #973713)
- Remove bundled CPANPLUS-Dist-Build (bug #973041)- Update SystemTap scripts to recognize new phase__change marker and new probe
  arguments (bug #971094)
- Update h2ph(1) documentation (bug #948538)
- Update pod2html(1) documentation (bug #948538)
- Do not double-own archlib directory (bug #894195)- Move CPANPLUS-Dist-Build files from perl-CPANPLUS
- Move CPAN-Meta-Requirements files from CPAN-Meta
- Add perl-Scalar-List-Utils to perl-core dependencies- Require $Config{libs} providers (bug #905482)- Correct typo in perl-Storable file list (bug #966865)
- Remove bundled Storable (bug #966865)- Sub-package Storable (bug #966865)- Use lib64 directories on aarch64 architecture (bug #961900)- Make regular expression engine safe in a signal handler (bug #849703)
- Remove bundled ExtUtils-ParseXS, and Time-HiRes- Sub-package Time-HiRes (bug #957048)
- Remove bundled Getopt-Long, Locale-Maketext, and Sys-Syslog- Fix leaking tied hashes (bug #859910)
- Fix dead lock in PerlIO after fork from thread (bug #947444)
- Add proper conflicts to perl-Getopt-Long, perl-Locale-Maketext, and
  perl-Sys-Syslog- Sub-package Sys-Syslog (bug #950057)- Sub-package Getopt-Long (bug #948855)
- Sub-package Locale-Maketext (bug #948974)- Remove bundled constant, DB_File, Digest-MD5, Env, Exporter, File-Path,
  File-Temp, Module-Load, Log-Message-Simple, Pod-Simple, Test-Harness,
  Text-ParseWords- Filter provides from *.pl files (bug #924938)- Conflict perl-autodie with older perl (bug #911226)
- Sub-package Env (bug #924619)
- Sub-package Exporter (bug #924645)
- Sub-package File-Path (bug #924782)
- Sub-package File-Temp (bug #924822)- Sub-package constant (bug #924169)
- Sub-package DB_File (bug #924351)- Correct perl-Digest-MD5 dependencies
- Remove bundled Archive-Extract, File-Fetch, HTTP-Tiny,
  Module-Load-Conditional, Time-Local- Correct dependencies of perl-HTTP-Tiny
- Sub-package Time-Local (bug #922054)- 5.16.3 bump (see <http://search.cpan.org/dist/perl-5.16.3/pod/perldelta.pod>
  for release notes)
- Remove bundled autodie, B-Lint, CPANPLUS, Encode, File-CheckTree, IPC-Cmd,
  Params-Check, Text-Soundex, Thread-Queue- Fix CVE-2013-1667 (DoS in rehashing code) (bug #918008)- Sub-package autodie (bug #911226)
- Add NAME headings to CPAN modules (bug #908113)- Fix perl-Encode-devel dependency declaration- Sub-package Thread-Queue (bug #911062)- Sub-package File-CheckTree (bug #909144)
- Sub-package Text-ParseWords
- Sub-package Encode (bug #859149)- Remove bundled Log-Message
- Remove bundled Term-UI- Correct perl-podlators dependencies
- Obsolete perl-ExtUtils-Typemaps by perl-ExtUtils-ParseXS (bug #891952)- Sub-package Pod-Checker and Pod-Usage (bugs #907546, #907550)- Remove bundled PathTools- Sub-package B-Lint (bug #906015)- Sub-package Text-Soundex (bug #905889)
- Fix conflict declaration at perl-Pod-LaTeX (bug #904085)
- Rem�x�������������0q�������XQȜ(
8I������`j�������!�$�����������������!�!�!�ExtUtils::ParseXS to 2.2206 (current) to fix Wx build- Make %global perl_default_filter lazy
- Do not hard-code tapsetdir path- added systemtap tapset to make use of systemtap-sdt-devel
- added an example systemtap script- stable update 5.12.3
- add COMPAT- 463773 revert change. txt files are needed for example by UCD::Unicode,
 PDF::API2,...- required systemtap-sdt-devel on request in 661553- create sub-package for CGI 3.49- Sub-package perl-Class-ISA (bug #651317)- Make perl(ExtUtils::ParseXS) version 4 digits long (bug #650882)- 643447 fix redefinition of constant C in h2ph (visible in git send mail,
  XML::Twig test suite)
- remove ifdef for s390- Package Test-Simple tests to dual-live with standalone package (bug #640752)- remove removal of NDBM- Consolidate Requires filtering
- Consolidate libperl.so* Provides- filter useless requires, provide libperl.so- Reformat perl-threads description
- Fix threads directories ownership- sub-package threads- add vendor path, clean paths in Configure in spec file
- create sub-package threads-shared- Do not leak when destroying thread (RT #77352, RHBZ #630667)- Fixing release number for modules- Update to 5.12.2
- Removed one hardcoded occurence of perl version in build process
- Added correct path to dtrace binary
- BuildRequires: systemtap-sdt-devel- run Configure with -Dusedtrace for systemtap support- Run tests in parallel
- Add "-Wl,--enable-new-dtags" to linker to allow to override perl's rpath by
  LD_LIBRARY_PATH used in tests. Otherwise tested perl would link to old
  in-system libperl.so.
- Normalize spec file indentation- 617956 move perlxs* docs files into perl-devel- 614662 wrong perl-suidperl version in obsolete- add temporary compat provides needed on s390(x)- Add Digest::SHA requirement to perl-CPAN and perl-CPANPLUS (bug #612563)- 607505 add another dir into Module::Build (thanks to Paul Howarth)- Address perl-Compress-Raw directory ownership (BZ 607881).- remove patch with debugging symbols, which should be now ok without it
- update to 5.12.1
- MODULE_COMPAT- packages in buildroot needs MODULE_COMPAT 5.10.1, add it back for rebuild- rebuild with tests in test buildroot- MODULE_COMPAT 5.12.0
- remove BR man
- clean configure
- fix provides/requires in IO-Compress- rebuild 5.12.0 without MODULE_COMPAT- initial 5.12.0 build- 463773 remove useless txt files from installation
- 575842 remove PERL_USE_SAFE_PUTENV, use perl putenv- package tests in their own subpackage- add noarch into correct sub-packages
- move Provides/Obsoletes into correct modules from main perl- restore missing version macros for Compress::Raw::Zlib, IO::Compress::Base
  and IO::Compress::Zlib- clean spec a little more
- rebuild with new gdbm- fix license according to advice from legal
- clean unused patches- update subpackage tests macros to handle packages with an epoch properly- add initial EXPERIMENTAL tests subpackage rpm macros to macros.perl- 547656 CVE-2009-3626 perl: regexp matcher crash on invalid UTF-8 characters  
- 549306 version::Internals should be packaged in perl-version subpackage
- Parse-CPAN-Meta updated and separate package is dead- subpackage parent and Parse-CPAN-Meta; add them to core's dep list- exclude "parent".- exclude Parse-CPAN-Meta.- do not pack Bzip2 manpages either (#544582)- do not pack Bzip2 modules (#544582)
- hack: cheat about Compress::Raw::Zlib version (#544582)- switch off check for ppc64 and s390x
- remove the hack for "make test," it is no longer needed- be more careful with the libperl.so compatibility symlink (#543936)- new upstream version
- release number must be high, because of stale version numbers of some
  of the subpackages
- drop upstreamed patches
- update the versions of bundled modules
- shorten the paths in @INC
- build without DEBUGGING
- implement compatibility measures for the above two changes, for a short
  transition period
- provide perl(:MODULE_COMPAT_5.10.0), for that transition period only- fix patch-update-Compress-Raw-Zlib.patch (did not patch Zlib.pm)�x��������������`�������XR��(
���������o������6��$&����������������6�7�5��com> - 4:5.10.0-1Robin Norwood <rnorwood@redhat.com> - 4:5.10.0_RC2-0.1- Fix CVE-2025-40909 - Clone dirhandles without fchdir
- Fix test broken by update in zlib on s390x- Add definition of OPTIMIZE to .ph files, if optimizing is used
  (bug#2152012)- Fix a memory leak when compiling a regular expression with a non-word
  class (bug #2014981)- Fix _resolv return value in Net-Ping (bug #1973030)- Fix CVE-2020-10543 (bug #1839273)
- Fix CVE-2020-10878 (bug #1839276)
- Fix a file mode of a perl-example.stp example (bug #1913693)- Fix CVE-2020-12723 (bug #1839279)- Fix Time-Local tests to pass after year 2019 (bug #1807120)
- Run-require perl(Encode) by perl-libs (bug #1903503)- 5.26.3 bump (bug #1655526)
- Fix CVE-2018-18311 (integer overflow leading to buffer overflow) (bug #1654920)
- Fix CVE-2018-18312 (heap buffer overflow in regcomp.c) (bug #1654922)
- Fix CVE-2018-18313 (heap buffer overflow read in regcomp.c) (bug #1654924)
- Fix CVE-2018-18314 (heap based buffer overflow) (bug #1654925)- Install Encode developmental files when installing complete Perl
  (bug #1645225)- Fix annocheck failure by passing CFLAGS to dtrace (bug #1630617)- Adjust tests to gdbm-1.15 (RT#133295)
- Fix an integer wrap when allocating memory for an environment variable
  (RT#133204)
- Fix printing a warning about a wide character when matching a regular
  expression while ISO-8859-1 locale is in effect
- Fix invoking a check for wide characters while ISO-8859-1 locale is in effect- perl-devel requires redhat-rpm-config because of hardened compiler profiles
  (bug #1557667)
- Do not clobber file bytes in :encoding layer (RT#132833)
- Fix line numbers in multi-line s/// (RT#131930)
- Fix parsing extended bracketed character classes (RT#132167)
- Fix a possibly unitialized memory read in the Perl parser (RT#133074)
- Fix an infinite loop in the regular expression compiler (RT#133185)- Correct license tags of perl-libs (bug #1579524)- 5.26.2 bump
- Fix CVE-2018-6913 (heap buffer overflow in pp_pack.c) (bug #1567776)
- Fix CVE-2018-6798 (heap read overflow in regexec.c) (bug #1567777)
- Fix CVE-2018-6797 (heap write overflow in regcomp.c) (bug #1567778)- Rebuild to pick up new build flags from redhat-rpm-config- Escape macros in %changelog- Fix parsing braced subscript after parentheses (RT#8045)
- Fix a heap use after free when moving a stack (RT#131954)
- Call ldconfig scriptlets using a macro- Correct shell bangs in tests- Link XS modules to pthread library to fix linking with -z defs- Add patch to conditionalize a fix for an old and long fixed bug
  in libcrypt / glibc (rhbz#1536752)- Rebuild against glibc without nsl library- Remove invalid macro definitions from macros.perl (bug #1532539)
- Fix an overflow in the lexer when reading a new line (RT#131793)
- Fix Term::ReadLine not to create spurious &STDERR files (RT#132008)
- Fix a crash when a match for inversely repeated group fails (RT#132017)
- Fix an overflow when parsing a character range with no preceding character
  (RT#132245)
- Fix walking symbol table for ISA in Carp
- Fix handling file names with null bytes in stat and lstat functions
  (RT#131895)
- Fix a crash when untying an object witout a stash
- Fix deparsing of transliterations with unprintable characters (RT#132405)
- Fix error reporting on do() on a directory (RT#125774)
- Fix stack manipulation when a lexical subroutine is defined in a do block in
  a member of an iteration list (RT#132442)
- Fix setting $! when statting a closed file handle (RT#108288)
- Fix tainting of s/// with overloaded replacement (RT#115266)
- Expand system() arguments before a fork (RT#121105)
- Avoid undefined behavior when copying memory in Glob and pp_caller (RT#131746)- Update perl(:MODULE_COMPAT)- 5.26.1 bump (see <http://search.cpan.org/dist/perl-5.26.1/pod/perldelta.pod>
  for release notes)- Fix unreliable Time-HiRes tests (CPAN RT#122819)
- Do not require $Config{libs} providers by perl-devel package (bug #1481324)- Fix reporting malformed UTF-8 character (RT#131646)
- Fix File::Glob r�x������������� P�������XSƜ(
@p������8Z�������!�$�����������������!!�!�ove bundled Module-Pluggable (bug #903624)- Run-require POD convertors by Module-Build and ExtUtils-MakeMaker to
  generate documentation when building other packages- Sub-package Pod-LaTeX (bug #904085)- Remove bundled Pod-Parser- Fix CVE-2012-6329 (misparsing of maketext strings) (bug #884354)- Do not package App::Cpan(3pm) to perl-Test-Harness (bug #893768)- Remove bundled Archive-Tar
- Remove bundled CPAN-Meta-YAML
- Remove bundled Module-Metadata- Remove bundled Filter modules- 5.16.2 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)- Remove bundled podlators (bug #856516)- Do not crash when vivifying $| (bug #865296)- Conflict perl-podlators with perl before sub-packaging (bug #856516)- Do not leak with attribute on my variable (bug #858966)
- Allow operator after numeric keyword argument (bug #859328)
- Extend stack in File::Glob::glob (bug #859332)- Put perl-podlators into perl-core list (bug #856516)- Remove bundled perl-ExtUtils-Manifest
- perl-PathTools uses Carp- Override the Pod::Simple::parse_file to set output to STDOUT by default
  (bug #826872)- Sub-package perl-podlators (bug #856516)- Do not access freed memory when cloning thread (bug #825749)
- Match non-breakable space with /[\h]/ in ASCII mode (bug #844919)
- Clear $@ before `do' I/O error (bug #834226)
- Do not truncate syscall() return value to 32 bits (bug #838551)- Move App::Cpan from perl-Test-Harness to perl-CPAN (bug #854577)- Remove perl-devel dependency from perl-Test-Harness and perl-Test-Simple- define perl_compat by macro for rebuilds
- sub-packages depend on compat rather than on nvr- apply conditionals for dual life patches- 5.16.1 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)
- Fixed reopening by scalar handle (bug #834221)
- Fixed tr/// multiple transliteration (bug #831679)
- Fixed heap-overflow in gv_stashpv (bug #826516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Move the rest of ExtUtils-ParseXS into its sub-package, so that the main
  perl package doesn't need to pull in perl-devel (bug #839953)- Fix broken atof (bug #835452)- perl-Pod-Perldoc must require groff-base because Pod::Perldoc::ToMan executes
  roff- Test::Build requires Data::Dumper
- Sub-package perl-Pod-Parser- Remove MODULE_COMPAT_5.14.* Provides- Perl 5.16 rebuild- perl_bootstrap macro is distributed in perl-srpm-macros now- Own zipdetails and IO::Compress::FAQ by perl-IO-Compress- Fix find2perl to translate ? glob properly (bug #825701)- Shorten perl-Module-Build version to 2 digits to follow upstream- upload the stable 5.16.0- clean patches, not needed with new version
- regen by podcheck list of failed pods. cn, jp, ko pods failed. I can't decide
  whether it's a real problem or false positives.- Enable usesitecustomize- Rebuild perl against Berkeley database version 5 (bug #768846)- perl-Data-Dumper requires Scalar::Util (bug #811239)- Sub-package Data::Dumper (bug #811239)- Sub-package Filter (bug #790349)- Fix searching for Unicode::Collate::Locale data (bug #756118)
- Run safe signal handlers before returning from sigsuspend() and pause()
  (bug #771228)
- Correct perl-Scalar-List-Utils files list
- Stop !$^V from leaking (bug #787613)- Rebuild again now that perl dependency generator is fixed (#772632, #772699)- perl-ExtUtils-MakeMaker sub-package requires ExtUtils::Install- Rebuild for gcc 4.7- Fix interrupted reading. Thanks to Šimon Lukašík for reporting this issue
  and thanks to Marcela Mašláňová for finding fix. (bug #767931)- Fix leak with non-matching named captures (bug #767597)- Sub-package ExtUtils::Install
- Sub-package ExtUtils::Manifest
- Do not provide private perl(ExtUtils::MakeMaker::_version)- Add $RPM_LD_FLAGS to lddlflags.- Sub-package Socket- Sub-package Pod::Perldoc- Increase epoch of perl-Module-CoreList to overcome version regression in
  upstream (bug #754641)- perl(DBIx::Simple) is not needed in spec requirement in CPANPLUS. It's genera�x��������������?�������XTߜ(
x3PZ������L��$\����������������L�M�K��f291bb2305ec9c43b9a84ad5f2342bdc8940f002512b693205da74c58474b0457c0abb5aad1039250b135335ab7103834b60336c29301695bc97f21e4ab370dbe97efb310aac6d36dc1bd979c817cc083eea34485522313b613b15bc3e4359fb18829024ac9f27f37700b481a0916eb5f2233cc8c6da3a263bd716ba020218783d2b5ac461aab6118483414afbe26afb2c3eae7e9828dccbefc4a2fac00a148187e5a8ca6f18dc6883bf401a5d88d77d2a25f41279a8597b84c62b0ed134a8b5c141643e9bef8711812d8dab39002218b35a267cc0c4dee248ff9cd67a76022a41e19541fbc63857818645c2abe1c2544e1472e4de3c789ed89db516a274a8e18b3a1e0591afb618e5df9ec688670d5e2d3c0cca7d474d447cf79e473228ab9a0826b4dd47ebfad3d503917ce737f678089010d3f91313fce38b539cb3fa3f7865b261a8b4adf6443b27aad6c5bf2c734f02b7d19f07de5f32645e5750e98cf4e7817516f83c2df5b22028b08567123f786dc7431314b0f684fa82c1395d3b4c30e8f4f6da5bcc3999ad4178274fbe4fdd933bcce0969880ce06063f838e5706d1b6b382abfea6f3fcd7f3b9e5dace6b426f8effe8e0b699862841ca46774f29162799810165265f0fc066d2200cb757a14181030c1e8a61d094d64734345a826c9838f361dbf252c711efc4472eebf39433f3a94a02e2a4f5d434978d5fa8e6124d1ec5f78007540d2234b954366012056de48c63860bc375f4a880f779dd046d2c2898c92a6980777d374755d98ce54a76fe4bad7375128cd77599411d8c25ea2deb1113494b1eeb876e95b56c86856a754ccaa2467ad527824b017736b4d2353587024fc0d76fd04adc4e10aeab2d0ee919dfa22bdf195efc67d4d960701aba4a83311b2b4cf4fe76cbdfc73380cd42da3d39df04bf69a50314e897c1802a1a932f19e333e7351bff952915799c977828aa9874a2e4dfe1044f4c5ccbfb1f0178c75be681d0437cca409b7daad495605b5e1da13ab708972979b51a5183f51e27c0584b6c84ffd5349143a26b9c68a4de3493fc08185047e85435055cb4c75e941e570072dd7b6239a6cb594f03dc4fd9a95b1f031de0d7bd51a1db06c5f7cbfe90cf02117ae3153dcaf3005a13c3a6316ea71e8253fdc55e6941769bcd30492b62358faf56c4a2374a927d403943480a0586081b042701b4ae2314f59ea8913fc3f4d84ab357cb1d8eef5bde716827fdf502681a66ae55bd789a2e1a6885545159a2d535f94b1beb8b82b22a77bf60e938485224bb9239513bc2c0fe0c2c2a49c9bf0b761c49ffb8f44108df0190177390277347167fff6b234f1b64786e9366954877597724e5d41b86abf4e79b1bf6fe7203cc60721a2cfa1dd5d1569381366039f5ff29d5158c2af6d132c7c074b8f4f122a39e3f11715780d14901705179c5ff858c96b8466afb8c66209844352e1b8c0b9d2343c853ec1bb6364ad4598b12b1f538a15d28caf942f72a0e057b4140e508374d5cc54d1b059f94058a1e3659bc95b14d842c543bd2697c4d26ae6fb2878e3549ad09490330909f81ae68dec951ed353df6e0e1ee2aa6cfd962729a14c70a734af191dd9cbaf638e38659ce21d7d6590bb6ba59b2ddf7f874acea2f403163f9ae27109b3a7a547471e64095c3eb94269beaf00c327b5b0cfff235c5a6f0b18bf97d85a8021e40c4b2f1b7a3700de22e5f5be423aa320ec9a7ddf2e63ae95eb154d9e9496b6d972400d2ce4c238bdf5326e609ba9e4cb427740bd1f65399fcd162e281dcca8f995020811ed8442850a006396233fa7ef4f1d3ad64c9180b0d3df2ac33d3c16170490fff8aef478ab77d02c93950cedf4ecd6be86794961014f5701d779205b1fbe4982d5e628bbaa5bee8d5793fefdb6a548cbf7698a1a1f2ce23832ca45a0a46674b63330807e4e9795aa95e68c84add08140f81f40ad3901408f8c64d2f858f3d61b1492e020579a46b93a9426ec51e88c476332447fb25ec766aacefd6181bfad905bba96965f19e82eec485c3d312d9ecbce9839ce32292431c920f3a1b9d7ace886ec7d07611ebcbea010e0bd4212e03813708156a3961047f3d440dc73fb39fa782034cd97a86b414a08da95c7872d15104c06a719ef3a6ef77989b83c9b273767c7c9cdd8b847e91182f0bf688acf79a0fb490e726ef8769ec6704553493acbfc0b148aeab03fe49ef17f62ceb7a772d7fc5fe3c4c540a79e627934488e1704e4233bbca8b59cfcd4ed22d8be4525bd09505bc60ecae41d76e5a369a00c9a891f6de538942cfeb4f3ee30d5d606dd0d0eeb72fc03de9260c57a8497a2ca72e921fcf8beabeacfd8e99d9f6fb5e9b9efa318c7ec96a330317445e47654f18be13f16d065847b1386c068a33334fafc6e568fd236ddd01a29e99f65b001ae57767dea4e611b8048c3780ad657cc414a86763f96866b52adac87aab5150123fcace0b68135e64240a82a122cab0ad124757a6d4d6db39284bd7b349794aaaefb20cb14907c2c4745ae4e20fe8f558e9a16a9984ddec73e43b9f481aabda6f89d9a3e221cc9ebe59b339eaec6c375bd49fe9bf4cda86c96b3f827cab53d030b4c7b65c6817a5ef6e8ec54eafae17d86ccdf33c466b7ea200b5fe30e800f510f6ea6d1fdf66d15f2b75b35e6be3b4968846f2774f3d93f54ca5f67ebb4c6aa37027c2daf38a1b88b7052b3ea0a137ab9d109aac47584996329395a5bc61faad006d0872be6d6ef6868420979c117208080f682e2fadf8288e346188ca1e3d3b4e87036f597646907627644e3d6d8fbff743f2f7�x�������������/�������XU�(
���������������x�$h����������������xwy�								
	
	



	


	



RRR$R!R RRQRRaRR#R$RR!R RRRaRR$RR!R RRRaRR$RR!R RRRaR R!RRRaRR$RR!R RRRaRMRNRLRJRIRR$RR!R RRHRRaRR#RR$RR!R RRQRDRRaR;R6RRRR$RR#R!R RR5R	RYRFRDRRaRR$RR!RR RRRaRJRIRR$RR!R RRHRRaR
RSRKRJRIR$RRR!R RR8R9R:R>R<R7R;R6R5R	RFRDRHRYRRRRaRERR$RR!RR RRDRRaRR R!RRRaRRR$R!R RRQRRaRR$RR!R RRRaRRRRR$RR!R RRRRaRR$RR!R RRRaRR#R$RR!R RRRaRR$RR!R RRRaRR$RR!R RRRaRR#R$RR!RR RRDRRaRPRRR$RR!R RRORRaRCRARRR$R#R!R RR@RBRRFRRaRR R!RRRaRSRRRMRJRIRRRR$R#R!R RR9R;R6R	R5RYRFRDRHRRRRaRJRIRRR#R$RR!R"R RRHRRaRJRIRR#R$RR!R RRHR�x���������������������XVԜ(
P� :������p�$`����������������pq�O1�?,|d����	�	2���������������	���7�=�D��,\	t
���
��Ut��	<�(�8�99�9:^9=&Q>&Y?&a@&iG&tH&�I&�X&�Y&�\']'D^'�b(�d)�e)�f)�l)�t)�u*,v*\w+�x+�y+�
�,,�,0�,6�,x,�,�6.�.�6
115�1x1|1�g1�h1�Ctrousers0.3.152.el8TCG's Software Stack v1.2TrouSerS is an implementation of the Trusted Computing Group's Software Stack
(TSS) specification. You can use TrouSerS to write applications that make use
of your TPM hardware. TPM hardware can create, store and use RSA keys
securely (without ever being exposed in memory), verify a platform's software
state using cryptographic hashes and more.fC0x64-ci01.almalinux.org�^AlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>System Environment/Librarieshttp://trousers.sourceforge.netlinuxx86_64getent group tss >/dev/null || groupadd -f -g 59 -r tss
if ! getent passwd tss >/dev/null ; then
    if ! getent passwd 59 >/dev/null ; then
      useradd -r -u 59 -g tss -d / -s /sbin/nologin -c "Account used for TPM access" tss
    else
      useradd -r -g tss -d / -s /sbin/nologin -c "Account used for TPM access" tss
    fi
fi
exit 0
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset tcsd.service &>/dev/null || : 
fi
if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now tcsd.service &>/dev/null || : 
fi
if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart tcsd.service &>/dev/null || : 
fi�����\"u���A�A�����A큤������A�fC/fC0fC0fC0fC/fC0fC0_�L�^�S�fC&fC&fC/eb009b7d1132ac33411e8f838c7e272606c8dd1d8944bc8b82ee28f9114e82fcfbdf7fb4f1584000a9d8325dc3bf855a60cae23f039bb062b7a8ea4edfd3e06e848efbe9340b08caa03efa4dce2bd67f14347139f66ef9e79f3202d21d2031a0fccf2c7a906ae571849fc1bacd98f3e070e4da85b2ec6e937aa45ca1323b55efe10fd3096b3fca327b01803d91959817028371fe8d9e1970256bc56aeb1bdc11f757ef7717ef3bea4827b60c632bebaad57f3f797e4ae16586488544462d7a953a5f497a4a34f03c8da37d1b0e530389d504b1c14b72c85c64d1a9342bce1002../../../../usr/sbin/tcsdrootrootrootrootrootrootrootrootrootrootroottsstssrootrootrootrootrootrootrootrootrootroottsstrousers-0.3.15-2.el8.src.rpm������������������������������������������������config(trousers)trouserstrousers(x86-64)	@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/sh/bin/shconfig(trousers)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)rpmlib(CompressedFileNames)rp�x��������������
�������X#��(
�������� ]	1Y�����$!����������������1Y2Y0Y��x�������������x��������XX��(
�*PW��������$m��������������������encryption works also without volume keys put in kernel
  keyring service.
- Resolves: #1757783 #1750680 #1753597 #1743399- patch: Fix mapped segments overflow on 32bit architectures.
- patch: Take optimal io size in account with LUKS2 reencryption.
- Resolves: #1742815 #1746532- Update to cryptsetup 2.2.0 (final)
- Resolves: #1738263 #1740342 #1733391 #1729600 #1733390- Updates to reencryption feature.
- Resolves: #1676622- Update to cryptsetup 2.2.0
- remove python bits from spec file.
- Resolves: #1676622- Add gating tests.
- Resolves: #1682539- Update to cryptsetup 2.0.6
- Enables all supported metadata sizes in LUKS2 validation code.
- Resolves: #1653383- patch: fix device alignment bug when processing hinted
  value by device topology info.
- Resolves: #1614219- Update to cryptsetup 2.0.4.
- patch: Add RHEL system library paths in configure.
- patch: Increase default LUKS2 header size to 8 MiBs.
- patch: update tests to be compatible with larger headers.
- Set default format to LUKS2.
- Cleanup changelog.
- Resolves: #1564540 #1595257 #1595266 #1595881 #1600164- Update to cryptsetup 2.0.3.- Rebuilt for libjson-c.so.4 (json-c v0.13.1) on fc28- Update to cryptsetup 2.0.2./sbin/ldconfig/sbin/ldconfigcryptsetup-luks-libs	

csdadeesfifriditjanlplptrusrsvukvizh��2.3.7-7.el82.3.7-7.el82.3.7-7.el81.4.0	

cryptsetup.build-id8c384cf3ea462026aedc9924b6e569eec1e93cb2cryptsetup.conflibcryptsetup.so.12libcryptsetup.so.12.6.0cryptsetup-libsCOPYINGCOPYING.LGPLcryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mocryptsetup.mo/run//usr/lib//usr/lib/.build-id//usr/lib/.build-id/8c//usr/lib/tmpfiles.d//usr/lib64//usr/share/licenses//usr/share/licenses/cryptsetup-libs//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sr/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8c384cf3ea462026aedc9924b6e569eec1e93cb2, strippedPPRRRRRRRRR	RRR
RRRR
RRRRRRRRRRRR utf-8408545425e50238e80edb006c5232a5bf2f8b6a10a36�x��������������������XY��(
:@�	��$l��������������������CRYPTSETUP_2.0)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@@



@/sbin/ldconfig/sbin/ldconfiglibblkid.so.1()(64bit)libblkid.so.1(BLKID_2.15)(64bit)libblkid.so.1(BLKID_2.17)(64bit)libblkid.so.1(BLKID_2.21)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdevmapper.so.1.02()(64bit)libdevmapper.so.1.02(Base)(64bit)libdevmapper.so.1.02(DM_1_02_97)(64bit)libjson-c.so.4()(64bit)libjson-c.so.4(JSONC_0.14)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libssl.so.1.1()(64bit)libuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3d�D@d� �c�S@c��@cd��bs@a�N�`-@`�@_G�@^ϧ�^�%@]҇�]i�]UI@]�@\�-@\�|�\�[m~@[j�@Z�K@Z�2@Z��@Ondrej Kozina <okozina@redhat.com> - 2.3.7-7Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-6Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-5Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-4Daniel Zatovic <dzatovic@redhat.com> - 2.3.7-3Ondrej Kozina <okozina@redhat.com> - 2.3.7-2Ondrej Kozina <okozina@redhat.com> - 2.3.7-1Ondrej Kozina <okozina@redhat.com> - 2.3.3-4Ondrej Kozina <okozina@redhat.com> - 2.3.3-3Ondrej Kozina <okozina@redhat.com> - 2.3.3-2Ondrej Kozina <okozina@redhat.com> - 2.3.3-1Ondrej Kozina <okozina@redhat.com> - 2.3.1-1Ondrej Kozina <okozina@redhat.com> - 2.2.2-1Ondrej Kozina <okozina@redhat.com> - 2.2.0-2Ondrej Kozina <okozina@redhat.com> - 2.2.0-1Ondrej Kozina <okozina@redhat.com> - 2.2.0-0.2Ondrej Kozina <okozina@redhat.com> - 2.2.0-0.1Milan Broz <mbroz@redhat.com> - 2.0.6-2Ondrej Kozina <okozina@redhat.com> - 2.0.6-1Ondrej Kozina <okozina@redhat.com> - 2.0.4-2Ondrej Kozina <okozina@redhat.com> - 2.0.4-1Ondrej Kozina <okozina@redhat.com> - 2.0.3-1Björn Esser <besser82@fedoraproject.org> - 2.0.2-2Milan Broz <gmazyland@gmail.com> - 2.0.2-1- Rebuild due to missing CI environment
- Resolves: #2212772 #2193342- patch: Delegate FIPS mode detection to configured crypto backend
- patch: Disallow use of internal kenrel crypto driver names in "capi"
- patch: Also disallow active devices with internal kernel names
- patch: Fix init_by_name to allow unknown cipher format in dm-crypt
- patch: Fix reencryption to fail properly for unknown cipher
- patch: Fix activation of LUKS2 with capi format cipher and kernel
- Resolves: #2212772 #2193342- change cryptsetup-devel dependency from cryptsetup to cryptsetup-libs
- Resolves: #2150254- patch: Remove LUKS2 encryption data size restriction.
- patch: Abort encryption when header and data devices are same.
- Resolves: #2150254- patch: Fix internal crypt segment compare routine
- Resolves: #2110810- patch: Fix cryptsetup --test-passphrase when device in
  reencryption
- Resolves: #2058009- update to cryptsetup 2.3.7
- fixes CVE-2021-4122
- patch: Fix suboptimal optimization in bundled argon2.
- patch: Fix bogus memory allocation/device read with
         invalid LUKS2 headers
- patch: Fix typo in luksRepair prompt.
- Resolves: #2021815 #2022301 #2031859- patch: Fix reencryption for custom devices with data segments
  set to use cipher_null.
- Resolves: #1927409- patch: Fix crypto backend to properly handle ECB mode.
- Resolves: #1859091- patch: Fix possible memory corruption in LUKS2 validation
	 code in 32bit library.
- Resolves: #1872294- Update to cryptsetup 2.3.3
- Resolves: #1796826 #1743891 #1785748- Update to cryptsetup 2.3.1
- Resolves: #1796826 #1743891 #1785748- Update to cryptsetup 2.2.2
- LUKS2 reencryption honors activation flags (one time and persistent).
- LUKS2 re�x�������������h�������XZ��(
�|��������$V��������������������params 
  by adding checking statements and display usage (msghack.py modified)
- rpath patch for binary-or-shlib-defines-rpath in x86_64.- fix autopoint messing up CVS files with upstream patch (#441481)- if %buildjar is off make sure libintl.jar does not get installed (#433210)- turn on building of libintl.jar now that we have gcc43- rebuild with gcc43- update to 0.17 release
  - update License field to GPLv3
  - add gettext-0.17-open-args.patch to fix build from upstream
  - gettext-tools-tests-lang-gawk-fail.patch, gettext-php-headers.patch,
    gettext-php-prinf-output-237241.patch, and
    gettext-xglade-define-xml-major-version-285701.patch are no longer needed
- drop superfluous po-mode-init.el source
- no need to run autoconf and autoheader when building
- pass -findirect-dispatch to gcj to make java binaries ABI independent
  (jakub,#427796)
- move autopoint, gettextize, and {_datadir}/{name}/ to main package
- force removal of emacs/ so install does not fail when no emacs- add a libs subpackage (suggested by Dwayne Bailey, #294891)
- move preloadable_libintl.so to the devel subpackage- remove gettext-xglade-include-expat-285701.patch, add
  gettext-xglade-define-xml-major-version-285701.patch to determine
  XML_MAJOR_VERSION from expat.h and define it in config.h (#285701)- buildrequire expat-devel
- add gettext-xglade-include-expat-285701.patch to include expat.h
  to get xgettext to dl the right libexpat (Nils Philippsen, #285701)- specify license is GPL and LGPL version 2 or later- fix encoding of msghack script (Dwayne Bailey, #250248)- add gettext-php-prinf-output-237241.patch to workaround php test failure
  (#237241)
- add gettext-php-headers.patch to correct php test headers
  (Robert Scheck, #232832)- set preloadable_libintl.so executable in %install so it gets stripped
- force removal of infodir/dir since it is not there when /sbin is not in path- add buildjar switch for building of libintl.jar
- lots of spec file cleanup (Mamoru Tasaka, #225791):
- preserve timestamps of installed files
- disable building of static library
- use %find_lang for .mo files
- remove examples from -devel package
- do not own en@*quot locale dirs
- set preloadable_libintl.so executable
- add ChangeLog to -devel package
- add %check to run make check
- add gettext-tools-tests-lang-gawk-fail.patch to work around gawk test failure- rebuild to pick up dependency on libgcj.so.8rh instead libgcj.so.7rh- protect install-info in devel %post and %preun too (Ville Skyttä, #223689)
- forward port fix to reset of timestamp of examples ChangeLog for
  brp-java-repack-jars libintl.jar multilib conflict (#205207)- protect install-info in %post and %preun (Ville Skyttä, #223689)- update to 0.16.1- re-enable openmp on ia64- update to 0.16 release
- disable openmp on ia64 (#216988)- update to 0.15 release
- mkinstalldirs and libintl.jar are gone
- javaversion.class added- buildrequire zip and unzip to fix libintl.jar multilib conflict (#205207)- move libgettext*.so devel files to devel package (Patrice Dumas, #203622)- update to 0.14.6
- include preloadable_libintl.so again (Roozbeh Pournader, #149809)
- remove .la files (Kjartan Maraas, #172624)
- cleanup spec file- Bump release number.- rebuild- --disable-csharp, otherwise it'll build a dll when mono is 
  installed in the buildroot.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt again- rebuilt- convert spec to UTF-8
- remove old tarballs from sources- updated to 0.14.5
- Add cvs as Requires for gettext-devel- updated to 0.14.3
- fixed compiling problem on gcc4 (#150992)
- fixed Group for -devel (#138303)
- moved gettextize and autopoint to -devel (#137542, #145768)
- moved some of the man pages- rebuilt with gcc 4.0- Add env var to redirect use fastjar instead of jar
- BuildRequires fastjar and libgcj- fix call on phase0_getc()
- fix temp file issue (#136323 - CAN-2004-0966 - mjc)- fixed typo on %preun on -devel- fix install_info
- add gcc-java build requirement- mo�x���������������������X[�(
H�0��������$�������������������JcT?_<d��
��	�	1�p�t�����������	�����H	^
t��
,c���	�@	t	�	�	�(	�8	��9��:)g�GX�HX�IYXY$	YYH	\Yl]Y�^Z6	bZ�d\8e\=f\@l\Bt\\u\�v\�w]�x^y^<,�^��^��^��_8_L_P�aa�
b�b��c8c<cHgcLhcPClibsolv0.7.206.el8Package dependency solverA free package dependency solver using a satisfiability algorithm. The
library is based on two major, but independent, blocks:

- Using a dictionary approach to store and retrieve package
  and dependency information.

- Using satisfiability, a well known and researched topic, for
  resolving package dependencies.e'+&x64-builder01.almalinux.orgC�AlmaLinuxAlmaLinuxBSDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttps://github.com/openSUSE/libsolvlinuxx86_64%"	?P�xneA�A�A����A큤A큤e'+%e'+%e'+%e'+%e'+%e'+%e'+%e'+%aO��e'+%aO��6bec96c1e60a28588d93d6555a913d4496cc24706f53ae28d42686fb281f1402d5171e5d258439829c7b4b987aa16cdb9fea08e7bf099fe1d8b869168fa41cab77b1004a889df14cf6d5a1b71e1d6cf17f89cdb6e408be77d3f4bb59f8a01c7d57f15acfb29fbef7749779e096a5885c60b716633e34484a21bb717554c0198f../../../../usr/lib64/libsolvext.so.1../../../../usr/lib64/libsolv.so.1�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibsolv-0.7.20-6.el8.src.rpm��������������������������������������������libsolvlibsolv(x86-64)libsolv.so.1()(64bit)libsolv.so.1(SOLV_1.0)(64bit)libsolv.so.1(SOLV_1.1)(64bit)libsolv.so.1(SOLV_1.2)(64bit)libsolv.so.1(SOLV_1.3)(64bit)libsolvext.so.1()(64bit)libsolvext.so.1(SOLV_1.0)(64bit)@@@@@@@@@@@@@@@@@@@@@@@@@@



@libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)liblzma.so.5()(64bit)liblzma.so.5(XZ_5.0)(64bit)librpm.so.8()(64bit)librpmio.so.8()(64bit)libsolv.so.1()(64bit)libsolv.so.1(SOLV_1.0)(64bit)libsolv.so.1(SOLV_1.1)(64bit)libsolv.so.1(SOLV_1.3)(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)libz.so.1()(64bit)libz.so.1(ZLIB_1.2.3.3)(64bit)libzstd.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-1rpm(x86-64)4.14.34.14.3d��@dd��c��@bs�@brj�a�b�`��@`��@`���`2@_��@^��\���\���\�t@\��\]o@\Z�@\�@[ā@[�Z��Z���Z��@Zz�@Zq��Zp^@Zp^@Zp^@Zo�Zo�Zo�Zo�Z�ZN�Y�+@Y��Y�4�Y��@Y�J�Y�J�Y�@Y�@Yx�@Yq�YW��Y,
@Y�X��X�!@X�~@X�O@X�B�X���Xx�@XN�@XJ��X%��X�@W��@W���W��@W��W��@W�g�W�@W_�WUe�WL+@W<Y@W;�W�W��V޾�Vя�V��@V��V�G�V��@Vs�@Vr��Vf�@VV�@VLh@VLh@VA�@VC�V��U�p�U���U��@U���U��x�������������X��������X\�(
��������Ȟ�d�$]�����������������d�d�d�
��	��	�	��	�*A큤������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤�������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x����������������������XMk�(
h4�������{d�����$k����������������{d|dzd��x�������������H��������X^�(
0��g�������d�$_�����������������d�d�d�	`	�
n	g
"
w		K	;	L
	s
;	�
�	�	|	w
!
b	0	�	k'�}
�o#�����	=
���
��L�
�	��!\�K�	�""����C	[	\�g��
m��
�
B��
L
Y	
��
�
�
�	Nx�4�	Q$$�$$$$$$$$$	3
�
�+
z
m	B"0
Z�ujt''''	;
@
� 	�%W	�#
�$*	]%**
	�%
""%%!#!%%"+""&$$$	v�#��#
�
H�	fA&"&&

��">+h��
JRs00�	�#
A%'%%%	��s
<�'%�x����������������������X_��(
���	0��$ ����������������0�1�/��ug #826872)- Sub-package perl-podlators (bug #856516)- Do not access freed memory when cloning thread (bug #825749)
- Match non-breakable space with /[\h]/ in ASCII mode (bug #844919)
- Clear $@ before `do' I/O error (bug #834226)
- Do not truncate syscall() return value to 32 bits (bug #838551)- Move App::Cpan from perl-Test-Harness to perl-CPAN (bug #854577)- Remove perl-devel dependency from perl-Test-Harness and perl-Test-Simple- define perl_compat by macro for rebuilds
- sub-packages depend on compat rather than on nvr- apply conditionals for dual life patches- 5.16.1 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)
- Fixed reopening by scalar handle (bug #834221)
- Fixed tr/// multiple transliteration (bug #831679)
- Fixed heap-overflow in gv_stashpv (bug #826516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Move the rest of ExtUtils-ParseXS into its sub-package, so that the main
  perl package doesn't need to pull in perl-devel (bug #839953)- Fix broken atof (bug #835452)- perl-Pod-Perldoc must require groff-base because Pod::Perldoc::ToMan executes
  roff- Test::Build requires Data::Dumper
- Sub-package perl-Pod-Parser- Remove MODULE_COMPAT_5.14.* Provides- Perl 5.16 rebuild- perl_bootstrap macro is distributed in perl-srpm-macros now- Own zipdetails and IO::Compress::FAQ by perl-IO-Compress- Fix find2perl to translate ? glob properly (bug #825701)- Shorten perl-Module-Build version to 2 digits to follow upstream- upload the stable 5.16.0- clean patches, not needed with new version
- regen by podcheck list of failed pods. cn, jp, ko pods failed. I can't decide
  whether it's a real problem or false positives.- Enable usesitecustomize- Rebuild perl against Berkeley database version 5 (bug #768846)- perl-Data-Dumper requires Scalar::Util (bug #811239)- Sub-package Data::Dumper (bug #811239)- Sub-package Filter (bug #790349)- Fix searching for Unicode::Collate::Locale data (bug #756118)
- Run safe signal handlers before returning from sigsuspend() and pause()
  (bug #771228)
- Correct perl-Scalar-List-Utils files list
- Stop !$^V from leaking (bug #787613)- Rebuild again now that perl dependency generator is fixed (#772632, #772699)- perl-ExtUtils-MakeMaker sub-package requires ExtUtils::Install- Rebuild for gcc 4.7- Fix interrupted reading. Thanks to Šimon Lukašík for reporting this issue
  and thanks to Marcela Mašláňová for finding fix. (bug #767931)- Fix leak with non-matching named captures (bug #767597)- Sub-package ExtUtils::Install
- Sub-package ExtUtils::Manifest
- Do not provide private perl(ExtUtils::MakeMaker::_version)- Add $RPM_LD_FLAGS to lddlflags.- Sub-package Socket- Sub-package Pod::Perldoc- Increase epoch of perl-Module-CoreList to overcome version regression in
  upstream (bug #754641)- perl(DBIx::Simple) is not needed in spec requirement in CPANPLUS. It's generated
  automatically.- Provide perl(DB) by perl- Do not warn about missing site directories (bug #732799)- cleaned spec (thanks to Grigory Batalov)
-  Module-Metadata sub-package contained perl_privlib instead of privlib
-  %files parent section was repeated twice- Filter false perl(DynaLoader) provide from perl-ExtUtils-MakeMaker
  (bug #736714)
- Change Perl_repeatcpy() prototype to allow repeat count above 2^31
  (bug #720610)
- Do not own site directories located in /usr/local (bug #732799)- Fix CVE-2011-3597 (code injection in Digest) (bug #743010)
- Sub-package Digest and thus Digest::MD5 module (bug #743247)- add provide for perl(:MODULE_COMPAT_5.14.2)- 5.14.2 bump (see
  https://metacpan.org/module/FLORA/perl-5.14.2/pod/perldelta.pod for release
  notes).
- Fixes panics when processing regular expression with \b class and /aa
  modifier (bug #731062)
- Fixes CVE-2011-2728 (File::Glob bsd_glob() crash with certain glob flags)
  (bug #742987)- Enable GDBM support again to build against new gdbm 1.9.1- Disable NDBM support temporarily too as it's provided by gdbm package- Disable GDBM suppor�x�������������8y�������X`�(
U
����������$;�������������������VR�?M�d��	��	�	F�<�@�\�`�j�t���	�����
�`x	�
�X	�

$
� ��8` � 2 (�)�*L+w,�-�8�f9Hf:)�f>A�?A�@A�BA�DA�GA�HBLIB�XB�YB�ZC[C\C]C�^D�bF&dGveG{fG~lG�tG�uHvHx
wK�xL8yL�(�MH�ML�MR�M�M�M�6O�O�6
R(RQ�R�R�R�gR�hR�Ccronie1.5.210.el8Cron daemon for executing programs at set timesCronie contains the standard UNIX daemon crond that runs specified programs at
scheduled times and related tools. It is a fork of the original vixie-cron and
has security and configuration enhancements like the ability to use pam and
SELinux.f4�x64-builder02.almalinux.org�AlmaLinuxAlmaLinuxMIT and BSD and ISC and GPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Basehttps://github.com/cronie-crond/cronielinuxx86_64# run after an installation

if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset crond.service &>/dev/null || : 
fi# run before a package is removed

if [ $1 -eq 0 ] ; then 
        # Package removal, not upgrade 
        systemctl --no-reload disable --now crond.service &>/dev/null || : 
fi# run after a package is removed

if [ $1 -ge 1 ] ; then 
        # Package upgrade, not uninstall 
        systemctl try-restart crond.service &>/dev/null || : 
fi�Bnd�8��'��TPV��
Wv�$A큤�����������A�A�A�A���A큤����A큤����������A�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�f4�Z�8�Z�:�X~>f4�X~>f4�f4�f4�f4�f4�f4�ad03f0fdb025e5b5a1c7f83cce837bb3ef8acfc8276efec6a17d39ec5a34756ee3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855b853e02adab40733e24f3b9757d9fb0078b734039ebdfdc085b322056529de1bf6e6c5ff94824545c9fee7e87857e49d4c4e966c6b5d8395190be08f7f2d2002a94151df6b78916177e5c3c3e7ad0c344f21aa5be2507c06229ae5152ff48a8d301b5bcfca6a3cfde00a4e2a2708892d01ab7639f087a8eca26a37d01d98b2b52233c23447eedafd1c66fc95a0c33467990d2b01fec89506593d9b4e092ab87614c800ab882d42af411df13631b059bbad9bc5f45b8fa23e63dbe129665bc46d422123b08e5afc5ef90bbbdfeff89223d60eef4e289a00f803a0e6f1907b26698802e2185f7200a078de5cf50a2f4149aad934a15c9071beb9fec331dd29aa869ff0e7602ba2ae0ddb16f10f417a4cde490598c25ce1cfb9e8d0dfb447fddb3d45898c8f5cbcdb95f215f48a99f2fbc311060c047541d1f954304d5d5cec8e2040628512ce3dfb19b729b4a4d4c4f68abc3f0b23f55f9ae0f87fc79774fc43227459fbfd3425ce7c97573909c6bca3967dd02165e2e69deebac21bada0c1a2fb57dbcb509e623211e4b77d76859b61a908734864d7173f09262b3cf6c3f6cfbce781e41fd8e89c8f0f37c4031722968b1346a2b3606f1b9be7ab7e1fa14f4c62c93e612e5d0ae66e118ef5698fd24b9a6f203c65c6cd48fa57bef42372f390f8../../../../usr/sbin/crond../../../../usr/bin/cronnext../../../../usr/bin/crontab��x��������������h�������Xa1�(
�p���$b��������������������c8b319d537e4926fc430f745cc23aa8cf1f7eeb93e1d39cbe36a083625065f96c04963ff9fa41634cb2d1073cddeb801ea69d1cb3bbadb61f8f0e5519794e9f745de4351edef34a952f6de998620963bbf5a3c0dc374ee055c047adb937320da21cd7550fe05981e2b5a70e88d1fd9ed209254f8f8d777e61253820b5e5d21089b12eb05fab22c6f36fa9e193b29948af0df43ceaf1ac493ab46db49407eca26889e55be695a30c6b1e9efbec8a7d30944bda7f2d9806f0978916769c49785231062469487be7ee1859ab2d6482bd941e3a2aa7f1f854800e11a55a6aa15cc9b6debabf7979b9131d6b72d2495f06e64b719e1c1c6a7c987205530da6dec092a5bfe708e3a846f2b78fab140c37a6c9d7c1e22aeb8f45cab80bc46dcfc8e4854e4efb77c300ae397cf9bcf4b2c99913fec598899a3a08cfc6c0028e652464a136aebf8f282fee18867d7af8d69691a4ea37a6627b60bd17631cc79052c22c044d74081a743a044aeb85929339f846c9df9334679fe2813b8ef1ba8cccb76991a66632f24631f31d12d6f5c87012006bd38976bbac7d22af81a1849c69f47791a1bca313f59e09f0a8b2a03e65da668cc2bc651e192f2938bb1c122f045e3ed35116daa671b87bca791285e1c391ca65144b00c828e063bc3d41adf0a997b20de9461fb9f69e97a227a667df613e1b720dbf9e6210ba774175a8ed1b1a4bcada9cb4cc81628d7a5ea610173bd95220d30c7526ddaf7fe6db963ebf72747b3d8788129eaaad85927c1ab2edf93e7d225915348878f1bed45e52e2f60604dd11e795fae53632d5a9bd52960fdc1012984792e9f5c3e20b0768aeee240a856450fe5456ee29e9252b81bd1e24ed3bc43915f0c41be5d7a2d05ef651d814b963dadfa8dff5f9210834c057e883dea3797339bba452c34e0a8da4ef706fdb95ca4783e5320e0f5e1d383d9652235883345da3888057d097f1589d97f98a6d73747a74a4225376e5ed193b57e8b438247035bd78cf89aaca7eff9af4d551f8ef87867bf1277058cab8c07fe78ba4bf3f1c38742964b338415fc2c342eccbeea849237649844995c77ac707600f8a6029a8ee6f71d8dea1d7f42cd127eccbeea849237649844995c77ac707600f8a6029a8ee6f71d8dea1d7f42cd127e42c305807fbf827e77c781de4c8f9d7e2eded13f70611eb97b995d2719c2901e42c305807fbf827e77c781de4c8f9d7e2eded13f70611eb97b995d2719c2901eb6e6fb1485237b68f3b25a993e89afc9c6ddd5a550c4898189b7842e5585f16a4935173968859c686938ae411bbb9156c48aae760bbdf64c4893241193bb25bd2d74038e05aebe980ffab0ec73bc91057d0176f986301574ce4d3229e2b2ceb5d5ef392d69da16b0c72bd700786cb0ab13b032d046ceb14f2bb93b683b3177f6a32051432a8c942cfab0593086989ef7579521f5a9e3374c4661c753167a5ba53f26d022266fa9367f3e24f53cfd755b4da9e3a46874c9c4dffe0ac30808ccb0d1114d3ca05eaaf071f14ea7f7171513989ee3d422a6f53974bb1c45100a104548a8801a9a22421f20ad21b8cc632606886209684fc74f9a8a2271e268b8ed156fb59f9600425774128dd0dda3e23a1dfec2281327bf22acc578b92e6a661e456fb59f9600425774128dd0dda3e23a1dfec2281327bf22acc578b92e6a661e4544535f43021874340863361cde4e665d24ac07c6240e732f4fd947048673437a44535f43021874340863361cde4e665d24ac07c6240e732f4fd947048673437add6504c25a5aee2eb6c88f10e94694358eeb4236d80ab7d6a3109459bb51613fdd6504c25a5aee2eb6c88f10e94694358eeb4236d80ab7d6a3109459bb51613f52bc48cdeda71da8660c65db0a34c298455bb827d16d760e2f4c5d208748995052bc48cdeda71da8660c65db0a34c298455bb827d16d760e2f4c5d2087489950420a0c3b2c73cc7bdd31ed48b7d8417f3105aef6f712ec40621fbd49051703f2420a0c3b2c73cc7bdd31ed48b7d8417f3105aef6f712ec40621fbd49051703f24c9e98a42b581136b136de203c7d5e2e715464e61f917999b5159270fb8fa9034c9e98a42b581136b136de203c7d5e2e715464e61f917999b5159270fb8fa90384208880ad8e12107ba0ad8b79ab3cbe0c14fd9c7dd4cd035745a2e7d008572084208880ad8e12107ba0ad8b79ab3cbe0c14fd9c7dd4cd035745a2e7d0085720f151633692db5f5c11bec0bb7ee01eb8069589a4866bf2baec387cf75c8c4b0ff151633692db5f5c11bec0bb7ee01eb8069589a4866bf2baec387cf75c8c4b0f590a48b197645534fa3fc7abc216222b2166bf6ae0ad691a363f7c894a2008ad590a48b197645534fa3fc7abc216222b2166bf6ae0ad691a363f7c894a2008ad25908facdaaccfee13532d42e74643b6e1d4deba182667c169e9c130ffe4161fc8ad697d6efa9bbb0e35f2b03b08de3feab4b17b70a56ae81e7f7e6891152cd8d8b7709ead1f6f75a904488a10dc22ad86d10481f5b336bb9ae89e7cd7972716694c6d623a94509f62cb2ec204010e5b54aebcb223feb7f854dcbec8b0599db2694c6d623a94509f62cb2ec204010e5b54aebcb223feb7f854dcbec8b0599db288b6b737e839e0d9eb790a8033ee9abb1fa3609a541b74fd0d60ec073b503ea288b6b737e839e0d9eb790a8033ee9abb1fa3609a541b74fd0d60ec073b503ea24e475bc65662416e54071f4b36dd72d5f720e68fc5ff194014eb86d95201d6ca4e475bc65662416e54071f4b36dd72d5f720e68fc5ff1940�x�������������(X�������Xb�(
���������g������:��$*����������������:�;�9��isar@redhat.com> - 4:5.22.0-352Petr Pisar <ppisar@redhat.com> - 4:5.22.0-351Petr Pisar <ppisar@redhat.com> - 4:5.22.0-350Petr Pisar <ppisar@redhat.com> - 4:5.22.0-349Petr Pisar <ppisar@redhat.com> - 4:5.22.0-348Petr Pisar <ppisar@redhat.com> - 4:5.22.0-347Petr Pisar <ppisar@redhat.com> - 4:5.22.0-346Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.22.0-345Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-244Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-242Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-328Petr Šabata <contyk@redhat.com> - 4:5.20.2-327Petr Šabata <contyk@redhat.com> - 4:5.20.2-326Petr Pisar <ppisar@redhat.com> - 4:5.20.2-325Lubomir Rintel <lkundrak@v3.sk> - 4:5.20.2-324Petr Pisar <ppisar@redhat.com> - 4:5.20.2-323Till Maas <opensource@till.name> - 4:5.20.2-322Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-321Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-320Petr Pisar <ppisar@redhat.com> - 4:5.20.1-319Petr Pisar <ppisar@redhat.com> - 4:5.20.1-318Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-317Petr Pisar <ppisar@redhat.com> - 4:5.20.1-316Petr Pisar <ppisar@redhat.com> - 4:5.20.1-315Petr Pisar <ppisar@redhat.com> - 4:5.20.1-314Petr Pisar <ppisar@redhat.com> - 4:5.20.1-313Petr Pisar <ppisar@redhat.com> - 4:5.20.1-312Petr Pisar <ppisar@redhat.com> - 4:5.20.1-311Petr Pisar <ppisar@redhat.com> - 4:5.20.1-310Petr Šabata <contyk@redhat.com> - 4:5.20.1-309Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-308Petr Pisar <ppisar@redhat.com> - 4:5.20.0-307Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-306Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-305Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-304Petr Pisar <ppisar@redhat.com> - 4:5.18.2-303Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-302Petr Pisar <ppisar@redhat.com> - 4:5.18.2-301Petr Pisar <ppisar@redhat.com> - 4:5.18.2-300Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-299Petr Pisar <ppisar@redhat.com> - 4:5.18.2-298Petr Pisar <ppisar@redhat.com> - 4:5.18.2-297Petr Pisar <ppisar@redhat.com> - 4:5.18.2-296Petr Pisar <ppisar@redhat.com> - 4:5.18.2-295Petr Pisar <ppisar@redhat.com> - 4:5.18.2-294Petr Pisar <ppisar@redhat.com> - 4:5.18.2-293Petr Pisar <ppisar@redhat.com> - 4:5.18.2-292Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-291Petr Pisar <ppisar@redhat.com> - 4:5.18.1-290Petr Pisar <ppisar@redhat.com> - 4:5.18.1-289Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-288Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-287Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.0-286Petr Pisar <ppisar@redhat.com> - 4:5.18.0-285Petr Pisar <ppisar@redhat.com> - 4:5.18.0-284Petr Pisar <ppisar@redhat.com> - 4:5.18.0-283Petr Pisar <ppisar@redhat.com> - 4:5.18.0-282Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.0-281Petr Pisar <ppisar@redhat.com> - 4:5.16.3-280Petr Pisar <ppisar@redhat.com> - 4:5.16.3-279Petr Pisar <ppisar@redhat.com> - 4:5.16.3-278Petr Pisar <ppisar@redhat.com> - 4:5.16.3-277Petr Pisar <ppisar@redhat.com> - 4:5.16.3-276Petr Pisar <ppisar@redhat.com> - 4:5.16.3-275Petr Pisar <ppisar@redhat.com> - 4:5.16.3-274Petr Pisar <ppisar@redhat.com> - 4:5.16.3-273Petr Pisar <ppisar@redhat.com> - 4:5.16.3-272Petr Pisar <ppisar@redhat.com> - 4:5.16.3-271Petr Pisar <ppisar@redhat.com> - 4:5.16.3-270Petr Pisar <ppisar@redhat.com> - 4:5.16.3-269Petr Pisar <ppisar@redhat.com> - 4:5.16.3-268Petr Pisar <ppisar@redhat.com> - 4:5.16.3-267Petr Pisar <ppisar@redhat.com> - 4:5.16.3-266Petr Pisar <ppisar@redhat.com> - 4:5.16.3-265Petr Pisar <ppisar@redhat.com> - 4:5.16.3-264Petr Pisar <ppisar@redhat.com> - 4:5.16.3-263Petr Pisar <ppisar@redhat.com> - 4:5.16.3-262Petr Pisar <ppisar@redhat.com> - 4:5.16.3-261Petr Pisar <ppisar@redhat.com> - 4:5.16.2-260Petr Pisar <ppisar@redhat.com> - 4:5.16.2-259Petr Pisar <ppisar@redhat.com> - 4:5.16.2-258Petr Pisa�x��������������G�������Xct�(
`�خrd�$b����������������rdsdqd�.3ssl.gzEVP_ENCODE_CTX_copy.3ssl.gzEVP_ENCODE_CTX_free.3ssl.gzEVP_ENCODE_CTX_new.3ssl.gzEVP_ENCODE_CTX_num.3ssl.gzEVP_EncodeBlock.3ssl.gzEVP_EncodeFinal.3ssl.gzEVP_EncodeInit.3ssl.gzEVP_EncodeUpdate.3ssl.gzEVP_EncryptFinal.3ssl.gzEVP_EncryptFinal_ex.3ssl.gzEVP_EncryptInit.3ssl.gzEVP_EncryptInit_ex.3ssl.gzEVP_EncryptUpdate.3ssl.gzEVP_KDF_CTX.3ssl.gzEVP_KDF_CTX_free.3ssl.gzEVP_KDF_CTX_new_id.3ssl.gzEVP_KDF_ctrl.3ssl.gzEVP_KDF_ctrl_str.3ssl.gzEVP_KDF_derive.3ssl.gzEVP_KDF_reset.3ssl.gzEVP_KDF_size.3ssl.gzEVP_KDF_vctrl.3ssl.gzEVP_MD_CTX_block_size.3ssl.gzEVP_MD_CTX_clear_flags.3ssl.gzEVP_MD_CTX_copy.3ssl.gzEVP_MD_CTX_copy_ex.3ssl.gzEVP_MD_CTX_ctrl.3ssl.gzEVP_MD_CTX_free.3ssl.gzEVP_MD_CTX_md.3ssl.gzEVP_MD_CTX_md_data.3ssl.gzEVP_MD_CTX_new.3ssl.gzEVP_MD_CTX_pkey_ctx.3ssl.gzEVP_MD_CTX_reset.3ssl.gzEVP_MD_CTX_set_flags.3ssl.gzEVP_MD_CTX_set_pkey_ctx.3ssl.gzEVP_MD_CTX_set_update_fn.3ssl.gzEVP_MD_CTX_size.3ssl.gzEVP_MD_CTX_test_flags.3ssl.gzEVP_MD_CTX_type.3ssl.gzEVP_MD_CTX_update_fn.3ssl.gzEVP_MD_block_size.3ssl.gzEVP_MD_flags.3ssl.gzEVP_MD_meth_dup.3ssl.gzEVP_MD_meth_free.3ssl.gzEVP_MD_meth_get_app_datasize.3ssl.gzEVP_MD_meth_get_cleanup.3ssl.gzEVP_MD_meth_get_copy.3ssl.gzEVP_MD_meth_get_ctrl.3ssl.gzEVP_MD_meth_get_final.3ssl.gzEVP_MD_meth_get_flags.3ssl.gzEVP_MD_meth_get_init.3ssl.gzEVP_MD_meth_get_input_blocksize.3ssl.gzEVP_MD_meth_get_result_size.3ssl.gzEVP_MD_meth_get_update.3ssl.gzEVP_MD_meth_new.3ssl.gzEVP_MD_meth_set_app_datasize.3ssl.gzEVP_MD_meth_set_cleanup.3ssl.gzEVP_MD_meth_set_copy.3ssl.gzEVP_MD_meth_set_ctrl.3ssl.gzEVP_MD_meth_set_final.3ssl.gzEVP_MD_meth_set_flags.3ssl.gzEVP_MD_meth_set_init.3ssl.gzEVP_MD_meth_set_input_blocksize.3ssl.gzEVP_MD_meth_set_result_size.3ssl.gzEVP_MD_meth_set_update.3ssl.gzEVP_MD_pkey_type.3ssl.gzEVP_MD_size.3ssl.gzEVP_MD_type.3ssl.gzEVP_OpenFinal.3ssl.gzEVP_OpenInit.3ssl.gzEVP_OpenUpdate.3ssl.gzEVP_PKEY_ASN1_METHOD.3ssl.gzEVP_PKEY_CTX_add1_hkdf_info.3ssl.gzEVP_PKEY_CTX_add1_tls1_prf_seed.3ssl.gzEVP_PKEY_CTX_ctrl.3ssl.gzEVP_PKEY_CTX_ctrl_str.3ssl.gzEVP_PKEY_CTX_ctrl_uint64.3ssl.gzEVP_PKEY_CTX_dup.3ssl.gzEVP_PKEY_CTX_free.3ssl.gzEVP_PKEY_CTX_get0_dh_kdf_oid.3ssl.gzEVP_PKEY_CTX_get0_dh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_get0_ecdh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_get0_rsa_oaep_label.3ssl.gzEVP_PKEY_CTX_get1_id.3ssl.gzEVP_PKEY_CTX_get1_id_len.3ssl.gzEVP_PKEY_CTX_get_app_data.3ssl.gzEVP_PKEY_CTX_get_cb.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_md.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_get_dh_kdf_type.3ssl.gzEVP_PKEY_CTX_get_ecdh_cofactor_mode.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_md.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_get_ecdh_kdf_type.3ssl.gzEVP_PKEY_CTX_get_keygen_info.3ssl.gzEVP_PKEY_CTX_get_rsa_mgf1_md.3ssl.gzEVP_PKEY_CTX_get_rsa_oaep_md.3ssl.gzEVP_PKEY_CTX_get_rsa_padding.3ssl.gzEVP_PKEY_CTX_get_rsa_pss_saltlen.3ssl.gzEVP_PKEY_CTX_get_signature_md.3ssl.gzEVP_PKEY_CTX_hkdf_mode.3ssl.gzEVP_PKEY_CTX_md.3ssl.gzEVP_PKEY_CTX_new.3ssl.gzEVP_PKEY_CTX_new_id.3ssl.gzEVP_PKEY_CTX_set0_dh_kdf_oid.3ssl.gzEVP_PKEY_CTX_set0_dh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_set0_ecdh_kdf_ukm.3ssl.gzEVP_PKEY_CTX_set0_rsa_oaep_label.3ssl.gzEVP_PKEY_CTX_set1_hkdf_key.3ssl.gzEVP_PKEY_CTX_set1_hkdf_salt.3ssl.gzEVP_PKEY_CTX_set1_id.3ssl.gzEVP_PKEY_CTX_set1_pbe_pass.3ssl.gzEVP_PKEY_CTX_set1_scrypt_salt.3ssl.gzEVP_PKEY_CTX_set1_tls1_prf_secret.3ssl.gzEVP_PKEY_CTX_set_app_data.3ssl.gzEVP_PKEY_CTX_set_cb.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_md.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_set_dh_kdf_type.3ssl.gzEVP_PKEY_CTX_set_dh_nid.3ssl.gzEVP_PKEY_CTX_set_dh_pad.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_generator.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_prime_len.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_subprime_len.3ssl.gzEVP_PKEY_CTX_set_dh_paramgen_type.3ssl.gzEVP_PKEY_CTX_set_dh_rfc5114.3ssl.gzEVP_PKEY_CTX_set_dhx_rfc5114.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_bits.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_md.3ssl.gzEVP_PKEY_CTX_set_dsa_paramgen_q_bits.3ssl.gzEVP_PKEY_CTX�x�������������7�������Xd��(
8��T������z!�$j����������������z!y!{!�Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-21Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-20Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-19Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-18Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-17Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-16Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-15Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-14Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-13Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-12Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-11Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-10Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-9Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-8Stepan Kasal <skasal@redhat.com> - 4:5.10.0-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 4:5.10.0-6Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-5Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-4Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-3Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-2Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-1Robin Norwood <rnorwood@redhat.com> - 4:5.10.0_RC2-0.1- Fix CVE-2025-40909 - Clone dirhandles without fchdir
- Fix test broken by update in zlib on s390x- Add definition of OPTIMIZE to .ph files, if optimizing is used
  (bug#2152012)- Fix a memory leak when compiling a regular expression with a non-word
  class (bug #2014981)- Fix _resolv return value in Net-Ping (bug #1973030)- Fix CVE-2020-10543 (bug #1839273)
- Fix CVE-2020-10878 (bug #1839276)
- Fix a file mode of a perl-example.stp example (bug #1913693)- Fix CVE-2020-12723 (bug #1839279)- Fix Time-Local tests to pass after year 2019 (bug #1807120)
- Run-require perl(Encode) by perl-libs (bug #1903503)- 5.26.3 bump (bug #1655526)
- Fix CVE-2018-18311 (integer overflow leading to buffer overflow) (bug #1654920)
- Fix CVE-2018-18312 (heap buffer overflow in regcomp.c) (bug #1654922)
- Fix CVE-2018-18313 (heap buffer overflow read in regcomp.c) (bug #1654924)
- Fix CVE-2018-18314 (heap based buffer overflow) (bug #1654925)- Install Encode developmental files when installing complete Perl
  (bug #1645225)- Fix annocheck failure by passing CFLAGS to dtrace (bug #1630617)- Adjust tests to gdbm-1.15 (RT#133295)
- Fix an integer wrap when allocating memory for an environment variable
  (RT#133204)
- Fix printing a warning about a wide character when matching a regular
  expression while ISO-8859-1 locale is in effect
- Fix invoking a check for wide characters while ISO-8859-1 locale is in effect- perl-devel requires redhat-rpm-config because of hardened compiler profiles
  (bug #1557667)
- Do not clobber file bytes in :encoding layer (RT#132833)
- Fix line numbers in multi-line s/// (RT#131930)
- Fix parsing extended bracketed character classes (RT#132167)
- Fix a possibly unitialized memory read in the Perl parser (RT#133074)
- Fix an infinite loop in the regular expression compiler (RT#133185)- Correct license tags of perl-libs (bug #1579524)- 5.26.2 bump
- Fix CVE-2018-6913 (heap buffer overflow in pp_pack.c) (bug #1567776)
- Fix CVE-2018-6798 (heap read overflow in regexec.c) (bug #1567777)
- Fix CVE-2018-6797 (heap write overflow in regcomp.c) (bug #1567778)- Rebuild to pick up new build flags from redhat-rpm-config- Escape macros in %changelog- Fix parsing braced subscript after parentheses (RT#8045)
- Fix a heap use after free when moving a stack (RT#131954)
- Call ldconfig scriptlets using a macro- Correct shell bangs in tests- Link XS modules to pthread library to fix linking with -z defs- Add patch to conditionalize a fix for an old and long fixed bug
  in libcrypt / glibc (rhbz#1536752)- Rebuild against glibc without nsl library- Remove invalid macro definitions from macros.perl (bug #1532539)
- Fix an overflow in the lexer when reading a new line (RT#131793)
- Fix Term::ReadLine not to create spurious &STDERR files (RT#132008)
- Fix a crash when a match for inversely repeated group fails (RT#13201�x��������������&�������Xe��(
ؐ�������H������m!�$}����������������m!l!n!�96fbd050e039b619778522e7e2935f848a63827a46eaa813dd5942eeb5e9feb6d8f5dd19e81335e95ee3a67e4426a3d8723d3aedebd072fff1c452c9387323c967f3fd297a013ebba9924ea103783fe02cc5772e0ff9b956a28b29a553fff10596082cb8fbb7d1ac9f6a3c062f249ae342dcc4534871b337866e8ad7e590b6744e0f63bdc24d9d6f68125237b07d5fb73f25504ed99a01984e76cf0fcb60295a723cc78ff50046bcdc7a6f930d332605875abfd97f2443dc774087747b82c4d5e3aa8613da5ad6a5bfed1cf795c40725c7d3994376bca13c8b6133bb1d02cfba3b6f05e04755359bac67a9b69a2f446050e6532dbf46e66a6f495d40f6ceace85305004abe28f3780a208b1ed63b5abe34d9431f0a5b1bf45c0d88da79a577088e02f6f5cfe2ed7a487f59f42740153c67c01aec4e1dc3f6c697619b23975c2e7e1f70b38b4eef8f57a419f390401cc27d52fc3cb9b3ba932bdc85413dae62f15a994123a40af569153bc8f91a9faa73e7d92a305923e331663fe2a1b52af6330518afbc1314ca0e02e89d254f2476d3a97a8e2c7ca03fae182272c1e3e985b8209eb89e0828b6092ed86f2cacaa9daffb5cca38ac2dd8d474e2750e69491b775fb8ecd30ce0a96c09691823a398e9a80e55fc9e5d37aaac2ffb13bf4d01f09c675a62aa929025f4110809843166b23c086ca532e8682e4fd97d102ec9f395bff3fbdaf10af56cce78cd1a879f91c47e8e9ce4812d02495583a4b26558d839c85a83c73d01b3434f38b6977cbb15581c958e001e2e06f7350744c736cbea359f5cbb7ef8f26173c20f8da196156382cc70790f09c4913c378ae132d1268b931b67a87cbbaf52de42a356f6b9a254fb729d35047560455d3acd3eb64f979f593493a7118a26abd1ba24566b7369a0f9355fd1afb94323545fe926b6faf5cd8e0a69933c9f13b7a14bfb2e04fd7e528dce7336d82322b63dfc1c728dd95eca18e5734338481011bf06de4b53f76adf13c829e5bc06b66f7712cf634995aaad6a2fcc9681d595464158afff84e426acd87cdd122980e5678d409185b31f7771abf48f674630321ce662576637f1a01f182c3de883e6864f24408b3b8d2cf6c193a1c95a18a449cbb127d711a7ba36fb99cc7b9220cd6ebb1ce0b56955de9f767567e6fa18f9fe3ab7fc4bb6310f22bd0d6d694548a8edfa55532dc16dbc068cf2516b205b41989a9f4931d260e6fe81a89536e9239682453df308dd11dfac163ecb067c369cb7c9f9e36d46f69c7011246752b731c6c98229cd2916a1b73dd80222bfdebc9a3994d243264a77415cb6e467be2a0a316e41f391af600339b95c4462895514465c118ae4942dcf3625deafd1fff1c031c133aab9b976427bab0ca7458e5bfa07cd0703cdb36f95432e93c0d3e7a15c6e8d13ce5eae59bc69412262c54c84edaa35f0ca67a75870fd1b924edb6a9f1c855aef117880ce9e0d91951d04c14808f25570e35a8d8c4b11cc130a3355663ac64021b88e88b890b436167ecc8c293341bb9818412ae71c9ba187dd8ab020c666e0af83a8d4b4c6c16383d4161c1227502d0362c2755ab5d41f8ea0a5f60ec910d31ea23e2a62429dd5789bb6e546b9c607e0ed4758ebe8a3690e6ef376ad01c39a162621f387c309b2d602a50ba9103befaba1a417359e201162b235b3776874a174457c61068d14def0ae76aadbe8eeac3fede9007ba064091e383ed2d6d77ddef88354bf5adfcceddf56775f947359f75883d0c3eb9fb5dd74d121434a44e54bbd0b950506f07503da95c0596a799c06b015c17428a4b34a26d713b8717dbe359d24d75d5da4261f03f29abccf84929a27a15998546f631f2073e6feb5c9e5c89fafd0cc9693cf9b785eba62c7183d6ec969d8c49a2cf74d1582ff59dfd2c65a64b258f29c6b8f2286590851408ea4a3c487474e3f9a1a3d59b4c9c332e881f65b2e80440d89ded2def88d3cb65d8064546d34a5d2d91fe4569ef19caab8318a4091f95a7583f606e6a1d6d69f1aa0f24a08476d9712c30312001bf534ebc95182f04844e4af8465779e29462421e26cae2fc7f3fde2dea489265f0835a31338173e92f923e86bb79e4da952194c8fd26cee77c99cad7b9a090c53c03dd05ee9b7b1aab083ed256932a4d72861edc0c733aa10b4f0a841b7b7ddb0c8b07cbdfb362d25d4ea2231f242a609b6f087b96d78b6aa635faabaa2feb3959fe1f5dbf24d1d7685ef579b40451dc009e5bc4094458eaf533bcd677d0f2a7ea6cfc804c415bdf6705e9170f3db5b3bf5cb14e081f12a2ff3f7a9152d140d28b0341c0b29b3fc773a0a446bf4935f85e237bc97fc7fd32bb88e4e4bcdcd8f666ae2e4e5027c2b48d88bb5b93cf20649a760d1290eb6299e3f5c40c3b5efcf37a835849e49c3d4c279bcef074580ebdb8e1473ef0df1d35d24e0ac444cfb15c71a9ae86b95e9b0ab2cf71368b9b39cde5a31404917da5506cf02fb112379980a487d95456c9833c1f0c85d484b88bc281e263e6d9ff43ebb784ecd9967adb94273429547c1320e24b98e2394dccd1264e3a72ca002971c56f41e1bdb27fae88c9ff26e6912a1a6d6693a524e97d9f10f2d4dd81021189e52de24dc3e10db32581bf1befbb19afc61baa1a08ac822082029b8f3c5e144a489f6e7da6db4ab61e1e5de9d850c22868f2c504a859b80906f8eec14d75b22fa697dcef30ae913597baee9da4afcf0975548093f94c9edb7efe38100f38adc297e5b97912215fa3be904680687d0af9cecd02c48336a025f573edfb1aa2fa2dd2a38dd06df3ee4�x�����؂��������������X��(
؂������������g�$w����������������gfh� use system-auth- eek, where did login go? (specfile tweaks)- 2.10k
- fix compilation with current glibc- 2.10h- rebuild for sparc baud rates > 38400.- use snprintf - not sprintf - when doing
  sprintf ("%s\n", _("Some string")) to avoid overflows and
  segfaults.- raw control file was /dev/raw, now /dev/rawctl.
- raw access files were /dev/raw*, now /dev/raw/raw*.- -v argument to mkswap wasn't working- Recognize 0xfd on Sun disklabels as RAID- more lives in /bin, and was linked against /usr/lib/libnurses. Bad.- update to 2.10f
- fix issues in the new realpath code, avoid leaking memory- rebuild to fix dependencies
- add NFSv3 patches- don't require csh- update to 2.10e
- add rename- strip newlines in logger input.- rebuild with correct ncurses libs.- updated to util-linux 2.10c
- deprecated IMAP login mail notification patch17
- deprecated raw patch22
- depricated readprofile patch24- add patch for readprofile- tunelp should come from util-linux- kbdrate cannot use /dev/port on sparc.- fix kbdrate on sparc.- ship hwclock on alpha.- don't ship symlinks to rdev if we don't ship rdev.- add rawIO support from sct- don't display "new mail" message when the only piece of mail is from IMAP- kbdrate is now a console program- hostid is now in sh-utils. On sparc, install hostid as sunhostid (#4581).
- update to 2.9w:
-  Updated mount.8 (Yann Droneaud)
-  Improved makefiles
-  Fixed flaw in fdisk- tsort is now in textutils.- turn off setuid bit on login. Again. :(- hostid script for sparc (#3803).- added locale message catalogs to %file
- added patch for non-root build
- vigr.8 and /usr/lib/getopt  man-page was missing from file list
- /etc/fdprm really is a config file- update to 2.9v:
- cfdisk no longer believes the kernel's HDGETGEO
	(and may be able to partition a 2 TB disk)- update to 2.9u:
- Czech more.help and messages (Jiri Pavlovsky)
- Japanese messages (Daisuke Yamashita)
- fdisk fix (Klaus G. Wagner)
- mount fix (Hirokazu Takahashi)
- agetty: enable hardware flow control (Thorsten Kranzkowski)
- minor cfdisk improvements
- fdisk no longer accepts a default device
- Makefile fix- update to 2.9t:
- national language support for hwclock
- Japanese messages (both by Daisuke Yamashita)
- German messages and some misc i18n fixes (Elrond)
- Czech messages (Jiri Pavlovsky)
- wall fixed for /dev/pts/xx ttys
- make last and wall use getutent() (Sascha Schumann)
	[Maybe this is bad: last reading all of wtmp may be too slow.
	Revert in case people complain.]
- documented UUID= and LABEL= in fstab.5
- added some partition types
- swapon: warn only if verbose- update to 2.9s.- fix mkswap sets incorrect bits on sparc64 (#3140).- on sparc64 random ioctls on clock interface cause kernel messages.- improved raid patch (H.J. Lu).- added patch for smartraid controllers- fix logging problems caused by setproctitle and PAM interaction
  (#2045)- include docs and examples for sfdisk (#1164)- rtc is not working properly on alpha, we can't use hwclock yet.- add patch to make mkswap more 64 bit friendly... Patch from
  eranian@hpl.hp.com (ahem!)- include sfdisk (#1164)
- fix write (#1784)
- use positive logic in spec file (ifarch rather than ifnarch).
- (re)-use 1st matching utmp slot if search by mypid not found.
- update to 2.9o
- lastb wants bad logins in wtmp clone /var/run/btmp (#884)- if hwclock is to be compiled on sparc,
  it must actually work. Also, it should obsolete
  clock, otherwise it clashes.
- limit the swap size in mkswap for 2.2.1+ kernels
  by the actual maximum size kernel can handle.
- fix kbdrate on sparc, patch by J. S. Connell
  <ankh@canuck.gen.nz>- added pam_console back into pam.d/login- updated to 2.9i
- added hwclock for sparcs and alpha- added vigr to file list- auto rebuild in the new build environment (release 12)- remove most of the ifnarch arm stuff- added pam_console.so to /etc/pam.d/login- .perms patch to login to make it retain root in parent process
  for pam_close_session to work correctly- strip fdisk in buildroot correctly (#71�x���������������������Xg2�(
H�`j��������$c��������������������14eb86d95201d6ca6935e3dc439ce377e3a4e6d42ee543c636764aa3805c998e82a3bea8665009a36935e3dc439ce377e3a4e6d42ee543c636764aa3805c998e82a3bea8665009a3dd44f38e6114ce0db3f438f75f27c600040cac4e6cec2723c6fe3eef44da96c3dd44f38e6114ce0db3f438f75f27c600040cac4e6cec2723c6fe3eef44da96c39642ce60c8b3638fb484d45f3bc8a7502ebb17ef080448b5e2b4dbae5e5136579642ce60c8b3638fb484d45f3bc8a7502ebb17ef080448b5e2b4dbae5e51365745196459ca215a02b16febfcaaa4c5d3a9ce7ce6d4b7fc4f208369615c1dd07645196459ca215a02b16febfcaaa4c5d3a9ce7ce6d4b7fc4f208369615c1dd0761d31773bb6c82dc085d99b548171f98e183be58a426fe2681e9adfde7db4b97a1d31773bb6c82dc085d99b548171f98e183be58a426fe2681e9adfde7db4b97a9def2584687afd61f2dc9f24345b7f35ac12c29b6583c01a78d05368059f462c9def2584687afd61f2dc9f24345b7f35ac12c29b6583c01a78d05368059f462c3ea4a4fb2e14ada35acc6365e71826c87c649f95e185d1a56eea73e7808450e63ea4a4fb2e14ada35acc6365e71826c87c649f95e185d1a56eea73e7808450e6c39188958a641bc9e804e97f11a0a643c48ae2d0338f8557d5710a180c691ceac39188958a641bc9e804e97f11a0a643c48ae2d0338f8557d5710a180c691ceabf6396de889ed4796afe21d7c5553f5d2140f08e5cbfc551908f48f5dd979f73bf6396de889ed4796afe21d7c5553f5d2140f08e5cbfc551908f48f5dd979f7386e67351dfda175406a11539b80436a65bc88e898f1ddc7ea70dc5140e7aedab86e67351dfda175406a11539b80436a65bc88e898f1ddc7ea70dc5140e7aedab81cfcc9b6807a724b902744e3087a50d8bacf8458aa99ed371abc99c22751a5681cfcc9b6807a724b902744e3087a50d8bacf8458aa99ed371abc99c22751a56df2df39774b1fbc68388657db5a36868889ef8ebe4281ea0edbf4a42992dd69fdf2df39774b1fbc68388657db5a36868889ef8ebe4281ea0edbf4a42992dd69f4394adfe44a00047787469591b1a9c0c2fe93c78a8f6fc5ebcaecd0ce69f760f4394adfe44a00047787469591b1a9c0c2fe93c78a8f6fc5ebcaecd0ce69f760f650a97b7d4ddc79884a434773de8a9a10096be8ca36c6ac838ca636f7ad94a5a650a97b7d4ddc79884a434773de8a9a10096be8ca36c6ac838ca636f7ad94a5a056d3b30470701b3b421e1083ecda9a8de85e90cea51729dc176bf3669932266056d3b30470701b3b421e1083ecda9a8de85e90cea51729dc176bf3669932266b0d4980f3187254cdfd6d10b72331f5fde3b0c31c133c6f0edff6fcd9ce45bf3b0d4980f3187254cdfd6d10b72331f5fde3b0c31c133c6f0edff6fcd9ce45bf3bb4356d948639bc7661073554a473a7d14594d0906cb41d570f4371f65134e55bb4356d948639bc7661073554a473a7d14594d0906cb41d570f4371f65134e552c62a9ce222ad6a9448a04f8dcc15f435f1750f64ff9f82859bc298126bf91a72c62a9ce222ad6a9448a04f8dcc15f435f1750f64ff9f82859bc298126bf91a71822bd92370719b8fbc06431c1eea43a70acc1c579e32a42d52ac728ce6f466f1822bd92370719b8fbc06431c1eea43a70acc1c579e32a42d52ac728ce6f466f8d7cfca08cc7d514b05da74290fbcb8c7d12bcae09023d4de31ee4a6ba5b68808d7cfca08cc7d514b05da74290fbcb8c7d12bcae09023d4de31ee4a6ba5b688015d7f8dea78eb4e1620b8c7cc30bdc8ba774f35c33657f2ea1a3edd43f32701b3ec77bd2a6280996e50fc457398baf03ce275935b8473a7350501dd3f4ff80337f4b3e3b3ce6484b638d8d382a53a6582f67c14786ebe2e1a720f9810f771305af14071bb5a858592d5a4e6141cca5747894cef11fa1769ffd6b31f93e1b810d0c0e164648503d58388c25f917dafd0dc65ce754fcc2166785f02f8e4a3c48bd5752bb1f7f3094fa9f4ee879646cc66818d948044b66881e3d6677b6da43f02f7fc9922bab6fb1bc2bfdbb2cb5eddc7bde86c4bb0289f9fbeec50d93f59076e253d6bb381514704a9c072804b175fd78b9b082bc3d436678dba6955a6e3496f40e8810fbaa2d8e8e14c52653d1bedc55124a24ce61916f85b60bb7e641d646d3fb4854edb226e45ad4c81cd8f4b606a0c504b91575f5d6d4e6408ccbcc16de87ea017baba502c916dc90ffdaf7250d27b46910e1901b6b89d19b472bb014da47d3f412a5ff5695263ce7466e27963caa181cd4ddebf522473461767b12237e0ca8ed0447b3115caa62065d542c5b6db6d3108e89ac1f25b3b71575355a76ed8382d1a1cccaf786b866ebb313df0353c077c0e2382ee7aabcb91030e51e68c4ac50603f34de8f78a209112b62dfa69131726c605a55a0ca8ea912a94daaadab2dc71a14ab100bfc1dd68298dcee8d5336ae8fd2dd8736445ac98c1484f2b2b31e79af32754a82032372c9fd3e228ef15fc16d76b85dea80309b62660b9a951cf746392d72d7c2f325423e7744d1eaa389aba1957a1b841d37dc829540186b44fa8c424f232a97954fe8d1a806ea4d92c72ccc8cc66322eba36121f705bb9447dfebc77d79f556b6aaa458be7bef8a3952678906c92c5b8c7e73824c0eb5f17035e954e69b40465392339fdf94eb68c04752c94f1eaad862108aa0337b6c6741d51676acdeadbdc955f01d68f7aeadf1ae6e331e4a866cddb55f60a4eb8f35b09f7b9cb3a243a7242bb7488fc�x�������������������Xh%�(
��������0�������$����������������a	�����`@уqэh^'U�x�������������p������Xi=�(
��������P����$n�����������������������m verify subcommand
    resolves: rhbz#1212836
  - do not install tuned kernel command line to rescue kernels
    resolves: rhbz#1223864
  - add variables support
    resolves: rhbz#1225124
  - add built-in support for unit conversion into tuned
    resolves: rhbz#1225135
  - fix vm.max_map_count setting in sap-netweaver profile
    resolves: rhbz#1228562
  - add tuned profile for RHEL-RT
    resolves: rhbz#1228801
  - plugin_scheduler: added support for runtime tuning of processes
    resolves: rhbz#1148546
  - add support for changing elevators on xvd* devices (Amazon EC2)
    resolves: rhbz#1170152
  - add workaround to be run after systemd-sysctl
    resolves: rhbz#1189263
  - do not change settings of transparent hugepages if set in kernel cmdline
    resolves: rhbz#1189868
  - add tuned profiles for RHEL-NFV
    resolves: rhbz#1228803
  - plugin_bootloader: apply $tuned_params to existing kernels
    resolves: rhbz#1233004- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- fixed configobj class imports
  resolves: rhbz#1217327- fixed bash completion
  resolves: rhbz#1207668- fixed KeyError exception in powertop2tuned- remove 00_tuned grub2 template upon tuned uninstall
  resolves: rhbz#1178310- new-release
  - fixed return code of tuned grub template
    resolves: rhbz#1151768
  - plugin_bootloader: fix for multiple parameters on command line
    related: rhbz#1148711
  - tuned-adm: fixed traceback on "tuned-adm list"
    resolves: rhbz#1149162
  - plugin_bootloader is automatically disabled if grub2 is not found
    resolves: rhbz#1150047
  - plugin_disk: set_spindown and set_APM made independent
    resolves: rhbz#976725- new-release
  resolves: rhbz#1093883
  - fixed traceback if profile cannot be loaded
    related: rhbz#953128
  - powertop2tuned: fixed traceback if rewriting file instead of dir
    resolves: rhbz#963441
  - throughput-performance: altered dirty ratios for better performance
    resolves: rhbz#1043533
  - latency-performance: leaving THP on its default
    resolves: rhbz#1064510
  - used throughput-performance profile on server by default
    resolves: rhbz#1063481
  - network-latency: added new profile
    resolves: rhbz#1052418
  - network-throughput: added new profile
    resolves: rhbz#1052421
  - recommend.conf: fixed config file
    resolves: rhbz#1069123
  - systemd: added cpupower.service conflict
    resolves: rhbz#1073392
  - balanced: used medium_power ALPM policy
  - added support for >, < assignment modifiers in tuned.conf
  - handled root block devices
  - balanced: used conservative CPU governor
    resolves: rhbz#1124125
  - plugins: added selinux plugin
  - plugin_net: added nf_conntrack_hashsize parameter
  - profiles: added atomic-host profile
    resolves: rhbz#1091977
  - profiles: added atomic-guest profile
    resolves: rhbz#1091979
  - moved profile autodetection from post install script to tuned daemon
    resolves: rhbz#1144067
  - profiles: included sap-hana and sap-hana-vmware profiles
  - man: structured profiles manual pages according to sub-packages
  - added missing hdparm dependency
    resolves: rhbz#1144858
  - improved error handling of switch_profile
    resolves: rhbz#1068699
  - tuned-adm: active: detect whether tuned deamon is running
    related: rhbz#1068699
  - removed active_profile from RPM verification
    resolves: rhbz#1104126
  - plugin_disk: readahead value can be now specified in sectors
    resolves: rhbz#1127127
  - plugins: added bootloader plugin
    resolves: rhbz#1044111
  - plugin_disk: added error counter to hdparm calls
  - plugins: added scheduler plugin
    resolves: rhbz#1100826
  - added tuned-gui- added kernel-tools requirement
  resolves: rhbz#1072981- fixed race condition in the start/stop code
  resolves: rhbz#1028119
- improved tuned responsiveness
  resolves: rhbz#1028122- new-release
  resolves: rhbz#1020743
  - audio plugin: fixed audio settings in standard profiles
    resolves: rhbz#1019805
  - video plugin: fixed tunings
  - daemon: fixed crash if preset profile is not�x���������������������Xj�(
�B�������$>��������������������es: RHEL-2609- Set 'missingok' for /etc/cron.deny to not recreate it on update- Add support for "~" ("random within range") 
  Resolves: rhbz#1832510- Use system-auth for PAM authentication
  Resolves: rhbz#2005526- Create PID files even when crond does not fork
  Resolves: rhbz#1926300- Make crond restart on failure
- Resolves: rhbz#1715137- use role from the current context for system crontabs
- Resolves: rhbz#1708557- Covscan issues review
- Fix potential memory leaks
- Fix unsafe code
- Resolves: rhbz#1602467- new upstream release 1.5.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- fix Y2038 problems in cron and anacron (#1445136)- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- make failure of creation of the ghost files in /var non-fatal- on some machines the power supply is named ADP0- query power status directly from kernel- new upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- the temp file name used by crontab needs to be ignored by crond- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- new upstream release- mark the 0hourly and dailyjobs crontabs as config
- do not add already existing orphan on reload- correct the permissions of the anacron timestamp files- check for NULL pamh on two more places (#1176215)- call PAM only for non-root user or non-system crontabs (#956157)
- bypass the PAM check in crontab for root (#1169175)- refresh user entries when jobs are run- new release 1.4.12
- remove gpl2 license, because it's part of upstream COPYING now- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- unwanted fd could make trouble to SElinux 1075106- Drop INSTALL from docs, fix rpmlint tabs vs spaces warning.- some jobs are not executed because not all environment variables are set 995590
- cronie's systemd script use "KillMode=process" 919290- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- scriptlets are not created correctly if systemd is not in BR 986698
- remove sub-package sysvinit, which is not needed anymore
- update license, anacron is under GPLv2+- new release 1.4.11 (contains previous bug fixes from 1.4.10-5)- add support for RANDOM_DELAY - delaying job startups
- pass some environment variables to processes (LANG, etc.) (#969761)
- do not use putenv() with string literals (#971516)- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- change configuration files to 644
- change 6755 to 4755 for crontab binary- New release 1.4.10- New release 1.4.9- Scriptlets replaced with new systemd macros (#850070)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for glibc bug#747377- make crond run a little bit later in the boot process (#747759)- change triggerun to fix 735802 during upgrade- rebuild again, ppc still had the broken rpm in the buildroots- rebuild (broken rpm in buildroot)- fix permission of init.d/crond- drop the without systemd build condition
- add the chkconfig readding trigger to the sysvinit subpackage- start crond after auditd- fix inotify support to not leak fds (#717505)- update to 1.4.8
- create sub-package sysvinit for initscript- missing requirement on systemd-sysv for scriptlets- use only systemd units with systemd
- add trigger for restart on glibc, libselinux or pam upgrades (#699189)- new release 1.4.7- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- enable crond even with systemctl- 663193 rewritten selinux support- apply selinux patch from dwalsh- do not lock jobs that fall out of allowed range - 661966- fix post (thanks plautrba for review)- systemd init script 617320- fix typos in man pages- update to 1.4.�x�������������`�������Xk�(
��������H>������x��$h����������������x�w�y��ordering to fix a comps merging issue (RhBug:1928181)
- Keep reason when package is removed (RhBug:1921063)
- Improve mechanism for application of security filters (RhBug:1918475)
- [API] Add new method for reset of security filters
- Remove hardcoded logfile permissions (RhBug:1910084)
- Preserve file mode during log rotation (RhBug:1910084)
- Increase loglevel in case of invalid config options
- Prevent traceback (catch ValueError) if pkg is from cmdline
- Check for specific key string when verifing signatures (RhBug:1915990)
- Use rpmkeys binary to verify package signature (RhBug:1915990)
- [doc] Improve description of modular filtering
- [doc] deprecated alias for dnf repoquery --deplist <deplist_option-label>
- [doc] Describe install with just a name and obsoletes (RhBug:1902279)
- [doc] Fix: "sslcacert" contains path to the file
- [doc] Added proxy ssl configuration options, increase libdnf require
- [doc] Update documentation for module_obsoletes and module_stream_switch
- [doc] Improve documentation for Hotfix repositories
- [doc] fix: "makecache" command downloads only enabled repositories
- [doc] Add info that maximum parallel downloads is 20
- [doc] installonly_limit documentation follows behavior
- [doc] Add documentation for config option sslverifystatus (RhBug:1814383)
- The noroot plugin no longer exists, remove mention- Allow stream switching if option enabled- Set persistdir for fill_sack_from_repos_in_cache tests (RhBug:1865803)- Add api function: fill_sack_from_repos_in_cache (RhBug:1865803)
- Add tests and docs for fill_sack_from_repos_in_cache (RhBug:1865803)
- Run tests for fill_sack_from_repos_in_cache in installroot- Make log rotated permissions match initial log permissions (RhBug:1894344)
- Add new attribute for Package - from_repo
- Change behaviour of Package().from_repo
- Package: add a get_header() method- yum.misc.decompress() to handle uncompressed files (RhBug:1895059)
- Module switch command- Fix patch for dnf history operations- `dnf history` operations that work with comps correctly
- Remove sourcepackages from install/upgrade set
- Fix documentation of globs not supporting curly brackets- Backport patches
- Log scriptlets output also for API users (RhBug:1847340)
- Post transaction summary is logged for API users (RhBug:1855158)- Backport patch Revert "Fix --setopt=cachedir writing outside of installroot"- Update to 4.4.2
- spec: Fix building with new cmake macros (backport from downstream)
- Warn about key retrieval over http:
- Fix --setopt=cachedir writing outside of installroot
- Add vendor to dnf API (RhBug:1876561)
- Add allow_vendor_change option (RhBug:1788371) (RhBug:1788371)- Update translations- Add logfilelevel configuration (RhBug:1802074)
- [doc] Enhance repo variables documentation (RhBug:1848161,1848615)- Handle empty comps group name (RhBug:1826198)- Update to 4.2.23
- Fix behavior of `install-n` command
- Fix behavior of `localinstall` command
- Fix behavior of `autoremove-n` command
- Fix behavior of `remove-n` command
- Fix behavior of `repoquery-n` command
- Fix behavior of `list-updateinfo` and related aliases
- Refactor code in `repoinfo` to use opts.command correctly.
- Add myself to list of contributors
- Add updated to verbose output of updateinfo list (RhBug: 1801092)
- Fix a couple of missed grammatical errors in updateinfo docs.
- Add comment option (RhBug:1773679)
- Better wording of dnssec email parsing error.
- Print nicer DnssecErrors (RhBug:1813244)
- Add new API for handling gpg signatures (RhBug:1339617)
- Verify GPG signatures (RhBug:1793298)
- Fix a syntax typo
- Fix up Conflicts: on python-dnf-plugins-extras so it actually works
- [doc] Move yum-plugin-post-transaction-actions to dnf-plugins-core
- Remove args "--set-enabled", "--set-disabled" from DNF (RhBug:1727882)
-  Search command is now alphabetical (RhBug:1811802)
- Fix downloading packages with full URL as their location
- repo: catch libdnf.error.Error in addition to RuntimeError in load() (RhBug:1788182)
- History tbl to max size when redirect to �x�������������ز�������Xl;�(
Ћ���������������$l����������������������� other plugins do
  - oracle: fixed ip_local_port_range parity warning
    resolves: rhbz#1527219
  - Fix verifying cpumask on systems with more than 32 cores
    resolves: rhbz#1528368
  - oracle: updated the profile to be in sync with KCS 39188
    resolves: rhbz#1447323- Fixed python3-gobject-base requirement- Bumped release to fix conflict caused by automerge- New version
- Dropped plugin-disk-traceback-fix patch (upstreamed)- Dropped qemu-kvm-tools-rhev requirement, now satisfied by
  tuned-profiles-nfv-host-bin
  Related: rhbz#1504681- kernel-tools made weak dependency- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- fixed traceback in disk plugin if dynamic tuning is enabled- qemu-kvm-tools-rhev made weak dependency- new release
  - rebase tuned to latest upstream
    resolves: rhbz#1388454
  - cpu-partitioning: enabled timer migration
    resolves: rhbz#1408308
  - cpu-partitioning: disabled kvmclock sync and ple
    resolves: rhbz#1395855
  - spec: muted error if there is no selinux support
    resolves: rhbz#1404214
  - units: implemented instance priority
    resolves: rhbz#1246172
  - bootloader: added support for initrd overlays
    resolves: rhbz#1414098
  - cpu-partitioning: set CPUAffinity early in initrd image
    resolves: rhbz#1394965
  - cpu-partitioning: set workqueue affinity early
    resolves: rhbz#1395899
  - scsi_host: fixed probing of ALPM, missing ALPM logged as info
    resolves: rhbz#1416712
  - added new profile cpu-partitioning
    resolves: rhbz#1359956
  - bootloader: improved inheritance
    resolves: rhbz#1274464
  - units: mplemented udev-based regexp device matching
    resolves: rhbz#1251240
  - units: introduced pre_script, post_script
    resolves: rhbz#1246176
  - realtime-virtual-host: accommodate new ktimersoftd thread
    resolves: rhbz#1332563
  - defirqaffinity: fixed traceback due to syntax error
    resolves: rhbz#1369791
  - variables: support inheritance of variables
    resolves: rhbz#1433496
  - scheduler: added support for cores isolation
    resolves: rhbz#1403309
  - tuned-profiles-nfv splitted to host/guest and dropped unneeded dependency
    resolves: rhbz#1413111
  - desktop: fixed typo in profile summary
    resolves: rhbz#1421238
  - with systemd don't do full rollback on shutdown / reboot
    resolves: rhbz#1421286
  - builtin functions: added virt_check function and support to include
    resolves: rhbz#1426654
  - cpulist_present: explicitly sorted present CPUs
    resolves: rhbz#1432240
  - plugin_scheduler: fixed initialization
    resolves: rhbz#1433496
  - log errors when applying a profile fails
    resolves: rhbz#1434360
  - systemd: added support for older systemd CPUAffinity syntax
    resolves: rhbz#1441791
  - scheduler: added workarounds for low level exceptions from
    python-linux-procfs
    resolves: rhbz#1441792
  - bootloader: workaround for adding tuned_initrd to new kernels on restart
    resolves: rhbz#1441797- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Fixed traceback when non-existent profile is queried through
  tuned-adm profile_info
  Resolves: rhbz#1385145- Fixed pkexec
  Resolves: rhbz#1377896- New release
  Resolves: rhbz#1362481
- Dropped tuned-gui-traceback-fix and tuned-adm-list-no-dbus-traceback-fix
  patches (both upstreamed)- Fixed tuned-gui traceback (by tuned-gui-traceback-fix patch)
  Resolves: rhbz#1358846
- Fixed 'tuned-adm list' traceback if daemon is not running
  (by tuned-adm-list-no-dbus-traceback-fix patch)- new-release
  - gui: fixed save profile
    resolves: rhbz#1242491
  - tuned-adm: added --ignore-missing parameter
    resolves: rhbz#1243807
  - plugin_vm: added transparent_hugepage alias
    resolves: rhbz#1249610
  - plugins: added modules plugin
    resolves: rhbz#1249618
  - plugin_cpu: do not show error if cpupower or x86_energy_perf_policy are
    missing
    resolves: rhbz#1254417
  - tuned-adm: fixed restart attempt if tuned is not running
    resolves: rhbz#1258755
  - nfv: avoided race condition by using synchronous�x�������������P��������Xm�(
0��Y������dX�$t����������������dXcXeX�	


ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=347d9c125ed18fd9bd011e4eb08fd906bbabc7f5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ae7e2784ab0ed6ceab9cd814959316751f043647, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3f996c930d2f96d497a06b94ff3c5e75d372d7a1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e6b8b29beb9a9cc689a1ca6ee006401056c9982, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=72fde2aa98926b7bf93f63e747af9666d4dee9c8, strippeddirectoryPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ee08bf55f4e16f0a193078635793a073d975af04, strippedBourne-Again shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6e359d2b9f27e4085fe8dd88866d17572f4b4544, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=344352788b234c87a220c8f2ee19e03ff36c8834, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e02ff9762ff3506eaed795eea435fe32d18c2da2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b8599377a36e3808e46d82101db19e68ad8a78ba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=619d297b56e297ccb0ef334af02898a844e46d24, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=50cb817d94efdc45a4ce57ee07b7556248356328, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)
�x�������������ȑ�������Xn�(
x������0������h�$x����������������hgi� vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only use reserve ports when necessary
  (bz# 141773)- Update to util-linux-2.12p. This changes swap header format
  from - you may need to rerun mkswap if you did a clean install of
  FC3.- Update to util-linux-2.12j- Corrected a buffer overflow problem with nfs mounts.
  (bz# 141733)- Patches for various bugs.- Made NFS mounts adhere to the IP protocol if specified on
  command line as well as made NFS umounts adhere to the
  current IP protocol. Fix #140016- Add include_raw macro, build with it off for Fedora- Add raw patch to allow binding of devices not yet in /dev- Add David Zeuthen's patch to enable the pamconsole flag #133941- Restore raw utils (bugzilla #130016)- Add the missing remote entry in pam.d- Rechecked in some missing NFS mounting code.- Make swaplabel support work with swapon -a -e- Updated the NFS and NFS4 code to the latest CITI patch set
  (in which they incorporate a number of our local patches).- Fix #132196 - turn on SELinux support at build-time.- Fix #91174 with pamstart.patch- Fix #16415, #70616 with rdevman.patch
- Fix #102566 with loginman.patch
- Fix #104321 with rescuept.patch (just use plain lseek - we're in _FILE_OFFSET_BITS=64 land now)
- Fix #130016 - remove raw.
- Re-add agetty (replacing it with mgetty is too much pain, and mgetty is much larger)- Made the NFS security checks more explicit to avoid confusion
  (an upstream fix)
- Also removed a compilation warning- Remove unused mount libdevmapper inclusion.- Add device-mapper mount-by-label support
- Fix segfault in mount-by-label when a device without a label is present.- Updated nfs man page to show that intr are on by
  default for nfs4- modified warning causing heart attack for >16 partitions, #107824- Fix #126623, #126572
- Patch cleanup
- Remove agetty (use mgetty, agetty is broken)- rebuilt- Update to 2.12a
- Fix #122448- Change pam_selinux to run last- Fix #122448 (autofs issues)- Fix #119157 by editing the patch
- Add patch145 to fix #119986- Fix #118803- mkcramfs: use PAGE_SIZE for default blocksize (#118681)- Updated the nfs-mount.patch to correctly 
  handle the mounthost option and to ignore 
  servers that do not set auth flavors- Fix selinux ordering or pam for login- Make RPC error messages displayed with -v argument
- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running
- Ping NFS v4 servers before diving into kernel
- Make v4 mount interruptible which also make the intr option on by default- Reworked how the rpc.idmapd and rpc.gssd checks were
  done due to review comments from upstream.
- Added rpc_strerror() so the '-v' flag will show RPC errors.- Added two checks to the nfs4 path what will print warnings
  when rpc.idmapd and rpc.gssd are not running.- Reworked and updated the nfsv4 patches.- Bump version- Tried to make nfs error message a bit more meaninful
- Cleaned up some warnings- Added pesudo flavors for nfsv4 mounts.
- Added BuildRequires: libselinux-devel and Requires: libselinux
  when WITH_SELINUX is set.- check for 2.6.3 kernel in mount options- Remove /bin/kill for #116100- rebuilt- rebuilt- Final 2.12 has been out for ages - might as well use it.- Added mount patches that have NFS version 4 support- Provides: mount losetup- Add multiple to /etc/pam.d/login for SELinux- 2.12pre-1
- Merge mount/losetup packages into the main package (#112324)
- Lose�x�������������0��������Xo
�(
���9������r�$b����������������rqs�@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijj@kklm@nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnonnnnnnnnnnnnnnnnnnnnnnnnnnnnnASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=78ecd19fec9be4640f53d9d755f6bbe3173a9e40, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=57406f96ecbc2f6576f5d78f254bf3571b1f5d4c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c5a8e742ea95368b65edd856bf2feb3119654677, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=de1ce0c881b70b8795bffa9c5293934ceed7a094, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=bbaf61082ea843099d4d4c605f38a644bfcfff58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=23930f026445ef98d4da490b100ca70f47a3df69, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dd56df3364e0a120316ba13844156f82f2316575, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=37d58cfc0cc4b064b5777d1c610edbdcf3ab0a33, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c9e12427b5453fd47600be6221f49fbd2c72231d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9f9375a931913c2f05b0717bd331e89920c00338, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=da6629069a545035ea5f8aed959c2b35e9b070d5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7a0517578d75c9d2926188e6b8717d2bd682beba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamicall�x��������������p�������Xp��(
����$y�������������������� kernel- makedumpfile: Support newer kernels
- kdump-lib-initramfs.sh: using -force option when poweroff
- kexec-tools/vmcore-dmesg: fix infinite loop if log buffer wraps around
- makedumpfile: sadump: fix failure of reading 640 KB backup region if at over 4GB location
- Make udev reload rules quiet during bootup- makedumpfile: Fix failure of detection of SPARSEMEM EXTREME in case of -x VMLINUX
- makedumpfile: ppc64: increase MAX_PHYSMEM_BITS to 128TB
- kdumpctl: Rebuild initramfs if loaded kernel modules changed- Add aarch64 specific kdump.sysconfig and use 'nr_cpus' instead of 'maxcpus'
- Add missing usage info
- Throttle kdump reload request triggered by udev event
- Rewrite kdump's udev rules
- kdumpctl: Add reload support- arm64: If 'getrandom' syscall fails, don't error out - just warn and proceed- Update help text to indicate --mem-usage is supported on archs other than x86_64
- Fix 'makedumpfile --split' error ("Can't read the buffer of struct page") on x86_64- dracut-module-setup: Enable dracut squash module
- dracut-module-setup: Fix DRM module inclusion test for hyper-v- kdumpctl: add showmem cmd
- makedumpfile: fix makedumpfile Not tainted in 2nd kernel- Add support to supply 'kaslr-seed' to secondary kernel
- kexec-tools.spec: Drop kexec-tools-2.0.3-disable-kexec-test.patch- Rebuild with fixed binutils- pull in makedumpfile 1.6.3- pull in 2.0.17- kdump.sysconfig.ppc64(le): remove "root=" param from ppc64(le) 2nd kernel
- kdumpctl: Check the modification time of core_collector
- dracut-module-setup.sh: pass correct ip= param for ipv6- Escape macros in %changelog- update anaconda addon migrate with Anaconda changes.- workaround koji build failure (rhbz1520805)- dracut-module-setup.sh: check whether to include multipath-hostonly or not
- Revert "kdumpctl: sanity check of nr_cpus for x86_64 in case running out of vectors"
- kdumpctl: skip selinux-relabel for dracut_args --mount dump target- update to kexec-tools 2.0.16- Use absolute path /usr/bin/dracut in mkdumprd- kdumpctl: Error out in case there are white spaces before an option name- dracut-module-setup.sh: eliminate redundant kdump_get_mac_addr call
- mkdumprd: use --quiet dracut argument to speedup initramfs build
- mkdumprd: fix patterns to modify mount options
- fadump: rebuild default initrd with dump capture capability
- module-setup: remove software iscsi cmdline generated by dracut
- kdumpctl: remove some cmdline inheritage from 1st kernel
- mkdumprd: apply dracut "--hostonly-cmdline" and "--no-hostonly-default-device"
- Change dump_to_rootfs to use "--mount" instead of "root=X"
- kdumpctl: move is_fadump_capable() to kdump-lib.sh
- Revert "kdumpctl: use generated rd.lvm.lv=X"
- Revert "mkdumprd: omit crypt when there is no crypt kdump target"
- Revert "mkdumprd: omit dracut modules in case of no dm target"
- Revert "mkdumprd: omit dracut modules in case of network dumping"
- update bogus date in rpm spec- makedumpfile: fix 4.13 kernel larget vmcore bug
- Revert "Improve 'cpu add' udev rules"- Own the /usr/share/makedumpfile dir
- Mark COPYING as %license- Improve 'cpu add' udev rules
- module-setup: suppress the early iscsi error messages
- mkdumprd: use 300s as the default systemd unit timeout for kdump mount- fix makedumpfile bug 1474706- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuild with binutils fix for ppc64le (#1475636)- update upstream makedumpfile 1.6.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- mkdumprd: remove useless "x-initrd.mount"
- kdumpctl: use "apicid" other than "initial apicid"- module-setup: fix 99kdumpbase network dependency
- mkdumprd: omit dracut modules in case of network dumping
- mkdumprd: omit dracut modules in case of no dm target
- mkdumprd: omit crypt when there is no crypt kdump target
- kdumpctl: use generated rd.lvm.lv=X
- mkdumprd: change for_each_block_target() to use get_kdump_targets()
- kdump-lib.sh: introduce get_kdump_targets()
- kdump-lib.sh: fix improper get_block_dump_target()
- kdumpctl: �x��������������_�������Xq��(
�0�������}������x!�$h����������������x!w!y!�sar <ppisar@redhat.com> - 4:5.14.2-198Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.2-197Petr Pisar <ppisar@redhat.com> - 4:5.14.2-196Petr Pisar <ppisar@redhat.com> - 4:5.14.2-195Iain Arnell <iarnell@gmail.com> 4:5.14.2-194Petr Pisar <ppisar@redhat.com> - 4:5.14.2-193Petr Pisar <ppisar@redhat.com> - 4:5.14.1-192Petr Pisar <ppisar@redhat.com> - 4:5.14.1-191Petr Pisar <ppisar@redhat.com> - 4:5.14.1-190Petr Pisar <ppisar@redhat.com> - 4:5.14.1-189Petr Pisar <ppisar@redhat.com> - 4:5.14.1-188Petr Pisar <ppisar@redhat.com> - 4:5.14.1-187Iain Arnell <iarnell@gmail.com> 4:5.14.1-186Petr Sabata <contyk@redhat.com> - 4:5.14.1-185Iain Arnell <iarnell@gmail.com> 4:5.14.1-184Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-183Paul Howarth <paul@city-fan.org> - 4:5.14.1-182Petr Sabata <contyk@redhat.com> - 4:5.14.1-181Iain Arnell <iarnell@gmail.com> 4:5.14.1-180Iain Arnell <iarnell@gmail.com> 4:5.14.1-179Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-178Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-175Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-174Iain Arnell <iarnell@gmail.com> 4:5.14.1-173Paul Howarth <paul@city-fan.org> - 4:5.14.1-172Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.1-171Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-170Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-169Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-167Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-165Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-163Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-162Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.14.0-161Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-160Petr Pisar <ppisar@redhat.com> - 4:5.12.3-159Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-158Robin Lee <cheeselee@fedoraproject.org> - 4:5.12.3-157Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-156Iain Arnell <iarnell@gmail.com> 4:5.12.3-154Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.12.3-153Petr Pisar <ppisar@redhat.com> - 4:5.12.3-152Tom Callaway <spot@fedoraproject.org> - 4:5.12.3-151Petr Pisar <ppisar@redhat.com> - 4:5.12.3-150Lukas Berk <lberk@redhat.com> - 4:5.12.3-149Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.3-148Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-146Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-145Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-144Petr Pisar <ppisar@redhat.com> - 4:5.12.2-143Petr Pisar <ppisar@redhat.com> - 4:5.12.2-142Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-141Petr Pisar <ppisar@redhat.com> - 4:5.12.2-140Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-139Petr Pisar <ppisar@redhat.com> - 4:5.12.2-138Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-137Petr Pisar <ppisar@redhat.com> - 4:5.12.2-136Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-135Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.2-134Petr Pisar <ppisar@redhat.com> - 4:5.12.2-133Petr Sabata <psabata@redhat.com> - 5:5.12.2-132Petr Sabata <psabata@redhat.com> - 4:5.12.2-1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-131Petr Pisar <ppisar@redhat.com> - 4:5.12.1-130Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-129Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-128Dan Horák <dan[at]danny.cz> - 4:5.12.1-127Petr Pisar <ppisar@redhat.com> - 4:5.12.1-126Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-125Ralf Corsépius <corsepiu@fedoraproject.org> -  4:5.12.1-124Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.1-123Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-122Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-121Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-120-testMarcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119.1Marcela Mašláňová <mmaslano@redhat.com> - 4:5.12.0-119Marcela Mašláňová <mmaslano@redhat.com> - 4�x��������������O�������Xr�(
�i�������i������I��$Y����������������I�J�H��61c5853c4580f762a6b01fee8c0efcd9c4bc3e734014afd7dc023de17ed82f7a85bfb5a794bb54a2f9e4494240e5fe847ea8d1a8278eba2dd650f3bcbaa7c124154e811d80263afd7d01dde01b821eb122f6f743f327229eba9e3b637f8761291ff45fec4aff95cd84b730159b523ad8cf5629f8dd35c11fe2213eeec21179fb395f4d9ad448872e6e465ade90b19e825037770dc12d27cd43e897480e362dd09305addea68a5c7cb5f0752aa16f07ea34a68f08d570ac73fd51bfc57db169be5877f93a31851c3b488673dfbfa9493c26e105f6d26e9f2e2a0fce0e306791c87dc540b80c1f7489ebd2225d6d922e14575a650330cb02f7424ba7c57f8788937cd6e52d404abc729ab75aa9d45022c0daef213c02c448f09f7c523a4736db4bdc1fb9e420f7ea03ceb09518850d5d37918deb4f6ed64ff72fe20fee99bbdb22d7529bb47749fa0a722fd25c9c480ddebdd1a9a658e4d6ec9d5380f7322ecea5461d046f44289a916c05c36c1e3ed6f6309755b274199ae6ff563296b21fdb46917a8df775c9ee225cff73c264be1076f943012a653b0bc893d8b813db38a75e873a2eace7352613b0feccea7d3bd705e983202479d40e816e9b41d3a1ed909cb5b0218582709b5fc04a27b4075d2a107df75f5ccdad3654dae5b796ad03f5654127a20b48f69da06c0f3effd1c7fc3e6b787c79a0f4e846d02f8b6c71393ead1f147cec270e3dab540527e5f2b45ecf6ceae38f02231dca6c8ec359bb007b13ba9206080bf7143f3e8c15a448d4c9b26dfdf4245ba603eb4ce9182e03b9bbeca0aba7d9b56989af5787bbe7434a9769d4efaf156b5278923ef97e7f0868e19dabe20b50493f55a5635f3170ac83d0a3ba4714a1291af1111b443aae61b6d99a477e6948c5f4de8be785aea40b32585b5dddeee9b77544932c95da8da9b2a37ecbc75e1742cf2cc01ceab118c7e3d3e13ccebcb4ae8f5879bec95e64b78981364a3b13c378f9da526e23452ab31ea5a9a2237347e88007f0535c481cb1d6951fc0629dfd550618e6459b34629b31b09fe96531c544cdd00783bcb9f3d22b02293825abd7dd02f57f601aa5c4e5d61e91d74b64f13d94fd2081571687c405e688eef7cdc2c62ffb5943d835c250c1546e95e8cf244430abbbe338a3f5223a9a3d7c1318c135809c5adb0ed4dd7ac6699d3a94d8f3fc4ee121949863f3767c2cd24599339c7b39b2ce777b9533a9f1c2d5b20b091967576239a18095f0ba8d9f02e8fe6095c41cbae556aa441c6d6e8fd50590fdc6c99b11ca5a7046adbfc5188789994f1f75e5799d97605ec0c23cd65ab0c89e2cd85c02eb63ac5ac93bbb07b3749e4420877b25e91e3d0aefc92e997e55e9ae94c83329f43a5153ebf9276e8e13d2e61a653c7587fc829b02487751ae664d0d97bad11d652bdfd7418d6e74c1b1f3563f500d5f21e3127f559068045728be1a117ea9f1247a46701d9ab54fa5fec9255354aadb8d58a3dd294d2f3b4f7977eea8d3671951d2d7ee446d331867b04ed3b98cc1d5c4571ae3bdf862eea2b3cfb01c61292ac72ebb3e10bdb4b5b465dc068803a1cbf6d27b5097668184e62a2e150d5b3b212282e1ad03a24e8a1ef45b3e76fed5b26cd341611fc9e1f3c34d1ae3e1712e156a2ab5d50a622c294c0befacc19c943ddec77c0ebeae1b41e905e0dd156123f274539220e87518206123d823183ae8dcc9ec3418ef1c07647b81d402d7f829cb7ea0f9070adb826789be0f51730cf90eecd3bba8491fc8248c450128872a12c3a31d90125001565e207e683298e27cc5582e44367a1fefae63e17ea061574340d174560a5275f4b3ef7c9cbe101f76b9b7b425e5cab2208d243de95e989cd9db5a474b43fc71bf12542fb95426ff3a8df76ab12fd70de4c2f4d227130817287e7fd6c392d818e560218b60ab756cd30d6572fa12f0e7c413c3d6ef9e13ed0964f3cc418b9305ad90408ef324a09cf9c27ac990bc88d28f859648560e43f7ff9a7e9608634bf593bdeb8abdccdaeb103959c0c4be7f7a8c7f3157aa43a59740dbf7a14bc3bee73940a3a5d4b01b2f814d6b0b554251731addbd7f243946c769505c419f3c43ccf5450e18df28acf3d4470c4c18004fbf4c20268c3bab690ecd2f76cd0f60e5f1a6756382bd37dd62505e9f8609cf739070345bde966da7e4ca3c3fc14ed2452289d1664c59387d60a6ac7857d378ea025514235474649998b2138368cae97a6abe88e835f800e0679f948827ae63af9570bc342b42b097324ce432e9c5ab066d992adb9f52212131818c22c32c935bfd12711e36d373265ad9418f8562eaaa995dbfc144d2b2f0b1be7ef61ad403ac4561d8a023c52df170bf44fa6950a8511556c85235b3e24f6f34455b9df7f04c84309b1b1ec5e5cd47c9ae56fde5e26c1a4f19afa9eab179f334610678ac514f54af924bd99a13b4a4c5a7f34d9721807e05950c679256d86b3a2538cbc143cf5d7698e95f8c47128a19387ad780211a6b4d7f9e94407e8e254572e9e8309997529e5034339a5bf2281a865e9f2c8f7f3e25b3c681f6030734d80a0f823f957823ac5bc7ee0840012438ae68231c872570e948a541513a6daaac43c793187f5aadf9cf9209e478d2df5894574377a484db3308379dfefcd613707ae7991d6ca04124dadf74ba479e02db5e30645881cf0f41584a40d325e6453800ff54f3eb013244ae2bda538e24a02288ce79b3f683721686d7295e6b7036f1aad4e7fd5a740bbf6c44e07139bfb5efd270b213a5dc0f0cc69a1d46621ef9ff19966fd46a8d915a125a30e7dad�x�����`��������>�������X���(
  �������\������y!�$i����������������y!x!z!�:5.10.1-118Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-117Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-116Paul Howarth <paul@city-fan.org> - 4:5.10.1-115Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-114Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-112Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-111Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-110Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.1-109Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.1-107Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-106Ralf Corsépius <corsepiu@fedoraproject.org> - 4:5.10.1-105Stepan Kasal <skasal@redhat.com> - 4:5.10.1-104Stepan Kasal <skasal@redhat.com> - 4:5.10.1-103Stepan Kasal <skasal@redhat.com> - 4:5.10.1-102Stepan Kasal <skasal@redhat.com> - 4:5.10.1-101Stepan Kasal <skasal@redhat.com> - 4:5.10.1-100Stepan Kasal <skasal@redhat.com> - 4:5.10.0-87Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-86Stepan Kasal <skasal@redhat.com> - 4:5.10.0-85Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-84Stepan Kasal <skasal@redhat.com> - 4:5.10.0-83Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-82Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-81Stepan Kasal <skasal@redhat.com> - 4:5.10.0-80Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-79Stepan Kasal <skasal@redhat.com> - 4:5.10.0-78arcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-77Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-76Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.10.0-75Stepan Kasal <skasal@redhat.com> - 4:5.10.0-74Stepan Kasal <skasal@redhat.com> - 4:5.10.0-73Stepan Kasal <skasal@redhat.com> - 4:5.10.0-72Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-71Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-70Stepan Kasal <skasal@redhat.com> - 4:5.10.0-69Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-68Stepan Kasal <skasal@redhat.com> - 4:5.10.0-67Stepan Kasal <skasal@redhat.com> - 4:5.10.0-66Stepan Kasal <skasal@redhat.com> - 4:5.10.0-65Stepan Kasal <skasal@redhat.com> - 4:5.10.0-64Stepan Kasal <skasal@redhat.com> - 4:5.10.0-63Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-62Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-61Stepan Kasal <skasal@redhat.com> - 4:5.10.0-60Robert Scheck <robert@fedoraproject.org> - 4:5.10.0-59Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-58Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-57Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-56Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-55Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-54Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-53Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-52Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-51Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-50Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-49Lubomir Rintel <lkundrak@v3.sk> - 4:5.10.0-48Marcela Mašláňová <mmaslano@redhat.com> 4:5.10.0-47.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-46Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-45Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-44.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-43.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-42.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-41.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-40.fc10Stepan Kasal <skasal@redhat.com> 4:5.10.0-39.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-38Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-36Stepan Kasal <skasal@redhat.com> 4:5.10.0-35Stepan Kasal <skasal@redhat.com> 4:5.10.0-34Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-33Stepan Kasal <skasal@redhat.com> 4:5.10.0-32Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-28Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-27Stepan Kasal <skasal@redhat.com> 4:5.10.0-26Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-25Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-24Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-23Marcela Maslanova <mmaslano@redhat.com>�x��������������.�������Xtǜ(
���������b�������!�$�����������������!�!�!�ted
  automatically.- Provide perl(DB) by perl- Do not warn about missing site directories (bug #732799)- cleaned spec (thanks to Grigory Batalov)
-  Module-Metadata sub-package contained perl_privlib instead of privlib
-  %files parent section was repeated twice- Filter false perl(DynaLoader) provide from perl-ExtUtils-MakeMaker
  (bug #736714)
- Change Perl_repeatcpy() prototype to allow repeat count above 2^31
  (bug #720610)
- Do not own site directories located in /usr/local (bug #732799)- Fix CVE-2011-3597 (code injection in Digest) (bug #743010)
- Sub-package Digest and thus Digest::MD5 module (bug #743247)- add provide for perl(:MODULE_COMPAT_5.14.2)- 5.14.2 bump (see
  https://metacpan.org/module/FLORA/perl-5.14.2/pod/perldelta.pod for release
  notes).
- Fixes panics when processing regular expression with \b class and /aa
  modifier (bug #731062)
- Fixes CVE-2011-2728 (File::Glob bsd_glob() crash with certain glob flags)
  (bug #742987)- Enable GDBM support again to build against new gdbm 1.9.1- Disable NDBM support temporarily too as it's provided by gdbm package- Disable GDBM support temporarily to build new GDBM- Correct perl-CGI list of Provides
- Make tests optional
- Correct perl-ExtUtils-ParseXS Provides
- Correct perl-Locale-Codes Provides
- Correct perl-Module-CoreList version
- Automate perl-Test-Simple-tests Requires version- Make gdbm support optional to bootstrap with new gdbm
- Split Carp into standalone sub-package to dual-live with newer versions
  (bug #736768)- Split Locale::Codes into standalone sub-package to dual-live with newer
  versions (bug #717863)- perl needs to own vendorarch/auto directory- Move xsubpp to ExtUtils::ParseXS (#728393)- fix Compress-Raw-Bzip2 pacakging
- ensure that we never bundle bzip2 or zlib- remove from provides MODULE_COMPAT 5.12.*- Have perl-Module-Build explicitly require perl(CPAN::Meta) >= 2.110420,
  needed for creation of MYMETA files by Build.PL; the dual-life version of
  the package already has this dependency- Temporarily provide 5.12.* MODULE_COMPAT- fix escaping of the __provides_exclude_from macro- Parse-CPAN-Meta explicitly requires CPAN::Meta::YAML and JSON::PP
- Exclude CPAN::Meta* from CPAN sub-package
- Don't try to normalize CPAN-Meta, JSON-PP, and Parse-CPAN-Meta versions;
  their dual-life packages aren't and have much higher numbers already- update macros -> add %perl_bootstrap 1 and example for readability
- add into Module::Build dependency on perl-devel (contains macros.perl)
- create new sub-package macros, because we need macros in minimal buildroot- remove from macros BSD, because there exists BSD::Resources- remove old MODULE_COMPATs- move ptargrep to Archive-Tar sub-package
- fix version numbers in last two changelog entries- add provide for perl(:MODULE_COMPAT_5.14.1)- update to 5.14.1 - no new modules, just serious bugfixes and doc
- switch off fork test, which is failing only on koji- try to update to latest ExtUtils::MakeMaker, no luck -> rebuild with current 
  version, fix bug RT#67618 in modules- filter even Mac:: requires, polish filter again for correct installation
- add sub-package Compress-Raw-Bzip2, solve Bzip2 conflicts after install
- and add IO::Uncompress::Bunzip2 correctly into IO-Compress- Perl 5.14 mass rebuild, bump release, remove releases in subpackages- Perl 5.14 mass rebuild- Perl 5.14 mass rebuild- add new sub-packages, remove BR in them- arm can't do parallel builds
- add require EE::MM into IPC::Cmd 711486- test build of released 5.14.0
- remove Class::ISA from sub-packages
- patches 8+ are part of new release
- remove vendorarch/auto/Compress/Zlib- add provides UNIVERSAL and DB back into perl- Remove rpath-make patch because we use --enable-new-dtags linker option- 692900 - lc launders tainted flag, RT #87336- Cwd.so go to the PathTools sub-package- sub-package Path-Tools- sub-package Scalar-List-Utils- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Document ExtUtils::ParseXS upgrade in local patch tracking- update �x��������������������Xu��(
��������P�7Y�$'����������������7Y8Y6Y�_method_data.3ssl.gzX509_LOOKUP_get_store.3ssl.gzX509_LOOKUP_hash_dir.3ssl.gzX509_LOOKUP_init.3ssl.gzX509_LOOKUP_load_file.3ssl.gzX509_LOOKUP_meth_free.3ssl.gzX509_LOOKUP_meth_get_ctrl.3ssl.gzX509_LOOKUP_meth_get_free.3ssl.gzX509_LOOKUP_meth_get_get_by_alias.3ssl.gzX509_LOOKUP_meth_get_get_by_fingerprint.3ssl.gzX509_LOOKUP_meth_get_get_by_issuer_serial.3ssl.gzX509_LOOKUP_meth_get_get_by_subject.3ssl.gzX509_LOOKUP_meth_get_init.3ssl.gzX509_LOOKUP_meth_get_new_item.3ssl.gzX509_LOOKUP_meth_get_shutdown.3ssl.gzX509_LOOKUP_meth_new.3ssl.gzX509_LOOKUP_meth_set_ctrl.3ssl.gzX509_LOOKUP_meth_set_free.3ssl.gzX509_LOOKUP_meth_set_get_by_alias.3ssl.gzX509_LOOKUP_meth_set_get_by_fingerprint.3ssl.gzX509_LOOKUP_meth_set_get_by_issuer_serial.3ssl.gzX509_LOOKUP_meth_set_get_by_subject.3ssl.gzX509_LOOKUP_meth_set_init.3ssl.gzX509_LOOKUP_meth_set_new_item.3ssl.gzX509_LOOKUP_meth_set_shutdown.3ssl.gzX509_LOOKUP_new.3ssl.gzX509_LOOKUP_set_method_data.3ssl.gzX509_LOOKUP_shutdown.3ssl.gzX509_NAME_ENTRY_create_by_NID.3ssl.gzX509_NAME_ENTRY_create_by_OBJ.3ssl.gzX509_NAME_ENTRY_create_by_txt.3ssl.gzX509_NAME_ENTRY_dup.3ssl.gzX509_NAME_ENTRY_free.3ssl.gzX509_NAME_ENTRY_get_data.3ssl.gzX509_NAME_ENTRY_get_object.3ssl.gzX509_NAME_ENTRY_new.3ssl.gzX509_NAME_ENTRY_set_data.3ssl.gzX509_NAME_ENTRY_set_object.3ssl.gzX509_NAME_add_entry.3ssl.gzX509_NAME_add_entry_by_NID.3ssl.gzX509_NAME_add_entry_by_OBJ.3ssl.gzX509_NAME_add_entry_by_txt.3ssl.gzX509_NAME_cmp.3ssl.gzX509_NAME_delete_entry.3ssl.gzX509_NAME_digest.3ssl.gzX509_NAME_dup.3ssl.gzX509_NAME_entry_count.3ssl.gzX509_NAME_free.3ssl.gzX509_NAME_get0_der.3ssl.gzX509_NAME_get_entry.3ssl.gzX509_NAME_get_index_by_NID.3ssl.gzX509_NAME_get_index_by_OBJ.3ssl.gzX509_NAME_get_text_by_NID.3ssl.gzX509_NAME_get_text_by_OBJ.3ssl.gzX509_NAME_new.3ssl.gzX509_NAME_oneline.3ssl.gzX509_NAME_print.3ssl.gzX509_NAME_print_ex.3ssl.gzX509_NAME_print_ex_fp.3ssl.gzX509_OBJECT_set1_X509.3ssl.gzX509_OBJECT_set1_X509_CRL.3ssl.gzX509_PUBKEY_free.3ssl.gzX509_PUBKEY_get.3ssl.gzX509_PUBKEY_get0.3ssl.gzX509_PUBKEY_get0_param.3ssl.gzX509_PUBKEY_new.3ssl.gzX509_PUBKEY_set.3ssl.gzX509_PUBKEY_set0_param.3ssl.gzX509_REQ_INFO_free.3ssl.gzX509_REQ_INFO_new.3ssl.gzX509_REQ_check_private_key.3ssl.gzX509_REQ_digest.3ssl.gzX509_REQ_dup.3ssl.gzX509_REQ_free.3ssl.gzX509_REQ_get0_pubkey.3ssl.gzX509_REQ_get0_signature.3ssl.gzX509_REQ_get_X509_PUBKEY.3ssl.gzX509_REQ_get_pubkey.3ssl.gzX509_REQ_get_signature_nid.3ssl.gzX509_REQ_get_subject_name.3ssl.gzX509_REQ_get_version.3ssl.gzX509_REQ_new.3ssl.gzX509_REQ_set0_signature.3ssl.gzX509_REQ_set1_signature_algo.3ssl.gzX509_REQ_set_pubkey.3ssl.gzX509_REQ_set_subject_name.3ssl.gzX509_REQ_set_version.3ssl.gzX509_REQ_sign.3ssl.gzX509_REQ_sign_ctx.3ssl.gzX509_REQ_verify.3ssl.gzX509_REVOKED_add1_ext_i2d.3ssl.gzX509_REVOKED_add_ext.3ssl.gzX509_REVOKED_delete_ext.3ssl.gzX509_REVOKED_dup.3ssl.gzX509_REVOKED_free.3ssl.gzX509_REVOKED_get0_extensions.3ssl.gzX509_REVOKED_get0_revocationDate.3ssl.gzX509_REVOKED_get0_serialNumber.3ssl.gzX509_REVOKED_get_ext.3ssl.gzX509_REVOKED_get_ext_by_NID.3ssl.gzX509_REVOKED_get_ext_by_OBJ.3ssl.gzX509_REVOKED_get_ext_by_critical.3ssl.gzX509_REVOKED_get_ext_count.3ssl.gzX509_REVOKED_get_ext_d2i.3ssl.gzX509_REVOKED_new.3ssl.gzX509_REVOKED_set_revocationDate.3ssl.gzX509_REVOKED_set_serialNumber.3ssl.gzX509_SIG_INFO_get.3ssl.gzX509_SIG_INFO_set.3ssl.gzX509_SIG_free.3ssl.gzX509_SIG_get0.3ssl.gzX509_SIG_getm.3ssl.gzX509_SIG_new.3ssl.gzX509_STORE.3ssl.gzX509_STORE_CTX_cert_crl_fn.3ssl.gzX509_STORE_CTX_check_crl_fn.3ssl.gzX509_STORE_CTX_check_issued_fn.3ssl.gzX509_STORE_CTX_check_policy_fn.3ssl.gzX509_STORE_CTX_check_revocation_fn.3ssl.gzX509_STORE_CTX_cleanup.3ssl.gzX509_STORE_CTX_cleanup_fn.3ssl.gzX509_STORE_CTX_free.3ssl.gzX509_STORE_CTX_get0_cert.3ssl.gzX509_STORE_CTX_get0_chain.3ssl.gzX509_STORE_CTX_get0_param.3ssl.gzX509_STORE_CTX_get0_untrusted.3ssl.gzX509_STORE_CTX_get1_chain.3ssl.gzX509_STORE_CTX_get_cert_crl.3ssl.gzX509_STORE_CTX_g�x�������������x
�������Xv�(
�����������������d�$X�����������������d�d�d���g��g��g��g��g��g�wg�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g�wg��g�wg��g�wg�wg��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g�wg�wg��g�wg��g��g��g��g��g��g�wg��g��g�wg��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g�wg��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�wg��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g�xg�xg��g��g��g�xg��g��g��g��g�xg�xg��g��g��g��g��g��g��g�xg��g��g�xg��g�xg��g�xg��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g�yg��g��g��g��g�yg��g��g��g��g��g��g��g�yg��g��g��g�yg��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g�zg��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g�zg��g��g��g�zg��g��g��g��g�zg��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g�zg��g�zg��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g�zg��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�zg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�{g��g��g��g��g��g��g��g��g�{g��g��g��g��g��g��g�{g��g��g�{g��g�{g��g��g�{g��g�{g��g��g�{g��g��g�{g��g��g��g�{g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�xg��g��g��g��g�xg��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g�yg��g��g�yg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�yg��g��g��g��g��g��g��g�yg��g��g��g��g�yg�yg�yg��g��g�zg��g��g�{g��g��g��g��g�{g��g��g�{g��g��g��g��g�{g�{g��g��g��g��g�{g�{g��g��g�{g��g��g��g��g��g��g��g��g�{g�{g��g��g��g��g��g�{g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g���x�������������������Xw8�(
0c�C���$i�����������������������vad@redhat.com> - 2.3.0-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.3.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.2.2-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.2.1-1Jan Vcelak <jvcelak@redhat.com> 2.2.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.1.2-1Jan Vcelak <jvcelak@redhat.com> 2.1.1-1Jan Vcelak <jvcelak@redhat.com> 2.1.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.1-3Jan Kaluza <jkaluza@redhat.com> - 2.0.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.0.1-1Jan Vcelak <jvcelak@redhat.com> 2.0-1- Make hdparm device checks lazy
  Resolves: RHEL-71457
- Disable the amd.scheduler plug-in instance in the postgresql profile
  Resolves: RHEL-70470- Added sanity checks for API methods parameters, (CVE-2024-52337)
  Resolves: RHEL-66614- sap-netweaver: increase vm.max_map_count
  resolves: RHEL-32124- release bump due to broken c8s
  related: RHEL-27528- release bump
  related: RHEL-27528- profiles: added epyc-eda profile
  resolves: RHEL-27528- new release
  - rebased tuned to latest upstream
    related: RHEL-17119
  - renamed intel_uncore plugin to uncore
  - network-throughput: increased net.ipv4.tcp_rmem default value- new release
  - rebased tuned to latest upstream
    related: RHEL-17119
  - lower CPU usage by using runtime=0 in profiles using scheduler plugin
    resolves: RHEL-6869- new release
  - rebased tuned to latest upstream
    resolves: RHEL-17119
  - print all arguments of failing commands in error messages
  - plugin_sysctl: added support for sysctl names with slash
  - tuned-adm: added support for moving devices between plugin instances
  - api: added methods for retrieval of plugin instances and devices
  - plugin_cpu: amd-pstate mentioned instead of just intel_pstate
  - hotplug: do not report ENOENT errors on device remove
  - plugin_sysctl: expand variables when reporting overrides
  - plugin_acpi: new plugin which handles ACPI platform_profile
  - plugin_bootloader: skip calling rpm-ostree kargs in no-op case
  - plugin_cpu: support cstate settings of pm_qos_resume_latency_us
  - scheduler: add option for ignoring IRQs affinity
  - plugin_intel_uncore: new plugin for uncore setting- new release
  - api: fixed stop method not to require any parameter
    resolves: rhbz#2235638- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2182119
  - sap-hana: new profile sap-hana-kvm-guest
    resolves: rhbz#2173740
  - serialized SIGHUP handler to prevent possible bootcmdline corruption
    resolves: rhbz#2215298- new release
  - rebased tuned to latest upstream
    related: rhbz#2133814- post RC.1 fixes
  related: rhbz#2133814
- fixed possible traceback on SIGHUP- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2133814
  - systemd: relax polkit requirement
    resolves: rhbz#2065591
  - sysvinit: fixed path
  - plugin_cpu: added support for pm_qos_resume_latency_us
  - do not exit on duplicate config lines
    resolves: rhbz#2071418
  - profiles: new cpu-partitioning-powersave profile
  - profiles: new profile for AWS EC2
  - API: add support for moving devices between instances
  - D-Bus: send tracebacks through D-Bus only in debug mode
  - Makefile: added fix for python-3.12
  - throughput-performance: set net.core.somaxconn to at least 2048
    resolves: rhbz#1998310
  - plugin_scheduler: do not leak FDs from the perf
    resolves: rhbz#2080227
  - plugin_cpu: added support for intel_pstate scaling driver
  - added support for the API access through the Unix Domain Socket- new release
  - rebased tuned to latest upstream
    related: rhbz#2057602- new release
  - rebased tuned to latest upstream
    resolves: rhbz#2057602
  - fixed parsing of inline comments
    resolves: rhbz#2060138
  - added support for quotes in isolated_cores specification
    resolves: rhbz#1891036
  - recommend: preset balanced profile for notebook, laptop or portable if
    syspurpose is not defined
    res�x�������������h������Xx�(
��������������E��$U����������������E�F�D��ba31969f92ca36e1d471d747d16942bc86730663f8cf01fd1556b5071ee6a2f9675d8d94c8f39d700f92cfcc3a3d7338a7e39931d89ed0c77ee2240b158badc06fd47e6506da2edb72625c3ba62f285e3097864cc9de017a87e4872c3185fb0c4e44a6da33aa79659d7a2d8906aada1a02523251b0180e0a47c93654fe9a2a77bfd4c858fa9f28a232a3e552c3943d9441b0b498077ddde2c225adda4bd975ed4a4d4be1f5d59c29473aeba3209c6c7def62cbf7d031c4fe319e414117043f2a273885bff93bd18e11935d00a66776893b9916b2700a479d94ed796de13f28f4b0ef427e5005f6a6f9780724960def377edf57122db849bacaf288e086826f3c2ad6f7a5f2fba491994c0296b42c16bbafce471fe506a1f5cab3875f656e266281842c8112b6c21d8f88aa930d5cbf45d2cdb28d14514fef7c4b742870776a468e3324740485f9dd230587e515bdc66dc3ed4c787854fe5af410de985a282f2111e34549aab97007f2be030b6c8dc9a7cb24e72aaeec867825d62c6e11fb1695e8271771e53e32bf3af78c8fd6faa38cf1a904399788bea53ac3c72986d68ab8cfd369224b872fad307152ca473ccdca763b20f8c701557c37bdcee0c589b9e21a3014b0452cfd673e65214b854f7696f1f9245e624b0685482cd59bbbdf74761a7b878f4836134147a57cb6eb473ed1e23ae5343dab562f5b3d8175c87964ec74af7f934f30cee287d51085ecf1d2b21c1ea5095b62d18db3278ce9f4d486ca8c9572f4485a9ae8012e161adaa2dcec8ed04d68bc8f205641f09130a97f94f8991cf76cda31ac80fee645beb9580880bfcd7863132c67fb05b6cfae8f85eb3caa09ec455e2997e8b7c2036561b31482f02bdf621f7e7656311666a4f1caa6b329d2ec3a197b3672ad92855794f1e5bba56c0acdcc449ca3b73500862a5750c907d97d652978038dbc7809c4fcd07d8b2a11727c5216b633d50fd36cb5a11c8918d07753f3d0b1648130c36549f6479e7545ecfe612ad172c65b122178c2a7c62e21e3e41f925d8759f2dad91000d6144f17dc2cfb8da3b3ed2e43feed553de02d25a512edc6f0402549868bc2aa56afabe4a2866dcaf34e7818501f169904bc622d184e1f9348aa7bbafc48ddb9d15829a1ab7f6499be29626aacd8fea4196a3008af1f9b4270ede0c92cb681d9d1225ebdc6b9b844ac2b4809a874c1b547c864549ed64604c79dfa35f42644dcae7daa0b442536eef42571d9611c76373620439e3308371674cc576ffb08c085bc639e6e04f2adeafe5e62dcb3f2674893116f9509e8bdffdc655f9ffaabe9f94f364621c828e5cbc6e1059bf550bcc429baa7b22c10192e76ceb5c2e20e65875181178c1af5ebdc964ecfe034e3083c8ccec186ab55a61fda5fe78feb262e7500072b716c8f4ed700f3b5078f1d04594aab9870e41fc7bd85a28680a8690d3337a0003537ac5276eb878bb444debb3c6fe75fc9ef584547666c46da3b9fcf54766388953b67bbc2f01409e1cd90d8489fd41b4dc5a5143ab354ed2494d955d086ab367b0e2b0dd2a8297fd7e741ebb755bf6c274e7f7a16764bf48f85b859eb67c2dc507d13b68c03e7fec925beeb6f768a071672e58886eb52cb943d5d2264c606e7ccda71d0fa24bf7f8570db025b43639c218446dcac3d7c515a5bb3408d4ee1bfe2033b75954bebf2d00033a2fbbb2d25a9919d40127edb267212948cba221d27dd2caa02e980f57a2f4090af5bf2aca3141433da5b9c9dd6b25b7e5f8ebd120f13dc53c6d1863a5371686dd71fa3d91a12426a062c05da80eddd401c5ece6ad67d5ee83a0a57928894de504e14d3a4c9b082c385adaff144017cf4dea808fe849fc47d3e8ff7239c6516dc1417250a204c5b806cdf49c933161ba1b2b186789bf001f5fadb9250c9c272305341e8ce38dcec033905e40971598324c9f3409e54cc2656069d36f0b558702cfcd10d3bb1bbefe63eab177eaa0aa68437ad19b1c2577476b9a6d5b72e111600cf933e1d90188bad2c9561932a066f2ca94e5158b0385f4cd0500f21e691ead5d2d7abbc674d0beb280d2eb8cb63e845180c3e563062866285cd06e154e3e5eddd874a82571be391f3af10895528de5a63a48ee9525fdd46bb9aac6b2037452cf96f320fb63b82641863aaef8c30f59bac4e09087dff57561e2b8665c28614222c91fa4763d937ce9685502038c8637510969dc151cf9c9238b84c8794a5151a08700c3e3e5cb7e1b81b67f874007abaac964d7e32dc9eb79ccd8f1fe5e13d297c34b79ef3a1a00c6878f1a770057284d34ea9edf85b638c3e6efb407fa2e46ac6f44bf3401cba25b7a354a4d700e0e0f6ad6ad870bc290e6a4f3329dd4aa5c0fa3950e6dda8edd21a257539ea6afd209264403723d1a4f3ae54283e0c70428caf32c5ce373006e69fd4c6e46e2038a8de491ae2265a07de9f4f06f50368ab26f916b890aadb42ad84dd00fb7e87e4e14416ae12461d0b4c1f669a5ffde310baeb19fd0308885460637c2c10b23a71aead041bff6841caba32324e8061d8611f873ea44a55994ee64444f407d93a3ba4344c147ff04111bce03f034d7fa73339a6632d472789e6a40fea1d324ecd3c6dbd7dd343f35e20cc1edb6d0cc45389225124c95924d05bfefe02c3835daf84f1507b9244d9d6db70af157c481fd8b7b7859be75d9e2aefa1023f230dff67a0ff4ce487cc04bbec5e6d2ff54a6f13176782a37704734e1e6815b682413573e9d318270cafcef2ecc16f77f3d00864ffca93cc6aa5aa7880c5a1626e7452a99dd74636255749f6�x���������������������Xy��(
�������������$w��������������������re.d and post.d mandatory- x86_64: enable the kexec file load by default
- Revert "kdump-lib: switch to the kexec_file_load() syscall on x86_64 by default"- mkdumprd: Improve the error message for umounted dump target- mkdumprd: Fix nfs detection in to_mount
- Always wrap up call to dracut get_persistent_dev function
- man: improve description about /etc/kdump/{pre.d,post.d}interface- kdump-lib: switch to the kexec_file_load() syscall on x86_64 by default- Fix kdump failure when mount target specified by dracut_args
- mkdumprd: Fix dracut error on multiple extra_modules- kdump.conf: Specify /etc/kdump/{pre.d,post.d}interface
- dracut-kdump.sh: Execute the binary and script filesin /etc/kdump/{pre.d,post.d}
- kdumpctl: Check the update of the binary and script files in /etc/kdump/{pre.d,post.d}
- dracut-module-setup.sh: Install files under /etc/kdump/{pre.d,post.d} into kdump initramfs- fadump: update fadump-howto.txt with some more troubleshooting help- fadump-howto.txt: source it in spec file- mkdumprd: Use DUMP_TARGET which printing error message during ssh- Don't inherit swiotlb parameter form 1st kernel by default
- Add a new option 'rd.znet_ifname' in order to use it in udev rules
- kdump.sysconfig: Remove the option 'log_buf_len' from kdump command line
- kdump-error-handler.service: Remove ExecStopPost
- module-setup.sh: Add "rd.neednet" parameter if network is needed- Update docs for the new noauto dump target support
- kexec-kdump-howto.txt: Add some format to the document
- mkdumprd: generate usable kdump initramfs even target is not mounted
- Use get_mount_info to replace findmnt calls
- kdump-lib.sh: add fstab failback helper for getting mount info
- Allow calling mkdumprd from kdumpctl even if targat not mounted
- Add a is_mounted helper
- Introduce get_kdump_mntpoint_from_target and fix duplicated /
- Doc: Improves the early-kdump-howto.txt document in several points
- Doc: Add --force option to step 2 in early-kdump-howto.txt
- Doc: Fix typo in early-kdump-howto.txt
- Remove adjust_bind_mount_path call
- No longer treat atomic/silverblue specially
- mkdumprd: Simplify handling of user specified target
- mkdumprd: Use get_save_path instead of parsing config
- Remove is_dump_target_configured
- Always use get_save_path to get the 'path' option
- kdump-lib: Don't abuse echo, and clean up
- mkdumprd: Fix dracut args parsing
- mkdumprd: simplify dracut args parsing- dracut-module-setup.sh: improve get_alias()
- fadump: update fadump-howto.txt with some troubleshooting help
- Append both nofail and x-systemd.before to kdump mount target
- Partially Revert "Don't mount the dump target unless needed"
- Don't unmount the dump target just after saving vmcore- makedumpfile: Avoid false-positive failure in mem_seciton validation- mkdumprd: Use makedumpfile --check-params option- makedumpfile update to latest- makedumpfile rebase to 1.6.7- kexec-tools/module-setup: Ensure eth devices get IP address for VLAN- Add document to declare FCoE support- powerpc: enable the scripts to capture dump on POWERNV platform- s390: Use get_kaslr_offset_general() for s390x- arm64: kdump: deal with a lot of resource entries in /proc/iomem
- arm64: kexec: allocate memory space avoiding reserved regions
- kexec: add variant helper functions for handling memory regions- makedumpfile: assign bitmap1/2 fd for subprocess in non-cyclic mode- makedumpfile: remove -lebl- makedumpfile: Fix off-by-one issue in exclude_nodata_pages()-rhel-8.2.0, origin/rhel-8.2.0) Increase SECTION_MAP_LAST_BIT to 4
- spec: move binaries from /sbin to /usr/sbin
- As /etc/kdump.conf timestamp is updated do not compare it when doing rpm --verify
- kdumpctl: make reload fail proof- Don't execute final_action if failure_action terminates the system
- module-setup: re-fix 99kdumpbase network dependency
- kdumpctl: bail out immediately if host key verification failed
- kdumpctl: echo msg when waiting for connection
- kdumpctl: distinguish the failed reason of ssh
- kdumpctl: wait a while for network ready if dump target i�x�������������X�������Xz��(
�������� Lq'�$a����������������q'r'p'�sed.
- Add support for ioctl's DM_UEVENT_GENERATED_FLAG.
- Allow incomplete mirror restore in lvconvert --repair upon insufficient space.
- Do not reset position in metadata ring buffer on vgrename and vgcfgrestore.
- Allow VGs with active LVs to be renamed.
- Only pass visible LVs to tools in cmdline VG name/tag expansions without -a.
- Use C locale and mlockall in clvmd and dmeventd.
- Mask LCK_HOLD in cluster VG locks for upgrade compatibility with older clvmd.
- Add activation/polling_interval to lvm.conf as --interval default.
- Don't ignore error if resuming any LV fails when resuming groups of LVs.
- Skip closing persistent filter cache file if open failed.
- Permit mimage LVs to be striped in lvcreate, lvresize and lvconvert.
- Fix pvmove allocation to take existing parallel stripes into account.
- Fix incorrect removal of symlinks after LV deactivation fails.
- Fix is_partitioned_dev not to attempt to reopen device.
- Fix another thread race in clvmd.
- Improve vg_validate to detect some loops in lists.
- Change most remaining log_error WARNING messages to log_warn.
- Always use blocking lock for VGs and orphan locks.
- Allocate all memory for segments from private VG mempool.
- Optimise searching PV segments for seeking the most recently-added.
- Remove duplicated vg_validate checks when parsing cached metadata.
- Use hash table of LVs to speed up parsing of text metadata with many LVs.
- Fix two vg_validate messages, adding whitespace and parentheses.
- When dmeventd is not forking because of -d flag, don't kill parent process.
- Fix dso resource leak in error path of dmeventd.
- Fix --alloc contiguous policy only to allocate one set of parallel areas.
- Do not allow {vg|lv}change --ignoremonitoring if on clustered VG.
- Add ability to create mirrored logs for mirror LVs.
- Fix clvmd cluster propagation of dmeventd monitoring mode.
- Allow ALLOC_ANYWHERE to split contiguous areas.
- Add some assertions to allocation code.
- Introduce pv_area_used into allocation algorithm and add debug messages.
- Add activation/monitoring to lvm.conf.
- Add --monitor and --ignoremonitoring to lvcreate.
- Don't allow resizing of internal logical volumes.
- Fix libdevmapper-event pkgconfig version string to match libdevmapper.
- Avoid scanning all pvs in the system if operating on a device with mdas.
- Disable long living process flag in lvm2app library.
- Fix pvcreate device md filter check.
- Suppress repeated errors about the same missing PV uuids.
- Bypass full device scans when using internally-cached VG metadata.
- Only do one full device scan during each read of text format metadata.
- Look up missing PVs by uuid not dev_name in pvs to avoid invalid stat.- Rewrite clvmd init script.
- Add default alternative to mlockall using mlock to reduce pinned memory size.
- Add use_mlockall and mlock_filter to activation section of lvm.conf.
- Handle misaligned devices that report alignment_offset of -1.
- Extend core allocation code in preparation for mirrored log areas.
- No longer fall back to looking up active devices by name if uuid not found.
- Don't touch /dev in vgmknodes if activation is disabled.
- Add --showkeys parameter description to dmsetup man page.
- Add --help option as synonym for help command.
- Add lvm2app functions lvm_{vg|lv}_{get|add|remove}_tag() functions.
- Refactor snapshot-merge deptree and device removal to support info-by-uuid.- Change spec file to support excluding cluster components from the build.- Add %ORIGIN support to lv{create,extend,reduce,resize} --extents.
- Accept a list of LVs with 'lvconvert --merge @tag' using process_each_lv.
- Remove false "failed to find tree node" error when activating merging origin.
- Exit with success when lvconvert --repair --use-policies performs no action.
- Avoid unnecessary second resync when adding mimage to core-logged mirror.
- Make clvmd -V return status zero.
- Fix cmirrord segfault in clog_cpg list processing when converting mirror log.
- Deactivate temporary pvmove mirror cluster-wide when activating it fails.
- Add missing�x�������������������X{��(
��	81������0X�$ ����������������0X0Y/X��x�������������H��������X|��(
�A������0)��������$b��������������������kdumpkdump.confpost.dpre.dmakedumpfile.conf.samplekdumpkdumpctl.build-id0a6eb0eb547817de6ae22f8d104990ad0436aaec0fd48a14e8929e2d42c098120deebc7d3cb5d4fbaedd825531f744c7fcb3e0d31695b4940a61d815c2ddea637dc46e756cc88db78504e6fc8e51153299earlykdumpearly-kdump.shmodule-setup.sh99kdumpbasekdump-capture.servicekdump-emergency.servicekdump-emergency.targetkdump-error-handler.servicekdump-error-handler.shkdump.shmodule-setup.shmonitor_dd_progresskdumpkdump-lib-initramfs.shkdump-lib.shkdump-logger.sh60-kdump.installkdump-dep-generator.shkdump.servicekdump-udev-throttlerrules.d98-kexec.ruleseppic_makedumpfile.sokexecmakedumpfilemkdumprdmkfadumprdvmcore-dmesgkexec-toolsNewsTODOearly-kdump-howto.txtfadump-howto.txtkdump-in-cluster-environment.txtkexec-kdump-howto.txtlive-image-kdump-howto.txtsupported-kdump-targets.txtkdumpkexec-toolsCOPYINGmakedumpfileeppic_scriptsREADMEap_messages_3_10_to_4_8.cdir_names_3_10_to_3_13.cdir_names_3_14_to_4_8.ckeyring_3_10_to_4_3.ckeyring_4_4_to_4_8.cproc_names_3_10_to_4_8.ctcp_sk_buf_3_10_to_4_8.cudp_sk_buf_3_10_to_4_8.cunix_sk_buff_3_10_to_4_8.cvhost_net_buffers_3_10_to_3_18.cvhost_net_buffers_3_19_to_4_8.cvhost_scsi_buffers_3_10_to_4_8.ckdump.conf.5.gzmakedumpfile.conf.5.gzkdumpctl.8.gzkexec.8.gzmakedumpfile.8.gzmkdumprd.8.gzvmcore-dmesg.8.gzcrashkdump/etc//etc/kdump//etc/sysconfig//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/0a//usr/lib/.build-id/0f//usr/lib/.build-id/ae//usr/lib/.build-id/c2//usr/lib/dracut/modules.d//usr/lib/dracut/modules.d/99earlykdump//usr/lib/dracut/modules.d/99kdumpbase//usr/lib/kdump//usr/lib/kernel/install.d//usr/lib/systemd/system-generators//usr/lib/systemd/system//usr/lib/udev//usr/lib/udev/rules.d//usr/lib64//usr/sbin//usr/share/doc//usr/share/doc/kexec-tools//usr/share//usr/share/licenses//usr/share/licenses/kexec-tools//usr/share/makedumpfile//usr/share/makedumpfile/eppic_scripts//usr/share/man/man5//usr/share/man/man8//var//var/lib/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu		





directoryASCII textBourne-Again shell script, ASCII text executablePOSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=aedd825531f744c7fcb3e0d31695b4940a61d815, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0fd48a14e8929e2d42c098120deebc7d3cb5d4fb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0a6eb0eb547817de6ae22f8d104990ad0436aaec, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c2ddea637dc46e756cc88db78504e6fc8e511532, strippedC source, ASCII texttroff or preproces�x����������������������X}�(
��������������y��$i����������������y�x�z��file (RhBug:1786335,1786316)- Update to 4.2.21
- Running with tsflags=test doesn't update log files
- Allow disabling individual aliases config files (RhBug:1680566)
- List arguments: only first empty value is used (RhBug:1788154)
- Report missing profiles or default as broken module (RhBug:1790967)
- Format history table to use actual terminal width (RhBug:1786316)
- Handle custom exceptions from libdnf
- Fix _skipped_packages to return only skipped (RhBug:1774617)
- Add setter for tsi.reason
- Add new hook for commands: Run_resolved
- Clean also .yaml repository metadata
- Use WantedBy=timers.target for all dnf timers (RhBug:1798475)
- Fix completion helper if solv files not in roon cache (RhBug:1714376)
- Add bash completion for 'dnf module' (RhBug:1565614)
- Check command no longer reports  missing %pre and %post deps (RhBug:1543449)
- Check if arguments can be encoded in 'utf-8'
- Fix crash with "dnf -d 6 repolist" (RhBug:1812682)
- Do not print the first empty line for repoinfo
- Redirect logger and repo download progress when --verbose
- Respect repo priority when listing packages (RhBug:1800342)
- Remove misleading green color from the "broken dependencies" lines (RhBug:1814192)
- [repoquery] Fix rich deps matching by using provide expansion from libdnf (RhBug:1534123)
- [repoquery] Do not protect running kernel for --unsafisfied (RhBug:1750745)
- [doc] Document the retries config option only works for packages (RhBug:1783041)
- [doc] repoquery --what* with  multiple arguments (RhBug:1790262)
- [doc] Remove incorrect information about includepkgs (RhBug:1813460)
- [doc] Document that list and info commands respect repo priority
- [doc] Document color options- Sort packages in transaction output by nevra (RhBug:1773436)
- Add support of commandline packages by repoquery (RhBug:1784148)
- [doc] Document that the include option was removed (RhBug:1786072)
- New API function for setting loggers (RhBug:1788212)- [translations] Update translations from zanata (RhBug:1754959)- Fix alias processing with '\' escaping (RhBug:1680482)
- [doc] Explain the backslash notation also near the example (RhBug:1680482)
- Better descriptions for infinite aliases recursion (RhBug:1680488)
- Improve help for 'dnf module' command (RhBug:1758447)
- Unify downgrade exit codes with upgrade (RhBug:1759847)
- Honor priority with check-update (RhBug:1769466)
- Add shell restriction with local packages (RhBug:1773483)
- Restore functionality of remove --oldinstallonly (RhBug:1774670)- Do a substitution of variables in repo_id (RhBug:1748841)
- Respect order of config files in aliases.d (RhBug:1680489)
- [doc] Remove note about user-agent whitelist (RhBug:1777255)
- Fix detection of the latest module (RhBug:1781769)- Update to 4.2.17
- Enable versionlock for check-update command (RhBug:1750620)
- Add error message when no active modules matched (RhBug:1696204)
- Log mirror failures as warning when repo load fails (RhBug:1713627)
- dnf-automatic: Change all systemd timers to a fixed time of day (RhBug:1754609)
- DNF can use config from the remote location (RhBug:1721091)
- [doc] update reference to plugin documentation (RhBug:1706386)
- [yum compatibility] Report all packages in repoinfo
- [doc] Add definition of active/inactive module stream
- repoquery: Add a switch to disable modular excludes
- Report more informative messages when no match for argument (RhBug:1709563)
- [doc] Add description of excludes in dnf
- Report more descriptive message when removed package is excluded
- Add module repoquery command
- Fix assumptions about ARMv8 and the way the rpm features work (RhBug:1691430)
- Add Requires information into module info commands
- Enhance inheritance of transaction reasons (RhBug:1672618,1769788)- Update to 4.2.16
- Fix downloading local packages into destdir (RhBug:1727137)
- Report skipped packages with identical nevra only once (RhBug:1643109)
- Restore functionality of dnf remove --duplicates (RhBug:1674296)
- Improve API documentation
- Document NEVRA parsing in the man page
- Do not wrap output �x�������������(��������X~Ϝ(
��X��������!�$�����������������!�!�!�	directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e0b12d7ea2fd7cae12140a00da756abe0c14597f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2622685f0db1f52fc83bfea6f0f78f27bafb41e, strippedPerl5 module source textUTF-8 Unicode textASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)HTML document, UTF-8 Unicode textPerl5 module source, ASCII text!"#$�x��������������x�������X��(
��
p�������u!�$e����������������u!t!v!�z)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.3he@c���ama�`�9@_��@_ܙ�_��@\	@[�<@[�]�[CN@[��Z��@ZԐ@Z��@Z}�@Zy��Zs@Zo�Zc/@Z\��ZT��Y��Y��Y��Y���Y|x�Yy�YS�@YG��Y6�@Y0�X�D�X��@X��X��@X��X���X|��Xwo�Xo��XW�X@�X#�X&�W�i�W��@W��W�P�W��W��W~D@W~D@WzO�Wm �Wj}�Wg�Wb��W_�W=��W<Y@W3�W'A@W�@V�@V�x�V��V�=@Vp�Vn�@V&,�V�@V�@Uĝ�U���U��@U��U���U���Ux&�Up=�Un�@UlI@U.R�U/@U/@U�@U
�@U�T�s@T�~�T�-@T��Tܕ�Tи@T�7�T|X@Tl�@Td�@TcK�TP�TH�T&@T�T=@TH�S��S�@S�S׌�S�\�S��S���SF��S>��R�R��@R�a@R�&�R�&�R�@R�v@Rfh�R-�@R
�Q��Q��@Q��Q�@Qک�Q�c�Q��Q��Q�b�Q�@Q�y�Q�?@Q��Q��Q��@Qzl@QeT@Qd�Q^��Q^��QP<@QLG�QJ�@QHS@QC
@QA��Q5�@Q"�Q�Q�Q�@Q�Q�@Q�@Q��Q	@Q	@Q��Qs�P��@P�P�@P�Z�P�Z�P��@P��P~��P`K@P\V�P[@PXb@PS@PPy@PO'�PG>�P7l�P(�@P#�@P#�@P	H@P
�O�@O�O�R�OЗ�O�F@O�F@OȮ�OȮ�O�]@O�t@O���O�~�O��@O�@O� �OC�@O/��O(@O�@O�@N�x�N�N��@N�1�N��@N�=@N�H�N��@N�0�N�S@N�
@N�$@N��@N��@N���N���N��@Ny�Nq�NoE�N\�NG��N;�@N2��N.�@N)f@N%q�N!}@N��Np�N*�N��M�6@M�6@M�6@M��@M���M���M�M�M�M�)�M��M��@M��@M��@M��@MT�M_��MQ0@MA^@M@�M@�M>�@M=i�M�M�L�L�7�L��@L��@L��@L�d�L�@L��@L��@L�{�L�A@L�)@L�)@L�)@L�)@Lk�@LMx�L>�@L9�@L7@L5��L(��L�K��K�.�Kы�KŮ@KŮ@K�"@K�r�K�!@K��@K��@K��@K��Kl@K0��K/c@K+n�K+n�K�@K�@K�@K�@KV�K@K��K�Ję�Ję�J��@J�u@J���J��@Jr�Jn�@Jm��Jj�JW-@JS8�JS8�J,�@J'�@J&e�I�4�I�@@I�@@I̿�I��@I�y�I���I���I�V@I��@I�U@I�U@I�w�I�1�Itk@IO�@IBR@I/�@I*�@Ig@H��H�O@H�f@H�f@H��@Hϟ�H�@H��H�@�H���H�z@Hu��Ht�@Hl�@Hj@Hd�@H`�HO�@HNl�HI&�H:�@H5`@H1k�H.�G߮�G߮�G߮�G߮�G߮�G��G��G��G�.@G�.@G�.@G�.@G�.@G��@G��G�f�G�f�G��G��@G�e�GN��Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-423Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-422Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-421Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-420Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-419Petr Pisar <ppisar@redhat.com> - 4:5.26.3-418Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-417Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-416Petr Pisar <ppisar@redhat.com> - 4:5.26.2-415Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-414Petr Pisar <ppisar@redhat.com> - 4:5.26.2-413Petr Pisar <ppisar@redhat.com> - 4:5.26.2-412Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-411Petr Pisar <ppisar@redhat.com> - 4:5.26.2-410Florian Weimer <fweimer@redhat.com> - 4:5.26.1-409Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.1-408Petr Pisar <ppisar@redhat.com> - 4:5.26.1-407Petr Pisar <ppisar@redhat.com> - 4:5.26.1-406Petr Pisar <ppisar@redhat.com> - 4:5.26.1-405Björn Esser <besser82@fedoraproject.org> - 4:5.26.1-404Petr Pisar <ppisar@redhat.com> - 4:5.26.1-403Petr Pisar <ppisar@redhat.com> - 4:5.26.1-402Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-401Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-400Petr Pisar <ppisar@redhat.com> - 4:5.26.0-399Petr Pisar <ppisar@redhat.com> - 4:5.26.0-398Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.0-397Fedora Release Engineering <releng@fedoraproject.org> - 4:5.26.0-396Petr Pisar <ppisar@redhat.com> - 4:5.26.0-395Petr Pisar <ppisar@redhat.com> - 4:5.26.0-394Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-393Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-392Petr Pisar <ppisar@redhat.com> - 4:5.24.1-391Petr Pisar <ppisar@redhat.com> - 4:5.24.1-390Petr Pisar <ppisar@redhat.com> - 4:5.24.1-389Petr Pisar <ppisar@redhat.com> - 4:5.24.1-388Petr Pisar <ppisar@redhat.com> - 4:5.24.1-387Petr Pisar <ppisar@redhat.com> - 4:5.24.1-386Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.1-385Igor Gnatenko <ignatenko@redhat.com> - 4:5.24.0-384Petr Pisar <ppisar@redhat.com> - 4:5.24.0-383Petr Pisar <ppisar@redhat.com> - 4:5.24.0-382Petr Pisar <ppisar@redhat.com> - 4:5.24.0-381Petr Pisar <ppisar@redhat.com> - 4:5.24.0-380Petr Pisar <ppisar@redhat.com> - 4:5.24.0-379Petr Pisar <ppisar@redhat.com> - 4:5.24.0-378Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-377Petr Pisar <ppisar@redhat.com> - 4:5.24.0-376Petr Pisar �x�������������h�������X��(
�	�������bX�$r����������������bXaXcX�eufafifrgaglguhehihrhuiaidiloisitjakakkkmknkoltlvmaimkmlmrmsnbndsnenlnnnsoorpaplptptrorusiskslsqsrsr@latinsvtatetgthtrukurvizhzhzu2.9-26.el8_102.9-26.el8_102.9-26.el8_102.0.61-2	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkklllllllllllllmnnooooooooooooosestatus.confseconsemodule_expandsemodule_linksemodule_packagesemodule_unpackage.build-id344352788b234c87a220c8f2ee19e03ff36c88347d9c125ed18fd9bd011e4eb08fd906bbabc7f53e6b8b29beb9a9cc689a1ca6ee006401056c99823f996c930d2f96d497a06b94ff3c5e75d372d7a150cb817d94efdc45a4ce57ee07b7556248356328619d297b56e297ccb0ef334af02898a844e46d246e359d2b9f27e4085fe8dd88866d17572f4b454472fde2aa98926b7bf93f63e747af9666d4dee9c8ae7e2784ab0ed6ceab9cd814959316751f043647b8599377a36e3808e46d82101db19e68ad8a78bae02ff9762ff3506eaed795eea435fe32d18c2da2ee08bf55f4e16f0a193078635793a073d975af04selinux-autorelabel-generator.shselinux-autorelabel-mark.serviceselinux-autorelabel.serviceselinux-autorelabel.targethllppselinux-autorelabelfixfilesgenhomedirconload_policyrestoreconrestorecon_xattrsemodulesestatussetfilessetseboolbash-completionsetseboolpolicycoreutilspolicycoreutilsCOPYINGpolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mopolicycoreutils.mosecon.1.gzselinux_config.5.gzsestatus.conf.5.gzfixfiles.8.gzgenhomedircon.8.gzload_policy.8.gzrestorecon.8.gzrestorecon_xattr.8.gzsemodule.8.gzsemodule_expand.8.gzsemodule_link.8.gzsemodule_package.8.gzsemodule_unpackage.8.gzsestatus.8.gzsetfiles.8.gzsetsebool.8.gzsecon.1.gzselinux_config.5.gzsestatus.conf.5.gzfixfiles.8.gzgenhomedircon.8.gzload_policy.8.gzrestorecon.8.gzrestorecon_xattr.8.gzsemodule.8.gzsemodule_expand.8.gzsemodule_link.8.gzsemodule_package.8.gzsemodule_unpackage.8.gzsestatus.8.gzsetfiles.8.gzsetsebool.8.gz/etc//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/34//usr/lib/.build-id/3e//usr�x��������������W�������X�ޜ(
;�r������M��$]����������������M�N�L��93aa5ef38dd09061c905617f2224e2a9a76b9390613ccd94c05bdc36fe3db99045367d4d4aafde70e4ccfd0b4b87a44baa6bd8e0469a084dd94c7d02b91894c4751c7d4bbe34b959c9542c5999b98e0063ce6907debe2def269d5d671d27f270dd50bf2079b605745189b8ca179628797916707f3cabc5a7f916edb9f9fe3fb5ab0fb157c7e7ce363cb1b3870a56e143f1c5cadf55ab35a697eeb75eaa70ee5357b004eea1075c2472e8a17be5f6511c869ded63ce7d43d253b9fbfe65301fb3b66f014d75e8baf87d6b881c96e20be097045ec732c90a900defb195c46e27caf395a01ef11db2cdf87622e40e88adfa543e0fd8734653e0f961a9d1cbe967c42dc9f8e3521d2b86ac60ef3a89ca0109d91d2a32970f5b6e3608dcbe9f7989d022d6db56ec70aa4e8141fa0a3e894a3a523d3de13e92514357936e365d020e9cf48b080e221573bc3f8d961409489cf26f398bef6bed2636d979fc93996656ea6c167ae7061140f3c7202a556cd54e8fdcc39f873398911bcc612461a65883228b860e27848cb7fe2f34dbf8661583203df573a2bb638885128b6cced51ff3c4b0408f947029442943a46b4c28a2ac37d1d2222314056c1335fb35d44f8ebed3a495ca01d3a6341d2df736c02389ef5b48ad21844d01ed73921b8abb013ae9309192bdf66d2aa1c03e2d27aa1b6a0cf766d2f4db2958686865e84f5ba4c7607a248572dad03436d7081aeb0cf08a3ae26246b860bc2ed3412981baac7f97aa85859b62e37ed8958b414ed8cf056314a887e79d967b8868952068ea2bef7cdca731d7ec33320e837b94e114e225619156cdaea05ed03ea0d4a2b14f15e03dffa64c09c0d36c877ffea7f5021e0b61b2e8c7d3b7c14db78239a3b27098c84588713de66694c170e44fec8cefbc10d1b656cbb08a8cec7ae4a98ed3e347a002d1e4040050237b2fb60d09994f668f119673fb89986ec62e561937ecf28d28ffef9df185832be9935c7b6ddebcc2abbad02139d4df99370b5b6536e7b20b8d6bc7f4ea6e7b5e48848238f3334e831f5eafc13778fe5af6d695561b00614512d6f2d9fed6f14b326f18bfe21ab9a59715c441fe9fbd1c2c8603214c1bc490720573bbabde592df5e491f11eb14e479b06c5105b79a79a1e3d13759e3efd177c9dd3eb67f60aece36e5091c3090dc4447047bd6569fef7fde871ab92e526ec91c1448196e657ddfa50d41c50cdb33e96198d1545757a764b8902fea9348789d62ec0ee6489bcf02bd252c7f834c3059fb593096cc7553b0755c94741aa604817db3584dbed93fa9c6c808f61fd53e004077ab8f686cc402dfcba035dc33704cb20fea27e78186a62e2f6a727e38b325b095d199c519397d8385b07c0bb7dd92ee15331bd5e581dd56dff3e2fb71e68321532a75ce24118e6f471da3c64ec421477116420a6aad6e228f16b26aca2dc76d0ee621d475a4c24d12269ded0316ce73ab138b47192c724dacae4a4aab628a342913bbecaa6fd83f086626c3b1c0b5bf274b66b14ab41086ab729a55e0d5263f3926eab44ec800354c0e271cbdc8ca7ae17f02169d76a164e59a7c1c9d1a5d680260603f7cc1a1e7528138a6228bda9cae32f3635a19c005c18284eecdba488e91d05c397925225e22ea90428f2858c867792bf589a025e0cc9e627a94cb39db643c8331bb9add131e36c8b484e4516faebc92c233bbc1b712e0084a97357d39b506eda8b01d6ff69d29bd115a83aa6df9cfb3498a9bd36a01931e726839a75e7f28349fd438c59ee7bc2929dc49e579aa628008dc94d4a07379e1c2ba143cd975cddd5b74b4007c8ff68fee5e3f3e40485f6f346d5bf3e627c8cdbb03516727def4d0116b2b811fd5622b40b97ad7ee2ed7681fb70806bf5039f9801e5299dc47165709e539dfee0e836fdeae456fe6f3165028a27d743ff744982f2172fc818e9ff12f94df9c1ae05b53990dceb51635ac3f4624c1c160fdc4723baf4070745bd5ec60a89de30b759ab04d8d012429a32a29b04a8b8381c5f1ed1caed718c76cd8d09e4c32f20cb3df5c3d0c6fc041f251606a288630f6a0432f39ffaa8b357df027cd75cbdb55e34b2ab3a57f518f9b12441159897c3e6bb185871c8a731c5e215bfc9f212d3afbb0dc39c4286fcc18d23afaa7c144c3ca09aabd864bd0628fe42112eb0df8b6ed9313b1f7f738cd360e827afb83883cf805a3017c1366cb8ee71c96b61cc56937153f628bcb7c3eeab19031d68ca11482e2d8815d0139426713acb8a24d9ffc68599934e7d13fa3bc4786fd6bb1604c8962ed6b97e7550456b8164579234c4e84224f24857961c20cac6689824dc08b3ffbf128b04bade8a6a373119d4c48e7860c6e03bddae68fc0654ec594f9e6ca28bf6cf02127178394a98f95109632e42bc5bd7783bbd6d7a52c8d3436f63335d953a559d5bbc70194d7fa2b764c68c361168c8e777b55484dbdabc19ca72c979bd8026c53ae2fb61261e0235702b743691f735a6ad4de208907a177d60a4988ceeabc71e199bbe7ba2ee4491342f6939b50d728a80650ecdc4025e8e18a864273e776b7eeadda82df51ce18d7ad3a92a4e4043065832519ebc687a30bc8a977fada6397b10dd06d9ff7f30b5d5ed4097d58bf288af30f7a5cf78bda2409beb60616e52f1429c857e8778b4a7ae4b30070399f44d699a0c979d738a8d70c1a512758dd93f60a8a9d142f70190d8e4e9b3bb63997c16908c958cc20d2e523ca1c23c2ba0e03d4942edccefb8c0c67b2e86323339d9e4bc3328990bc6f8f09ea9�x�������������G�������X��(
�������������$�����������������������254879) (Jaroslav Mracek)
- po: update translations (Igor Gnatenko)
- po: migrate to zanata python client and trivial fixes in build (Igor
  Gnatenko)
- po: include all possible languages from zanata (Igor Gnatenko)
- po: include comments for translations (Igor Gnatenko)
- shell: catch exceptions from depsolving (Michal Luscon)
- shell: update documentation (Michal Luscon)
- shell: add transaction reset cmd (Michal Luscon)
- shell: add transaction resolve cmd (Michal Luscon)
- shell: provide rewritable demands for cmds (Michal Luscon)
- shell: catch tracebacks from shlex (Michal Luscon)
- shell: handle ctrl+D more gracefully (Michal Luscon)
- groups: set demands in configure instead of run (Michal Luscon)
- shell: implement config cmd (Michal Luscon)
- shell: add help (Michal Luscon)
- shell: make alias repo list -> repolist (Michal Luscon)
- shell: catch exceptions from do_transaction (Michal Luscon)
- shell: resolve transaction in ts run (Michal Luscon)
- shell: add default value for internal methods argument (Michal Luscon)
- shell: create run alias for ts run (Michal Luscon)
- shell: add ts list cmd (Michal Luscon)
- shell: refill sack after every successful repo cmd (Michal Luscon)
- shell: allow running multiple transaction in one session (Michal Luscon)
- shell: add ts command (Michal Luscon)
- shell: catch cmd parsing and run exceptions (Michal Luscon)
- shell: allow to run scripts (Michal Luscon)
- shell: add repo cmd (Michal Luscon)
- shell: add resolving + transaction run support (Michal Luscon)
- shell: implement quit method (Michal Luscon)
- shell: add custom cmds stubs (Michal Luscon)
- shell: implement basic logic (Michal Luscon)
- shell: register new cmd (Michal Luscon)- tests: catch ModuleNotFoundError as well (Igor Gnatenko)
- Switch out automatic service for automatic-download and automatic-install
  (Pat Riehecky)
- Make upgrade-to alias for upgrade (RhBug:1327999) (Jaroslav Mracek)
- skip appending an empty option (RhBug: 1400081) (Michael Mraka)
- Add description of nevra foems for commands and autoremove args (Jaroslav
  Mracek)
- Add support of arguments nevra forms for autoremove command (Jaroslav Mracek)
- Add nevra forms for remove command (Jaroslav Mracek)
- Add nevra forms for install command (Jaroslav Mracek)
- add bin/yum into .gitignore (Michal Luscon)
- clean: acquire all locks before cleaning (RhBug:1293782) (Michal Luscon)
- Change hawkey version requirement (Jaroslav Mracek)
- Add information for translators (RhBug:1386078) (Jaroslav Mracek)
- Change info to warning for clean repoquery output (RhBug:1358245) (Jaroslav
  Mracek)
- Add description of pkg flag for Query (RhBug:1243393) (Jaroslav Mracek)
- Add minor changes in documentation (Jaroslav Mracek)
- Do not always overwrite the name with the repo ID (Neal Gompa)- See http://dnf.readthedocs.io/en/latest/release_notes.html- See http://dnf.readthedocs.io/en/latest/release_notes.html- Obsolete dnf-langpacks
- Backport patch for dnf repolist disabled- Update to 1.1.10- Fix typo- Also change shebang for %{?system_python_abi} in %{_bindir}/dnf- Add %{?system_python_abi}- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Revert "group: treat mandatory pkgs as mandatory if strict=true" (RhBug:1337731)
- enforce-api: reflect changes from #992475 in completion_helper (RhBug:1338504)
- enforce-api: add compatibility methods for renamed counterparts (RhBug:1338564)- doc: release notes 1.1.9 (Igor Gnatenko)
- spec: correctly set up requirements for python subpkg (Igor Gnatenko)
- spec: follow new packaging guidelines & make compatible with el7 (Igor
  Gnatenko)
- zanata update (Jan Silhan)
- enforce-api: add missing bits of Base class (Michal Luscon)
- help: unify help msg strings (Michal Luscon)
- enforce-api: decorate Base class (Michal Luscon)
- util: add decorator informing users of nonapi functions (Michal Luscon)
- Added description for 'autoremove' in dnf help (RhBug:1324086) (Abhijeet
  Kasurde)
- i18n: fixup for 0db13feed (Michal Luscon)
- i18n: use fallback mode if�x�����Ћ������P6�������X���(
0��D������2��$"����������������2�3�1��99)
- Remove bundled perl-B-Debug (bug #1142952)
- Remove bundled perl-ExtUtils-CBuilder (bug #1144033)
- Remove bundled perl-ExtUtils-Install (bug #1144068)- Move all Module-CoreList files into perl-Module-CoreList
- Sub-package corelist(1) into perl-Module-CoreList-tools (bug #1142757)
- Remove bundled perl-Module-CoreList, and perl-Module-CoreList-tools
  (bug #1142757)
- Sub-package Devel-PPPort (bug #1143999)
- Sub-package B-Debug (bug #1142952)
- Use native version for perl-ExtUtils-CBuilder
- Specify all dependencies for perl-ExtUtils-Install (bug #1144068)
- Require perl-ExtUtils-ParseXS by perl-ExtUtils-MakeMaker because of xsubpp- Provide 5.20.0 MODULE_COMPAT- 5.20.1 bump (see <http://search.cpan.org/dist/perl-5.20.1/pod/perldelta.pod>
  for release notes)
- Sub-package perl-ExtUtils-Miniperl (bug #1141222)- Specify all dependencies for perl-CPAN (bug #1090112)
- Disable non-core modules at perl-CPAN when bootstrapping
- Remove bundled perl-CPAN (bug #1090112)- Stop providing old perl(MODULE_COMPAT_5.18.*)- Update to Perl 5.20.0
- Clean patches, not needed with new version
- Update patches to work with new version
- Update version of sub-packages, remove the deleted sub-packages
- Sub-package perl-IO-Socket-IP, perl-experimental
- Disable BR perl(local::lib) for cpan tool when bootstraping- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Declare dependencies for cpan tool (bug #1122498)
- Use stronger algorithm needed for FIPS in t/op/crypt.t (bug #1128032)
- Make *DBM_File desctructors thread-safe (bug #1107543)- Sub-package perl-Term-ANSIColor and remove it (bug #1121924)- Remove bundled perl-App-a2p, perl-App-find2perl, perl-App-s2p, and
  perl-Package-Constants
- Correct perl-App-s2p license to ((GPL+ or Artistic) and App-s2p)- Sub-package perl-App-find2perl (bug #1111196)
- Sub-package perl-App-a2p (bug #1111232)
- Sub-package perl-App-s2p (bug #1111242)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Pass -fwrapv to stricter GCC 4.9 (bug #1082957)- Fix t/comp/parser.t not to load system modules (bug #1084399)- Move macro files into %{_rpmconfigdir}/macros.d- Provide perl(CPAN::Meta::Requirements) with six decimal places- Drop perl-Test-Simple-tests package is it is not delivered by dual-lived
  version
- Hide dual-lived perl-Object-Accessor- Use a macro to cover all 64-bit PowerPC architectures (bug #1052709)- Use upstream patch to fix a test failure in perl5db.t when TERM=vt100- 5.18.2 bump (see <http://search.cpan.org/dist/perl-5.18.2/pod/perldelta.pod>
  for release notes)- Document Math::BigInt::CalcEmu requires Math::BigInt (bug #959096)- perl_default_filter macro does not need to filter private libraries from
  provides (bug #1020809)
- perl_default_filter anchors the filter regular expressions
- perl_default_filter appends the filters instead of redefining them- Fix rules for parsing numeric escapes in regexes (bug #978233)
- Fix crash with \&$glob_copy (bug #989486)
- Fix coreamp.t's rand test (bug #970567)
- Reap child in case where exception has been thrown (bug #988805)
- Fix using regexes with multiple code blocks (bug #982131)- 5.18.1 bump (see <http://search.cpan.org/dist/perl-5.18.1/pod/perldelta.pod>
  for release notes)
- Disable macro %{rebuild_from_scratch}
- Fix regex seqfault 5.18 regression (bug #989921)
- Fixed interpolating downgraded variables into upgraded (bug #970913)
- SvTRUE returns correct value (bug #967463)
- Fixed doc command in perl debugger (bug #967461)
- Fixed unaligned access in slab allocator (bug #964950)- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.16.*)- Perl 5.18 rebuild- Define SONAME for libperl.so and move the libary into standard path
- Link XS modules to libperl.so on Linux (bug #960048)- Do not load system Term::ReadLine::Gnu while running tests
- Disable ornaments on perl5db AutoTrace tests- Update to Perl 5.18.0
- Clean patches, not needed with new version- Edit local patch level before compilat�x��������������%�������X��(
��������X�l�$|����������������lkm�e)-use 1st matching utmp slot if search by mypid not found.
- update to 2.9o
- lastb wants bad logins in wtmp clone /var/run/btmp (#884)- if hwclock is to be compiled on sparc,
  it must actually work. Also, it should obsolete
  clock, otherwise it clashes.
- limit the swap size in mkswap for 2.2.1+ kernels
  by the actual maximum size kernel can handle.
- fix kbdrate on sparc, patch by J. S. Connell
  <ankh@canuck.gen.nz>- added pam_console back into pam.d/login- updated to 2.9i
- added hwclock for sparcs and alpha- added vigr to file list- auto rebuild in the new build environment (release 12)- remove most of the ifnarch arm stuff- added pam_console.so to /etc/pam.d/login- .perms patch to login to make it retain root in parent process
  for pam_close_session to work correctly- strip fdisk in buildroot correctly (#718)- have fdisk compiled on sparc and arm- added beos partition type to fdisk- incorporate fdisk on all arches- restore PAM functionality at end of login (Bug #201)- patch top build on the arm without PAM and related utilities, for now.
- build hwclock only on intel- upgraded to version 2.9- build for Raw Hide (slang-1.2.2)
- patch kbdrate wackiness so it builds with egcs- patched more to use termcap- added warning about alpha/bsd label starting cylinder- use sigsetjmp/siglongjmp in more rather then sig'less versions- explicit attrs for setuid/setgid programs- sln is now included in glibc- add cbm1581 floppy definitions (problem #787)- remove /etc/nologin at end of shutdown/halt.- add mount/losetup.- update to 2.8 with 2.8b clean up. hostid now defunct?- "more" now works properly on sparc- Fix "fdisk -l" fault on mounted cdrom. (prob #513)- translations modified for de, fr, tr- manhattan rebuild- more didn't suspend properly on glibc
- use proper tc*() calls rather then ioctl's- fixed a security problem in chfn and chsh accepting too 
  long gecos fields- removed "." from default path- added (again) the vipw patch- minor cleanups for glibc 2.1- added vfat32 filesystem type to list recognized by fdisk- don't build clock on the alpha 
- don't install chkdupexe- Update to new pam standard.
- BuildRoot.- added rootok and setproctitle patches
- updated pam config files for chfn and chsh- updated MCONFIG to automatically determine the architecture
- added glibc header hacks to fdisk code
- rdev is only available on the intel- update to util-linux 2.7, fixed login problems- Merged Red Hat changes into main util-linux source, updated package to
  development util-linux (nearly 2.7).- LOG_AUTH --> LOG_AUTHPRIV in login and shutdown- Moved to new pam and from pam.conf to pam.d- pam.patch differentiated between different kinds of bad logins.
  In particular, "user does not exist" and "bad password" were treated
  differently.  This was a minor security hole./bin/shejectrfkillutil-linux-ng�x�������������@�������X��(
 B�-������@������$P����������������@�A�?��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�����xZ��������������X���(
������������)X�$9����������������)X*X(X��x�������������P�����X��(
HY�������"s�$c����������������srt�y linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cbb1127ad5c32d0ebd416db5b6050bafed1bbef3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=81f48c27d66282a04dfe1be7fcabda2847a38dac, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b0acc07b4e7553291368912761ccd0cf8deb4d1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fa78e3ef0c2e1b2c11a566b32d7a09c944cb6ea2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=26f840aa8aaf351d6db02657710d4d67d0386521, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a3a3f7a633db84a38c2c31aa5026844ba19adb9d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=39151120aba86b79c44792da063cd5ba688e3dc5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=578197c089708b3416bc29fcd59d841c72ac308f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e9233b7b682b460975a18b93bafa64c32f9f9684, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=abc92ca53fff204b8c138db0c1875c9b5080b982, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=064260a6230beda04eb252db03555241020324f8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6f3972e436819a532462d5f62ad0816bca52af7e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4bfdf3b9a45c0228b0a2bfdd376e48b58b91f36c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a7a7d8e00e96d0d9230d12060035a1a78239c92b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cf9991e8f9318ae0a27cedd2c50d0050f6bf79b3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c6388d29e31b46dbebd8c97d43839130a7d68206, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d25b460efd4edd6e04d182126d575cccc7c4473b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=97fe06643ca18cf95b7a8d2d832d0d67c550d534, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9d98322b1766e1778b5246be23672ad96544052e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2f0b0a383360b8423522795127961534bdb060e2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, �x��������������������X���(
����������������#X�$3����������������#X$X"X�RRPRPRRPRRRutf-80b9dc27fb200763d9fb72e7af6b909d9f97c67e559e8b1adaad1f33e84d87a54?���0%#4�3!�^���P,��*����%�g��
	*����%�Yt�-�Ј��c,/y�R��[�X��p�jL��2�
c���M<1f
��ŏ�wf����UUI�w���ɭk�SbD^�d�f�}|�}��UNҴX�^����Ȥ͓%�7��(*�ґ����ӶJ�dHTF�o+=qU�;(E��Ԛ�^sSgx�7��q)@�"wMhaǨ�]�nj�,���YY�G��'�ߏS
Đ�_�b�̺�[y3r>e2
d�?3wGn�
��k{X���C�`_�]t����|�����&%Z� F|ڥ�~[}{jڇ1��g��b�Chg��6d?/f����*���[���MwO��a];���{m3����_���Ѣ�[v���0�
��V��og���\����זPo	�Y��Ս�AW��H�)o�*��Pp�r�9�~��B�~����K'�c�k������L��nb�9�[y�
�{҉$����If�"�X�]�c0���#TF�.�.�n�(�c?}���.<��,�2�������Ώ�:D��{Q�}M��C��m�ʉ3!�^���P,��*����%�g��
	*����%����|{���{�T�4L؂��2����/y�y��blW����x� z���e���[�Lw�
B�Ge��q�G��x���	L�@�y4���S�J^�Ú��UCIj�{��lA�c��,맮�4,+������X�ײc?��⾁�ma1P�;�P��9�4D�
#A}�'���ƴ�Ic��s�
|�e7�S��~���
`�1|�<���ϭƒ�֬���W�f�Y
Fҥ3����s������r��r�D=eci�P�w,���̠QϨ�,��RX����cj��մ�����wP�s�_�{ޖz(���#$��׶�
	�ԅ"$IX8�6��s�e|���^m�5�)��u���b�����a^����ۈ!��6�J�u����}�Ovm2;��Z��E�f����칬D�B�9�5�[l�Շ\��
�i��1��`�S��2�?�o�9���kY
�*-F)$�sB�|���j��'��́w]�8__{��ԥ������>�W���6oab73ddef86e70271bd39ee89a7dd1d7d7430da58747b85c8e19ddbe36b5f7c8e4ca8c09cda01facf4168f6d66f4ca3c224f18392gU��x�������������@�������X���(
�!����������$P��������������������52ef156dba2b38e6db3da04ccb371a2f38d05c189ecf078123269d5a2083ae2bc845e72a66568c542e6e9ad50f274a4ba9f9778b9a3884beab30ee8696b4e6e4878460c12b515fb87248e30a244dc7c50745eb749ed8391c806dcdbf03d5721650c13b2b6b43e788fbe3407076c243454d77dc1aad12d7664ffe29f7bd3abdc703f8877dbb08fdcbca85ce35f570620739b91c92bffd3e6c384fed3138bef283664abdb91e2a32911857a9ee24e27b41337a759fc5e9829199c7b329ec4ec15f2ded1bce85f87cf41d7160458cb6fb5b95e9a1ebbcfb1a5e1fc07d916de844cb6ba3e6efd063eecc3de86f6922424d9b0c5289d0859e5d75d8ee1efe5d18e258a11aca8d8b487185162119ed6719d44eae67087db2cc2515919656121d0891dbda42e9d2498e3f4ee5fab08c866666c1b1bd4e676b2ffa911de366375550e7cd60f399f4c8b5644421e6230e8d37669897b16fe318076e24377886f363ea8561d451e547054bb70c63ce6ee89cc985fdfd6d07bbe757cfa0cb7db86f30574ba6a5f0b8dfb8ee69bfe33aba5203d1979cf2ac3aca86f1f79437a3dea52855201617c576215c9e73b1c96fe1c78f92727098fa9eaec99fee492e07ab7b59a064ad89b33167502a5b9dd02a3ce3848082b8df5bbe02733d24e3dd8cf84f69a2c7adb0ae8e8459efe059ba5600aa5e587647d3d379e46b7ecdedba2e7245a216b90f544e847312f52cea48a82f518c1aa6edbdda2d91d9ba488cb916d80513c6b7eea1ca310ef1a6cb144fc8738863fc5e94aa33f254d45ffc3e74942d1d5424cff4b2edb71c8aeda0eef1b279e133555949b2144e66e5a433347e5cce8380fedad568995ddb82c42d9d397e29a47213f7aacd660c9c6ac13faa12a06a1e6f7b88669e30fa97e5031e43e0fba38e4b39a63b6be9880bcede610a080d7f0c174c15000699b3683afd9a6baa7e8832370791833f76fb8f328322aa46f8ac85b901ec672d85a8506f83f0a38342757b484dbbd95888b079a0f339a94393f5ae88c4c52bf7d65f6fc2abac8e3de90f303ae27c23a753b232d504333482b4c4a7cb8e1cc6f3766e89521f8a13884e023914d5ae7e4acd3c5afc2f7ba8e53a362b3958b26c066c8bca0010b203c16cd69cd21d95b39a1f0514a29e20a6b2edb622eeb345dd117f2a41524fbd533a3fa28b3891971160cdc887d948e1cfa5a1b3605da6d3b968da951437880cf4fa904b819d0c1d6aa5ca422e3b01ff14e5550a1a98fc0ccc9cfde179d7e2943ff7a883008d9319c1e3e70a5287ccfd12104a7d661e58f510ff5e993f5770b0dcc283ffaaff69c26bf92284a450027cf87fe4b4684d0de218de485e40dfdb47468c67724dd6718d517e8853b201c22abae10458f7899c0b063b11af21ed63dee750ce70867e919124244027d3059c02137e367f3ba784fc00872171bd948b9906fc8f943db5f6dd5d9ed93b8a20c7295bb17d69a942ab23ce73dff5ac0734daf9e0fa4a9c3ea2fef43a75dba9119b7095b9f378a245c63fd8830f86bf388c2bdb723b27c43ff2e7a2cc662b6788285750dc242e5effe7f2cc4ae98e2644d018c997618ab229ff608f12ebd0a953dbfb3f390157b8149c736720cc3fc23c5de1fee02a4ac68293fb89e191cdc2290632860baf0345b08536ca1b4d19a9857859d1e8f0238c26e93392080c65e25944787e085408f16c5c49b2df1103738de369cc98d879e2975ba78ac8f1715eb33787a2aae0468bc271bde3fce6ac4ed8491f061d0be9a587c4c08f4a5f233b82964d5f5051e1c33509411609982778a74d0862c6d54c49a655b21c8bc14cd529e305674b0ed1b4b8f4a3660ab7a7ac403dbb07d7e5d80688a1a842971e176b9b944b057f9fa92a3ed0d458e6d42f01790c741ff4869af851921cf71829d94f6845c5abdbafce59675a59be49625bf399e8721609ebc0880547f7f29a4fa43b2525b76357a2ff0dafa3ecf36cdf9d78f755479dbe5637a767755aa63393374ea549125e15833961c7fd505786b5f6ef2975fe2dd70d4c0306b0bc0ca55325bbc5a7287da72a4../../../../usr/bin/msgattrib../../../../usr/bin/recode-sr-latin../../../../usr/bin/msgexec../../../../usr/bin/msgunfmt../../../../usr/bin/msguniq../../../../usr/bin/msgen../../../../usr/bin/msgcomm../../../../usr/bin/msgcmp../../../../usr/bin/ngettext../../../../usr/bin/gettext../../../../usr/bin/msgfmt../../../../usr/lib64/gettext/urlget../../../../usr/lib64/gettext/hostname../../../../usr/bin/msgfilter../../../../usr/lib64/gettext/cldr-plurals../../../../usr/bin/msggrep../../../../usr/bin/envsubst../../../../usr/bin/msginit../../../../usr/bin/msgcat../../../../usr/bin/msgmerge../../../../usr/bin/msgconv../../../../usr/bin/xgettext�x���������������������X���(
��x���$[��������������������=4ea2eb1b5eafd4590247827e9bee85b22ecc2f3d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3f5368b93c48850b3784102c00e29ef0bd8bb9e2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6d7ac15733fdf04b4463c0468b684acdc39a7e73, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=84c3b7489b9214a19a5004c01c72d6305e44af45, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c5e7f6997f3c09f1a6c06e7250b74015b5361179, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=13a25f4d93acfe31e6de5bce53ec18b4e4d1c9ba, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1b2939ffbcd5d3cbc720b8185126b8c52bf8d167, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=329c3c540de0f517c3b2b225395228963f1f1874, stripped, too many notes (256)ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=076deb60a2f2af66db58bc601bafe5745115b9fe, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f6572773f4194d29b93fadc7d1bb88c4300fd721, stripped, too many notes (256)directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=53f8dfae4a9ac79e2becec15072a7fa74191eac4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4478e1c8a7aab31a8c380ff33b1d0e6acb973038, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4228317a64d4bb4e1b6f0cc92871d721acb06a3e, strippedUTF-8 Unicode textASCII textHTML document, ASCII textXML 1.0 document, ASCII textmakefile script, ASCII textUTF-8 Unicode text, with escape sequencesassembler source, ASCII textGNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (\321\201\320\260\320\274\320\276 \320\265\320\267\320\270\321\206\320\270 \320\262\321\212\320\267 \320\276\321\201\320\275\320\276\320\262\320\260 \320\275\320\260 XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8.1 '                                (only XML based languages)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                              (seulement les langages de la famille XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (XML\245\331\241\274\245\271\244\316\270\300\270\354\244\316\244\337)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (XML \352\270\260\353\260\230 \354\226\270\354\226\264\353\247\214 \354\247\200\354\233\220)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (tylko j\304\231zyki oparte na XML-u)'GNU message catalog (little endia�x������������� ��������X�h�(
8� ;~d�$n����������������~dd}d����1:1.1.1k-14.el8_61:1.1.1k-14.el8_61.1.1k1.1.1k1.1.1k�x����������������������X��(
`������� Le�$u����������������edf�to change mkcramfs blocksize with a command line option- Fix segfault on s390x due to wrong usage of BLKGETSIZE.- Really apply the ipcs patch. Doh.- rebuilt- ipcs-84243.patch to fix #84243- Update moremisc patch to fix swprintf()'s minimum field (bug #83361).- Fix mcookie segfault on many 64-bit architectures (bug #83345).- Fix underlined multibyte characters (bug #83376).- rebuild to have again a s390 rpm
- disable some more apps for mainframe- util-linux-2.11y-umask-82552.patch- rebuilt- Fix #81069, #75421- Update to 2.11y
- Fix #80953
- Update patch0, patch107, patch117, patch120 for 2.11y
- Remove patch60, patch61, patch207, patch211, patch212, patch119, patch121
- Remove patch122, patch200- Remove some crack/unnecessary patches while submitting stuff upstream.
- Build with -D_FILE_OFFSET_BITS=64- Update to 2.11w, resolve patch conflicts- Extended util-linux-2.11b-s390x patch to work again.- Add patch122 for hwclock on x86_64- Fixed pam config files- Port to hammer- Patch120 (hwclock) to fix #72140
- Include isosize util- Patch120 (skipraid2) to fix #70353, because the original patch was 
totally useless.- Patch119 (fdisk-add-primary) from #67898- Really add the gptsize patch, instead of what I think the patch says.
(+1)- Add the sp[n].size part of the patch from #69603- adjust mainframe patches- only require usermode if we're shipping kbdrate here- Port the large swap patch to new util-linux... the off_t changes 
  now in main aren't sufficient- Remove swapondetect (patch301) until it avoids possible false positives.- Update to 2.11r, wheeee
- Remove unused patches- Make a note here that this package was the source of the single change 
contained in util-linux-2.11f-18 (in 7.2/Alpha), and also contains the 
rawman patch from util-linux-2.11f-17.1 (in 2.1AS).
- Package has no runtime deps on slang, so remove the BuildRequires: 
slang-devel.- automated rebuild- Fix teg's swapondetect patch to not print out the usage message when 
'swapon -a -e' is run. (#66690) (edit existing patch)
- Apply hjl's utmp handling patch (#66950) (patch116)
- Fix fdisk man page notes on IDE disk partition limit (#64013) (patch117)
- Fix mount.8 man page notes on vfat shortname option (#65628) (patch117)
- Fix possible cal overflow with widechars (#67090) (patch117)- support large swap partitions
- add '-d' option to autodetect available swap partitions- automated rebuild- Remove kbdrate (again).- adjust mainframe patches to apply to current rpm
- do not include fdisk until it is fixed to work on mainframe- Don't strip binaries - rpm does it for us.- Apply patch115 from ejb@ql.org for bug #61868- Finish fixing #60675 (ipcrm man page), updated the patch.
- Fix #61203 (patch114 - dumboctal.patch).- Update ctty3 patch to ignore SIGHUP while dropping controlling terminal- Update ctty3 patch to drop controlling terminal before forking.Fix various bugs:
- Add patch110 (skipraid) to properly skip devices that are part of a RAID array.
- Add patch111 (mkfsman) to update the mkfs man page's "SEE ALSO" section.
- remove README.cfdisk
- Include partx
- Fix 54741 and related bugs for good(hah!) with patch113 (ctty3)- Put kbdrate in, add usermode dep.- Fix #60363 (tweak raw.8 man page, make rawdevices.8 symlink).- remove kbdrate (fixes kbd conflict)- Add util-linux-2.11n-ownerumount.patch (#56593)
- Add patch102 (util-linux-2.11n-colrm.patch) to fix #51887
- Fix #53452 nits.
- Fix #56953 (remove tunelp on s390)
- Fix #56459, and in addition switch to using sed instead of perl.
- Fix #58471
- Fix #57300
- Fix #37436
- Fix #32132- Update to 2.11n
- Merge mount/losetup back in.- Add patch38 (util-linux-2.11f-ctty2.patch) to ignore SIGINT/SIGTERM/SIGQUIT in the parent, so that ^\ won't break things.- Merge patches 36, 75, 76, and 77 into patch #37, to attempt resolve all the remaining issues with #54741.- add nologin man-page for s390/s390x- Don't build kbdrate on s390/s390x
- Don't make the pivot_root.8 man page executable(!)- Patch/idea #76 from HJL, fixes bug #54741 (race condit�x�����([��������X$��(
����������������.��$>����������������.�/�-��RHBZ #630667)- Fixing release number for modules- Update to 5.12.2
- Removed one hardcoded occurence of perl version in build process
- Added correct path to dtrace binary
- BuildRequires: systemtap-sdt-devel- run Configure with -Dusedtrace for systemtap support- Run tests in parallel
- Add "-Wl,--enable-new-dtags" to linker to allow to override perl's rpath by
  LD_LIBRARY_PATH used in tests. Otherwise tested perl would link to old
  in-system libperl.so.
- Normalize spec file indentation- 617956 move perlxs* docs files into perl-devel- 614662 wrong perl-suidperl version in obsolete- add temporary compat provides needed on s390(x)- Add Digest::SHA requirement to perl-CPAN and perl-CPANPLUS (bug #612563)- 607505 add another dir into Module::Build (thanks to Paul Howarth)- Address perl-Compress-Raw directory ownership (BZ 607881).- remove patch with debugging symbols, which should be now ok without it
- update to 5.12.1
- MODULE_COMPAT- packages in buildroot needs MODULE_COMPAT 5.10.1, add it back for rebuild- rebuild with tests in test buildroot- MODULE_COMPAT 5.12.0
- remove BR man
- clean configure
- fix provides/requires in IO-Compress- rebuild 5.12.0 without MODULE_COMPAT- initial 5.12.0 build- 463773 remove useless txt files from installation
- 575842 remove PERL_USE_SAFE_PUTENV, use perl putenv- package tests in their own subpackage- add noarch into correct sub-packages
- move Provides/Obsoletes into correct modules from main perl- restore missing version macros for Compress::Raw::Zlib, IO::Compress::Base
  and IO::Compress::Zlib- clean spec a little more
- rebuild with new gdbm- fix license according to advice from legal
- clean unused patches- update subpackage tests macros to handle packages with an epoch properly- add initial EXPERIMENTAL tests subpackage rpm macros to macros.perl- 547656 CVE-2009-3626 perl: regexp matcher crash on invalid UTF-8 characters  
- 549306 version::Internals should be packaged in perl-version subpackage
- Parse-CPAN-Meta updated and separate package is dead- subpackage parent and Parse-CPAN-Meta; add them to core's dep list- exclude "parent".- exclude Parse-CPAN-Meta.- do not pack Bzip2 manpages either (#544582)- do not pack Bzip2 modules (#544582)
- hack: cheat about Compress::Raw::Zlib version (#544582)- switch off check for ppc64 and s390x
- remove the hack for "make test," it is no longer needed- be more careful with the libperl.so compatibility symlink (#543936)- new upstream version
- release number must be high, because of stale version numbers of some
  of the subpackages
- drop upstreamed patches
- update the versions of bundled modules
- shorten the paths in @INC
- build without DEBUGGING
- implement compatibility measures for the above two changes, for a short
  transition period
- provide perl(:MODULE_COMPAT_5.10.0), for that transition period only- fix patch-update-Compress-Raw-Zlib.patch (did not patch Zlib.pm)
- update Compress::Raw::Zlib to 2.023
- update IO::Compress::Base, and IO::Compress::Zlib to 2.015 (#542645)- 542645 update IO-Compress-Base- back out perl-5.10.0-spamassassin.patch (#528572)- add /perl(UNIVERSAL)/d; /perl(DB)/d to perl_default_filter auto-provides
  filtering- update Storable to 2.21- update our Test-Simple update to 0.92 (patch by Iain Arnell), #519417
- update Module-Pluggable to 3.9- fix macros.perl *sigh*- Remove -DDEBUGGING=-g, we are not ready yet.- add helper filtering macros to -devel, for perl-* package invocation
  (#502402)- Add configure option -DDEBUGGING=-g (#156113)- 510127 spam assassin suffer from tainted bug- 494773 much better swap logic to support reentrancy and fix assert failure (rt #60508)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix generated .ph files so that they no longer cause warnings (#509676)
- remove PREREQ_FATAL from Makefile.PL's processed by miniperl
- update to latest Scalar-List-Utils (#507378)
- perl-skip-prereq.patch: skip more prereq declarations in Makefile.PL files- re-enable tests- move -DPERL_USE_SAFE_�x��������������������X�}�(
x0������id�$y����������������idjdhd�ion.3ssl.gzSSL_CTX_get_mode.3ssl.gzSSL_CTX_get_num_tickets.3ssl.gzSSL_CTX_get_options.3ssl.gzSSL_CTX_get_quiet_shutdown.3ssl.gzSSL_CTX_get_read_ahead.3ssl.gzSSL_CTX_get_record_padding_callback_arg.3ssl.gzSSL_CTX_get_recv_max_early_data.3ssl.gzSSL_CTX_get_security_callback.3ssl.gzSSL_CTX_get_security_level.3ssl.gzSSL_CTX_get_session_cache_mode.3ssl.gzSSL_CTX_get_timeout.3ssl.gzSSL_CTX_get_tlsext_status_arg.3ssl.gzSSL_CTX_get_tlsext_status_cb.3ssl.gzSSL_CTX_get_tlsext_status_type.3ssl.gzSSL_CTX_get_verify_callback.3ssl.gzSSL_CTX_get_verify_depth.3ssl.gzSSL_CTX_get_verify_mode.3ssl.gzSSL_CTX_has_client_custom_ext.3ssl.gzSSL_CTX_keylog_cb_func.3ssl.gzSSL_CTX_load_verify_locations.3ssl.gzSSL_CTX_new.3ssl.gzSSL_CTX_remove_session.3ssl.gzSSL_CTX_select_current_cert.3ssl.gzSSL_CTX_sess_accept.3ssl.gzSSL_CTX_sess_accept_good.3ssl.gzSSL_CTX_sess_accept_renegotiate.3ssl.gzSSL_CTX_sess_cache_full.3ssl.gzSSL_CTX_sess_cb_hits.3ssl.gzSSL_CTX_sess_connect.3ssl.gzSSL_CTX_sess_connect_good.3ssl.gzSSL_CTX_sess_connect_renegotiate.3ssl.gzSSL_CTX_sess_get_cache_size.3ssl.gzSSL_CTX_sess_get_get_cb.3ssl.gzSSL_CTX_sess_get_new_cb.3ssl.gzSSL_CTX_sess_get_remove_cb.3ssl.gzSSL_CTX_sess_hits.3ssl.gzSSL_CTX_sess_misses.3ssl.gzSSL_CTX_sess_number.3ssl.gzSSL_CTX_sess_set_cache_size.3ssl.gzSSL_CTX_sess_set_get_cb.3ssl.gzSSL_CTX_sess_set_new_cb.3ssl.gzSSL_CTX_sess_set_remove_cb.3ssl.gzSSL_CTX_sess_timeouts.3ssl.gzSSL_CTX_sessions.3ssl.gzSSL_CTX_set0_CA_list.3ssl.gzSSL_CTX_set0_chain.3ssl.gzSSL_CTX_set0_chain_cert_store.3ssl.gzSSL_CTX_set0_security_ex_data.3ssl.gzSSL_CTX_set0_verify_cert_store.3ssl.gzSSL_CTX_set1_cert_store.3ssl.gzSSL_CTX_set1_chain.3ssl.gzSSL_CTX_set1_chain_cert_store.3ssl.gzSSL_CTX_set1_client_sigalgs.3ssl.gzSSL_CTX_set1_client_sigalgs_list.3ssl.gzSSL_CTX_set1_curves.3ssl.gzSSL_CTX_set1_curves_list.3ssl.gzSSL_CTX_set1_groups.3ssl.gzSSL_CTX_set1_groups_list.3ssl.gzSSL_CTX_set1_param.3ssl.gzSSL_CTX_set1_sigalgs.3ssl.gzSSL_CTX_set1_sigalgs_list.3ssl.gzSSL_CTX_set1_verify_cert_store.3ssl.gzSSL_CTX_set_allow_early_data_cb.3ssl.gzSSL_CTX_set_alpn_protos.3ssl.gzSSL_CTX_set_alpn_select_cb.3ssl.gzSSL_CTX_set_block_padding.3ssl.gzSSL_CTX_set_cert_cb.3ssl.gzSSL_CTX_set_cert_store.3ssl.gzSSL_CTX_set_cert_verify_callback.3ssl.gzSSL_CTX_set_cipher_list.3ssl.gzSSL_CTX_set_ciphersuites.3ssl.gzSSL_CTX_set_client_CA_list.3ssl.gzSSL_CTX_set_client_cert_cb.3ssl.gzSSL_CTX_set_client_hello_cb.3ssl.gzSSL_CTX_set_cookie_generate_cb.3ssl.gzSSL_CTX_set_cookie_verify_cb.3ssl.gzSSL_CTX_set_ct_validation_callback.3ssl.gzSSL_CTX_set_ctlog_list_file.3ssl.gzSSL_CTX_set_current_cert.3ssl.gzSSL_CTX_set_default_ctlog_list_file.3ssl.gzSSL_CTX_set_default_passwd_cb.3ssl.gzSSL_CTX_set_default_passwd_cb_userdata.3ssl.gzSSL_CTX_set_default_read_buffer_len.3ssl.gzSSL_CTX_set_default_verify_dir.3ssl.gzSSL_CTX_set_default_verify_file.3ssl.gzSSL_CTX_set_default_verify_paths.3ssl.gzSSL_CTX_set_ex_data.3ssl.gzSSL_CTX_set_generate_session_id.3ssl.gzSSL_CTX_set_info_callback.3ssl.gzSSL_CTX_set_keylog_callback.3ssl.gzSSL_CTX_set_max_cert_list.3ssl.gzSSL_CTX_set_max_early_data.3ssl.gzSSL_CTX_set_max_pipelines.3ssl.gzSSL_CTX_set_max_proto_version.3ssl.gzSSL_CTX_set_max_send_fragment.3ssl.gzSSL_CTX_set_min_proto_version.3ssl.gzSSL_CTX_set_mode.3ssl.gzSSL_CTX_set_msg_callback.3ssl.gzSSL_CTX_set_msg_callback_arg.3ssl.gzSSL_CTX_set_next_proto_select_cb.3ssl.gzSSL_CTX_set_next_protos_advertised_cb.3ssl.gzSSL_CTX_set_num_tickets.3ssl.gzSSL_CTX_set_options.3ssl.gzSSL_CTX_set_post_handshake_auth.3ssl.gzSSL_CTX_set_psk_client_callback.3ssl.gzSSL_CTX_set_psk_find_session_callback.3ssl.gzSSL_CTX_set_psk_server_callback.3ssl.gzSSL_CTX_set_psk_use_session_callback.3ssl.gzSSL_CTX_set_quiet_shutdown.3ssl.gzSSL_CTX_set_read_ahead.3ssl.gzSSL_CTX_set_record_padding_callback.3ssl.gzSSL_CTX_set_record_padding_callback_arg.3ssl.gzSSL_CTX_set_recv_max_early_data.3ssl.gzSSL_CTX_set_security_callback.3ssl.gzSSL_CTX_set_security_level.3ssl.gzSSL_CTX_set_session_cache_mod�x�������������`p�������X��(
h������� �������?��$/����������������?�@�>��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�����(�������h_�������X� �(
��������h��������d�$V�����������������d�d�d���g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�vg��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g���x�������������PO�������X�ܛ(
���������K^X�$N����������������^X]X_X�module_expand to use shared libsepol.
        Fixed audit2why to call policydb_init prior to policydb_read (still
        uses the static libsepol).- Update to match NSA
        * Updated for changes to libsepol.
        Changed semodule and semodule_package to use the shared libsepol.
        Disabled build of semodule_link and semodule_expand for now.
        Updated audit2why for relocated policydb internal headers,
        still needs to be converted to a shared lib interface.- Update newrole pam file to remove pam-stack
- Update run_init pam file to remove pam-stack- Update to match NSA
        * Fixed warnings in load_policy.
        * Rewrote load_policy to use the new selinux_mkload_policy()
        interface provided by libselinux.- Rebuild with newer libararies- Update to match NSA
        * Merged patch to update semodule to the new libsemanage API
        and improve the user interface from Karl MacMillan (Tresys).
        * Modified semodule for the create/connect API split.- More fixes to stop find from following nfs paths- Update to match NSA
        * Merged run_init open_init_pty bug fix from Manoj Srivastava
          (unblock SIGCHLD).  Bug reported by Erich Schubert.- Update to match NSA
        * Merged error shadowing bug fix for restorecon from Dan Walsh.
        * Merged setfiles usage/man page update for -r option from Dan Walsh.
        * Merged fixfiles -C patch to ignore :s0 addition on update
          to a MCS/MLS policy from Dan Walsh.- Add chcat script for use with chcon.- Fix restorecon to exit with error code* Updated version for release.- Add prereq for mount command- Update to match NSA
        * Changed setfiles -c to translate the context to raw format
        prior to calling libsepol.- Use new version of libsemange and require it for install- Ignore s0 in file context- Update to match NSA
        * Merged patch for fixfiles -C from Dan Walsh.- Update to match NSA
        * Merged fixes for semodule_link and sestatus from Serge Hallyn (IBM).
          Bugs found by Coverity.- Fix fixfiles to call sort -u followed by sort -d.- Change fixfiles to ignore /home directory on updates- Update to match NSA
        * Merged patch to move module read/write code from libsemanage
          to libsepol from Jason Tang (Tresys).- Update to match NSA
        * Changed semodule* to link with libsemanage.- Update to match NSA
        * Merged restorecon patch from Ivan Gyurdiev.- Update to match NSA
        * Merged load_policy, newrole, and genhomedircon patches from Red Hat.- Update to match NSA
        * Merged loadable module support from Tresys Technology.- Update to match NSA
        * Updated version for release.- Fix Ivan's patch for user role changes- Add Ivan's patch for user role changes in genhomedircon- Fix warning message on reload of booleans- Update to match NSA
        * Merged fixfiles and newrole patch from Dan Walsh.
        * Merged audit2why man page from Dan Walsh.- Add call to pam_acct_mgmt in newrole.- Update to match NSA
        * Extended audit2why to incorporate booleans and local user
          settings when analyzing audit messages.- Update to match NSA
        * Updated audit2why for sepol_ prefixes on Flask types to
          avoid namespace collision with libselinux, and to
          include <selinux/selinux.h> now.- Fix fixfiles to accept -f
- Update to match NSA
        * Added audit2why utility.- Change -f flag in fixfiles to remove stuff from /tmp
- Change -F flag to pass -F flag  to restorecon/fixfiles.  (IE Force relabel).- Update to match NSA
        * Fixed signed/unsigned pointer bug in load_policy.
        * Reverted context validation patch for genhomedircon.- Update to match NSA
        * Reverted load_policy is_selinux_enabled patch from Dan Walsh.
          Otherwise, an initial policy load cannot be performed using
          load_policy, e.g. for anaconda.- remove is_selinux_enabled check from load_policy  (Bad idea)- Update to version from NSA
        * Merged load_policy is_selinux_enabl�x�����DX>�������X�(
�	HJ��������$�������������������hare/licenses//usr/share/licenses/libsolv/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=db70ab2422666bdc4ca19fd25d7a8a1bace05015, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a41ef2a076fb9767824ed44e7c17321c0effaf50, strippedASCII textPPPPPPPPRRRR	RRRRR
RRPPR
RRRRRRRRRRRRRRRRRRRRRRutf-8b363644b47aef6e9e26015e79bc5393b6e54b5d3bf0c968a1a8582270ddb812d?����܉�!�<��ΰ��Q�d~���e(��
	Q�d~��ꋕ�p����F���4��?���	_����/�#�j9�T���@%D-Z�J�(#��X���H����˭v<�2�p`��.lw `^�OW�JW��abUa����(�I�������ժ�QDg:���R9J�ܓ�0T`R��d7E�����~�W
��xi�
)s���?��4J��/�DYG��{�E��z�m�����K�ѽ�֬��jޞ�_Ւ<kC�x��D�/&f3}�QNQ��v�����yT��T�}]��OA
�ݭ�6�S�
x/
�E>ܢ� 
.��F���g�)��"ݿ�N�X����>jk{��)��IAC��f{�n�"��4ɝ�:�h�.2Z�aUa��#QV ��m}�U��p�V��Wx����&�ph��%����!�<��ΰ��Q�d~���e(��
	Q�d~���S��܄)��̑�
�ީy�7>򋬚�.)IFj�b�qP�W8���#P�q(��nS%��a�W�8�=�}�|.)�br���t�A����ɴD�R�[�z�}RU���4�7��ޟ�i^LZ�e�q�Ѥ
�C0��m�.���_��̇���_0�w]�^��C�ݯ���ȳ�q�nk��H�,h����>��(�|��ä��?8�X�R�w_�r^/��}(��V��ȾI�_��d~���/M-�L���SC����_wq���_7d��1#d�
s��X�|-��wN(R��\�O�*�G-d��RZl�%�1t�y��ݨ[�����o�u�,���'薕.����ָ�{��ʎn��$Pz�UPޡ+�\yzk8a37236175aca3d34d6c44ee57238141026a83eeb32365a28cc6cabaed6ea5adf8a67b1240136108534ce42774c5e2f55a536f43fX�/J�fX�1246eefbdc0103118a993a�u(fc9b5f991d99c019cb011b637e844ad767a00cb4L�(fbac21015d11b9523b89929117bb5bfcb92fe3a3Dc(f9459099bf21cd815d415b1cf482ba99f79722d63�(f79ddd72cfeff0a2bc6f2db35e3d25fc12e53bc2��(f6b7354075fba5aa64dba2e570be6734f1c37225�j�(f675ba873daa2a99f05d95b2b0cc76e45a02cef0w(f4b61bd5aecd1084baa4133aef250facf771b422�(f42c801c269ced38359ecdd18cb8c18b8fd508072(ef0094c10d14ce7270befa287f257f305fe58639(eddec6b29868c2721fa96de49f7948c5097c1c1c�e(ed89318f75edea035acab5c670473f44daf6230e (e90949572c22eb2875172c3e62cdf7e5569cd121(e83db379aaab364fa832814ca7dc699df5cb1c28�n(e7bbfc7a99f705765226d5f85ecb9a2b28c360c4<(e6efa4380b4da03d366ea260018ffb6e9a09331a\b(e6948cd688fa1695ca31484a0517195ca46fe426j�(e5c8356a9d9c547981f5eb5ae395aa555f3f28b8�(e584d0d0cc9e4a53d3536e819630b1d0d0c9bb61de(e4d70f73ada4904646c6baee146eba34b5b0fe48
!(e3d4fe8ad1e5f16d73bb3c97e6a06329b70efaac_w(e2d2ea815c8b5c9eb3f78de777d084533040457f2�(e12a2aea5ccc0c4afa83e67d2d2b517a7dd2a42cf8(e077affe3807fdaad7d1ded48c215846711e6409��(dfe123b6d0250ef7915ec8cd606cb190bd6a3d6fRi(df84848ee16bbe742455c99a9dec24d88eed2fe5
�l(de58d669bd66a96c65e9d2dbb3976669d9728fafa6(ddfc8e29d23472004f473989e3b2313592908ec7�8(dc870ca510b4fbbd02da073ca987694c10638726�(dbfe0fd4d9bf766164292cda75143c0af7003403� (db2cc805f052664553f2034dda33f8b9a7635191i�(d924b831b95822ac0f9a8ccd49d58665754ee0cb�(d86c2995499c7cc7f42267b12a290191b28df34a�(d23bab2be15edd8458777313641a452e3327c822�x�������������@.�������X��(
���������F������C��$S����������������C�D�B��d59e174fdac2269d55740093bc91a3af2828211b357ee866b91d1d79077e3da1e6af5e9670341ed853aeb2c2a77041a6ef907cf26cc3f23bbb93e4c24e097c09ede74221bc1b8bf95cdf0f6109573b337fba766b3cd361027eb48804560bab0e0972384b78c556f57d5817d51350e92c6ac19ad49d8f848ea8f581d0ce625b39539f9f0f0093f14bc14129564e9132a5b03889a027ab1561f862d36e072d028275e8c876744209b575e2546f07c05621682df82159ec789e1e348fcb8bc748cde66aa0bad58600070adccde5f1f5e4aca122bc6a26aa06b723ff560f1da7edab03f1707b1b430bae1dc26beaf883eea1bf52fdc7fe08e55ab4449452039629ee60a27f18a097a77cfbc764d6eb65b9de8495522cac38694982641d57081c16de66cda43ef7c53c370b2738746fadb96e3848833a4ea4352e3c9fcf2b8c11fd615485c763f34eb46936ce88668fde7642c947c6edb927e733bc31faeed409868ef6195b4b4dd4700735cad0b41ee0065c9786f55653b19e3178228b7f682f2a83b54f6f74c5284e3823fa3df10480afe0b4346dc53e30b547b03b862601c6fdabbf9cec89d2ef3ab03c715059e2123785c70d7a2bb872034d755507a9f8784abb4c0d282655054c1738d52ece37054b26017cb0f96a6e965707ed694238cfadb49a3a817166fa6271d516718dd268d13396f598b2c1a618940d505790e27fb759bac9e1a0bf29fd686ac463cbf9fb82496d12057601577aaa64c19813921a25e8d13f9a08974fd8d05bc04f52d239a3391ca99230af5e48114ce5279a15fb80c92543e5ed80f4fc8153f1e8a33c981024a71c84d83e36ab734028b57d5e18e2745ef135863a9abec5f666b69c8a7a54444ed5e4615f84d93bc69f6efac90c533e865498ce3e7094f1f702153a023709f68e9d9d1d4f1143329015282ffe5dc361a229d25471475f6bcc0058d2c5ff2a36e64f8d8c22bc4439236f244c724c4862eef5d57717f2ed8764d4e9f70d5d7e1ff2fdfd9041c884462b23204f2182d9c0713cca99f022d44f938cf80fb62270830471e15248e579ce03836b14ae51a101d6567c7cb8c422574cddad3c5c7fcb58aaafd1e6c8266387391679e3f18be30c22851db200a8451819b8a3549d8d6c67250017b56e1d0d524fd66fdf5e61fc81c560dad4177ca019e04f239ee2f4e17b4c1f0ac2c57758e4b63cb2d3654afe046a423b400b7809e6a8448b43c07af9bccf87f37fc9555aa6eb521cd707f09e74c3e0ee3b167d4d85eab7ec518aa6baf47ba86a05884c26b3458fd795bdb019060c93bfbadbb799d92afc052e2ed22f375d261fa5e51a21000daaa8bf55b4ba80bbe9bcb437129c33cb38f84cceb21e2948f98083f0d443057a4cb2a5452bf2bdc7e8c5ef211049360e1d26a231076bbed818db6b2db6e0ff43f079e9428b5ab7cc510f6994717fada671c6dd6d518c60cbb320a7ae386e1ad495afd213e9d075725982d751c2fc28291f659fa55d205b9e16e442782f3a987150880d5d5170fe76ba4991ec33a12593c6dfa48d27332c415f71343ee49748c385a8fb84e17696d27e201f26608f34d80a01bdbe970180e732dd248284294a9e08307083b63901e153b59a475603e0bee03762c68ebc293a38fc835344e1499aefb13071652a1750d52668ce71ffb106d704ed38f7783f7621ab73b2654f3298e9d739930a05a7d3572bc6fe448e7c19d2fa3b99a6ec9366151bfa657924162b6de1011bd4bfc288e41cc2d845e911a65bcc57095a43b2dd24bb64880f97f95240db0bb3a3c7a6dd5031ca66bcdcd7bbefdb6773fc8e559bdc7d70e13df5535ec6c83b18808e6ed0af94048303a673505ba3dc64c8f85ce164567d994e3611850da33191e102daa90d42d7ec8f3120fce9e257ec950dde7b6a038bce3e8f9aebc50eb202f67a109eeb791ad97c51ffcf2882c887d738cd52397ffd0559d8d847e8a6993b26ff24de0e606e7137056f4893d303a3afc058b142e14620144ce822bf5d7780fdf2ca5382076ffcd2ea07d26be85f6c72a30bac9ebd39320872720d8c7e4e79bfde06874d05e4d52312528ab1e6cc317e75e418388d77217b80e1cedd209989aae700937bac1d3531e1009f730411a8f40ff9f1eeb0528261bfbf1e15a1b87e9fc5ec323e26a481489e747c84a97ddf073b8819bf79d35b34b0f619af64a48d71740ac0da283f8bb7b386a7466b7673ff29eecfc8c760b4fc8cf8a5fb7ecf8c7001fa93e9ede7f05b4a0d5192016b64b38d525149ea437073341d9c60dd4810b2c7df4854f701442598fcf49bdb35a01f5371d9ba33e212e2b2cb2630f85b58d8c7a5b32bb0be35bf21514b58d7cb85a88959784b8e9df16da06b2bbbd1d1f5185e04c43e39974278a3992501bb70ea54f6eaa3be51436b36a8de472f823cddcbfcbf97f9ca4f85634b3f9abd66d692e12568cf7e42e8e3d668b91620b615e9bc49cec472a195ebf4be8be8061015302027567274ebcd8607943b110b957c493ad7383c33782f7baefa75fe3eb73dede515c8f2c59ecca6891c57e367d4b56ee81518748d86537ac50893d4e36321446bd0e0137a19b83ae592ec27b5648ce416ba0ee47efabbdac7ac1001e21e6db499a1d14bd120f40e791761144c9d080cd0b0142fcf5ef029131135938b9ab728d1b2988be1e63a6d82ad895d3ea87f85b5364e39abca43225ec25abcd34ff5ab356ca47715ad3dbaded71cd0f0b483c234c265081e2f882e2a0699117c1bfafbae4b02a81955695175061469e19ea564a8a9000ae8920bdcd194eb5545f119deb5a7c4be81921�x���������������������X�[�(
��������PI�������d�$�����������������d�d�d�session resumption
- various null checks and other small fixes from upstream
- upstream changes for the renegotiation info according to the latest draft- fix non-fips mingw build (patch by Kalev Lember)
- add IPV6 fix for DTLS- add better error reporting for the unsafe renegotiation- fix build on s390x- disable enforcement of the renegotiation extension on the client (#537962)
- add fixes from the current upstream snapshot- keep the beta status in version number at 3 so we do not have to rebuild
  openssh and possibly other dependencies with too strict version check- update to new upstream version, no soname bump needed
- fix CVE-2009-3555 - note that the fix is bypassed if SSL_OP_ALL is used
  so the compatibility with unfixed clients is not broken. The
  protocol extension is also not final.- fix use of freed memory if SSL_CTX_free() is called before
  SSL_free() (#521342)- fix typo in DTLS1 code (#527015)
- fix leak in error handling of d2i_SSL_SESSION()- fix RSA and DSA FIPS selftests
- reenable fixed x86_64 camellia assembler code (#521127)- temporarily disable x86_64 camellia assembler code (#521127)- fix openssl dgst -dss1 (#520152)- drop the compat symlink hacks- constify SSL_CIPHER_description()- fix WWW:Curl:Easy reference in tsget- enable MD-2- update to new major upstream release- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- do not build special 'optimized' versions for i686, as that's the base
  arch in Fedora now- abort if selftests failed and random number generator is polled
- mention EVP_aes and EVP_sha2xx routines in the manpages
- add README.FIPS
- make CA dir absolute path (#445344)
- change default length for RSA key generation to 2048 (#484101)- fix CVE-2009-1377 CVE-2009-1378 CVE-2009-1379
  (DTLS DoS problems) (#501253, #501254, #501572)- support compatibility DTLS mode for CISCO AnyConnect (#464629)- correct the SHLIB_VERSION define- add support for multiple CRLs with same subject
- load only dynamic engine support in FIPS mode- update to new upstream release (minor bug fixes, security
  fixes and machine code optimizations only)- move libraries to /usr/lib (#239375)- add a static subpackage- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- must also verify checksum of libssl.so in the FIPS mode
- obtain the seed for FIPS rng directly from the kernel device
- drop the temporary symlinks- drop the temporary triggerpostun and symlinking in post
- fix the pkgconfig files and drop the unnecessary buildrequires
  on pkgconfig as it is a rpmbuild dependency (#481419)- add temporary triggerpostun to reinstate the symlinks- no pairwise key tests in non-fips mode (#479817)- even more robust test for the temporary symlinks- try to ensure the temporary symlinks exist- new upstream version with necessary soname bump (#455753)
- temporarily provide symlink to old soname to make it possible to rebuild
  the dependent packages in rawhide
- add eap-fast support (#428181)
- add possibility to disable zlib by setting
- add fips mode support for testing purposes
- do not null dereference on some invalid smime files
- add buildrequires pkgconfig (#479493)- do not add tls extensions to server hello for SSLv3 either- move root CA bundle to ca-certificates package- fix CVE-2008-0891 - server name extension crash (#448492)
- fix CVE-2008-1672 - server key exchange message omit crash (#448495)- super-H arch support
- drop workaround for bug 199604 as it should be fixed in gcc-4.3- sparc handling- update to new root CA bundle from mozilla.org (r1.45)- Autorebuild for GCC 4.3- merge review fixes (#226220)
- adjust the SHLIB_VERSION_NUMBER to reflect library name (#429846)- set default paths when no explicit paths are set (#418771)
- do not add tls extensions to client hello for SSLv3 (#422081)- enable some new crypto algorithms and features
- add some more important bug fixes from openssl CVS- update to latest upstream release, SONAME bumped to 7- update to new CA bundle from mozilla.org- fix CVE-2007-5135 - off�x�������������0
�������X��(
��� ��������$<��������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcronie-1.5.2-10.el8.src.rpm����������������������������������������������������������������������������������������������������������������config(cronie)croniecronie(x86-64)	@@@@@@@@@@@@@@



@/bin/sh/bin/sh/bin/sh/bin/shconfig(cronie)coreutilsdailyjobslibaudit.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.8)(64bit)libdl.so.2()(64bit)libpam.so.0()(64bit)libpam.so.0(LIBPAM_1.0)(64bit)libselinuxlibselinux.so.1()(64bit)pamrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)sedsystemdsystemdsystemd1.5.2-10.el82.0.641.0.13.0.4-14.6.0-14.0-15.2-14.14.3# empty /etc/crontab in case there are only old regular jobs
cp -a /etc/crontab /etc/crontab.rpmsave
sed -e '/^01 \* \* \* \* root run-parts \/etc\/cron\.hourly/d'\
  -e '/^02 4 \* \* \* root run-parts \/etc\/cron\.daily/d'\
  -e '/^22 4 \* \* 0 root run-parts \/etc\/cron\.weekly/d'\
  -e '/^42 4 1 \* \* root run-parts \/etc\/cron\.monthly/d' /etc/crontab.rpmsave > /etc/crontab
exit 0# Save the current service runlevel info
# User must manually run systemd-sysv-convert --apply crond
# to migrate them to systemd targets
/usr/bin/systemd-sysv-convert --save crond

# The package is allowed to autostart:
/bin/systemctl enable crond.service >/dev/null 2>&1

/sbin/chkconfig --del crond >/dev/null 2>&1 || :
/bin/systemctl try-restart crond.service >/dev/null 2>&1 || :
/bin/systemctl daemon-reload >/dev/null 2>&1 || :# changes in pam, glibc or libselinux can make crond crash
# when it calls pam
/bin/systemctl try-restart crond.service >/dev/null 2>&1 || :croniecronie-anacronglibclibselinuxpam1.4.7-21.4.1ehy@ehy@b��bo�aHw�a2@]�@\�[�h@Z�Zz�@Y���Yx�@Y�X��@Xk�@W�^@W�:�Wk�@V��U��@U�a@Ug@U6;�Tи@T��@T}��TX��Tw�S�G�S��S���S`�R��RB�@Q��Q��Q��Q�@Q�@P�!@P��@P��PG>�P��O�N��@N���N��N/��N(�N(�Ne@N�N�N	�@M��@M‘@MT�MQ0@M4/@M	�@M��M@L��@L��@L��@L�|�Le3�L_�LV�@K~}@Ky7@J�@J��@J�T�J�@J��@J�Q�J�Q�Jyt@Ji�@Jd\@J:,@I��@I�I��I��@IP�I��H�}@H�B�Hc��HW�@HF��H=I@H2�@G��@G��@G�O�G�f�G�e�Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-10Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-9Jan Staněk <jstanek@redhat.com> - 1.5.2-8Ondřej Pohořelský <opohorel@redhat.com> - 1.5.2-7Jan Staněk <jstanek@redhat.com> - 1.5.2-6Jan Staněk <jstanek@redhat.com> - 1.5.2-5Marcel Plch <mplch@redhat.com> - 1.5.2-4Marcel Plch <mplch@redhat.com> - 1.5.2-3Marcel Plch <mplch@redhat.com> - 1.5.2-2Tomáš Mráz <tmraz@redhat.com> - 1.5.2-1Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-9Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-8Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-7Tomáš Mráz <tmraz@redhat.com> - 1.5.1-6Fedora Release Engineering <releng@fedoraproject.org> - 1.5.1-5Tomáš Mráz <tmraz@redhat.com> - 1.5.1-4Tomáš Mráz <tmraz@redhat.com> - 1.5.1-3Tomáš Mráz <tmraz@redhat.com> - 1.5.1-2Tomáš Mráz <tmraz@redhat.com> - 1.5.1-1Fedora Release Engineering <releng@fedoraproject.org> - 1.5.0-4Tomáš Mráz <tmraz@redhat.com> - 1.5.0-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.5.0-2Tomáš Mráz <tmraz@redhat.com> - 1.5.0-1Tomáš Mráz <tmraz@redhat.com> - 1.4.12-6Tomáš Mráz <tmraz@redhat.com> - 1.4.12-5Tomáš Mráz <tmraz@redhat.com> - 1.4.12-4Tomáš Mráz <tmraz@redhat.c�x�������8�����X���(
���������l��$.���������������������)]��)]��)]��)]��)]��)]��)]��)]��)]��)]��)]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]�қ]��)]��)]��)V�SQ]��)]��]�қTk�%P��*P��*T��P��*WY�P��*WY�W\	]��]��]��(]��(]��(Vf�Vf�V�SQVf�VzHkVzHkVf�VzHkWY�]��(]��"WY�Tk�'VzHkP��*P��*P��*P��*P��*P��*]��"V�SQV�SQV�SQV�SQV�SQV�SQW\W\dW\jW\
6W\
=W\
6W\
>W\
6W\jW\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
>W\jW\
6W\
>W\
6W\
>W\
6W\
6W\
>W\
6W\
6W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
6W\
>W\
>W\
6W\
>W\
6W\jW\
6W\
>W\dW\jW\
6W\
>W\
6W\
>W\
7W\
>W\
7W\
>W\
7W\
>W\
7W\jW\
7W\
>W\
7W\
>W\
7W\
>W\dW\
7W\
>W\	]��W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�W\�]��W\�]�� 3cade7e28fcef68312108df54585b6eda7ccd5efb5ef9033d421ae4c8cb6f2dcf252061af47e1f773ed29e3010f24412f5c7359b3ed5a74a3b7ac84e2b0959fbd6500b47e8dd42f1ef88d0effb9203bbc5d23f0bade3d6fac41468ae9dc4d3a24c84ed5af2781e2b9a11be085d2bcbae5dd6739cf3be5d5fefcb86290d97a060f54da466596be271a1e3b604ede62ddd54f1e903fc620e380ac1c27ba16561612b57870c232dd3c8f48f43259fc341da5563cc0f198d9f3aaa482b62c117a3c5a0ad19ea873e2f5cfb9f6e39189b0f3a5b810c1f00e2f2985a67062d6b0363a6fbb01d670de00b8663de15cbd3e6432cc34a961bff7c765781a0e8ef05d879ca2978eb4a21396e5ab7e0a44b67c4d653018b01ec39ce4455d68ac36e54d325f2a9f7060e57eed0826bfb8cb85712ac932a505830d2ac949fa3f2ae85e3428cdc7743106fe77f222e4876dff59c18152490f3e5220b9a8effb3f23146b3b0ee1b049cbc732103b8142b46ea7107dd4694834caad39a49ce5ecc7edbb7bb28f8eecac3cb4e41992c121acb05a5244d054bd4d79d3b568a1e874dcf429a04309cb530ee13ef31458d3eb6cecc75fc1e4026e2ba89766d9f8b7c21594977d4d8c599f276b3c4d898796cc66fd6a2760329b871f1ca319c0e6a13d8c7703ae116680e271ec77dbd5bcefd23c4721b15b679caf833fb770c04c8ab21c08d2954616c53b4c889b79416b1da7641b380f892411bd8543f1d618beb84fca2587761c6f990186c4c6075f0b4dc15ce6799f4f1aab30f453d66696313f678f0ec14268d458f66855fd6b5fd6fa5088a46b17ea86cd3dceb12cf47535fd4c0e6dd314b5951fcc425fa83e18e9b54f5b1fc8d977138bd9855b23140f9d473338484d30207d405b344049bc22036c131d4982770e0b5296cd9d86f51045601087ba382b18a4fc219a4e91505c0b6dce1ac8a61f6435e6bc6874a3c1313f5ce54c623cc35b5f4ee2f6f990858a05ac854b5809c652ce9148529b26bbdd8154ddf12764da0e82d2c3c1e0240df767b62ac86e017efe06d3bd1438d243f8bc69ec553172ed0dc08453220894eb086252ba417a438cd309a759996323aa818aa8befd4a0768eba9ff7b5a0860df3e21b2bfdef52893bfcdd5ca3a81f3714d5591682c845a1cbf46359c8953a637c1b38e4d8db4cdddffacb2096ac4fce6178403c842d68f8b0de95bd8ceb4b9ee5adedde47b31e975c1d90c73ad27b6b165a1dcd80c7c545eb65b9033fe5361f24b7c49ba12911c08f5a33f9cb18871d95d9fb881f5b8a4793e04288676e5840760b6adfc1c825615a6ccae0d8803018a18e8a3c511d28d9b62f51af4336e4a9cb4becdd86dd91104bf57fb92d55910b3479499c77e1e27b9c21c7101ee8289abcf7f86d48b4b10fc82da76b20e39c238159f0e2bbd263d8d930edb59e983b35e4c818b00ee5568cede04ef1c2eb24d4dd96e4e91c9b904e866927950a5c49a50383b8a984e82f23e48b5ac1f5649ff0a07830d4f5403e0cde33d73bca4068f64726454f71bcd1670e4da6e3d8f96d596642554b6025f94548841056700348e6ed9006f0ef3d6c5beaf22fa5ac358b9a16c57e74b8ed312b3ef3592e3eb1a786c9d725ac8f41030c63e37ec94cf4db04d926398fbab5138e862695255d6d31196dca079b1c43f65282953af5d6586bd1ada936931ec3bb0a502cf3b11623b4cb92fd33a0c35ec9a3d5c3ee0d960f3288951c10b3dfb6d5670c2c65fe3a60192fe6f655e9373d6b3c5368b63cd4d8c66b0050a7bb67bd12b6171daa65f1c7ed8274f848d63b32b8ec66f438c8dbe67c659a939b0e6f649803dd59f7a4949781fbd03ce1e1a16b797a856edfe8cbf18550aa28e52bbd1c64434ab9da76d28bb08e5db9aadf20bfa00b963ef21b53804a7b76d4acd63280b6008cf4c85181c39f44376083d31004805c7e069fd681a8c2c98a4f8fa79d39b4800b71ac8739004a6f74a9a482bb70af3d17ba0d3ac32964e666302160dc8e6590eb1a35b8ed85e3a2a4ce7157180b40ffab00bd8a24b4891c9ffc3e3bc94cb161d62e744cd5a3b72f3d2a12b6740416c201b35c77808a981feae8a7c9b674cd3ee875e00001b364b311c593a1a80c02fe2dd68cbeff7014515f4d54b3bf62dc74370a179033234736a58f1610c73e1c8c08faf1b2ef1397d878dd7d2cbd888ca0f2da4ffc3b0b89aa6625c051e69cce1e341f973f62ca9�x������������� �����X�˜(
�;�������!�$�����������������!�!�!�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?�x�������������������X�N�(
��������������d�$�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x����������X5�(
���������t�$d����������������tsu�interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f515c57028e1014b65f84fb1409d7aece221d5a6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=d5d8db2ff8938bfbbf163e6e6c7eaa5174f21e58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=9902196839a9d210b6a543f5972ab391b412a244, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b4b4681e4929d5303888ee1615db98ef9828764d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3e82124a0700ec5ece3d81ba6c675b598ef23c71, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=782d434196eecba659bcb616010a65ad2fd6e913, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=530df3fecc75965786f1fbc7aa64e4d87e05258a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=1b57d0c25d77b2e6cfd52a2aad1b74c56ecb46a9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5f1e784fd38990fcea1cb886a6e2c99972edfb22, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b7609384d36cb0303a98f49a56a965714f5fae6e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=dafd9825e1f4ce945d76d3b46af79a3f162e9da1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b5fe79f64199bda21d529cda0cffbe878329f82f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ddd3d00de96d6ab28e8db6587bbc803d3f6b39f6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=6d73e2035e046c2bbe3b4caad35387ed1c7550dc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4ffbec8ad9ffda8daccb0e7a3adef656d847ebd2, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2d99a6ed0176c1ffbe9de63047f7e4400a7ac931, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=01bd476ab709c516470e74fd08f54074d31c19b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e1b6d36dcac415e99a02207c507582313b3b57ea, strippedsetuid ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3541638a6871762059904627fb8fde808eb8f3b4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=af85288e7b3f9d0ea77c9a06ce208b5a3f4c91cd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically link�x�������������������X��(
�������������*��$:����������������*�+�)����LUXYZ[\]^_`abklmn�����������������������������������				�	�	�	�	�	�	�	�	�	�	�	�	�	�	�	�








z

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
����������mnops���
t
u
~

�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�
�UVWX[rsz{|}��������������������������������������������������������������������������������������������������������
 !"#$%&'()*+,-./0123456789:;<=>ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghklmnopqrsv���������������������������������������������������������������������������������������������������������������������������������������������������������1.015.741.061.680.9991.405.0260031.051.071.061.220.655.0260030.011.080.060.030.030.030.030.031.041.181.421.100.230.050.080.030.031.132.851.10062.321.121.341.281.071.092.031.511.151.120.221.191.020.421.060.390.131.041.201.140.671.011.001.001.011.011.141.391.761.100.260.0160.260.171.111.142.401.071.021.081.201.4031.171.023.042.131.061.024.21.050.101.11.391.044.41.001.031.021.001.130.691.011.001.450.120.291.112.261.061.051.450.031.360.131.472.231.030.06060.030.641.091.201.021.280.021.082.021.021.031.041.044:5.26.3-423.el8_104:5.26.3-423.el8_10
4:5.26.0-3954:5.12.2	

 !"#$%&'()*+,-�x������������������X��(
Xi�������K��$�������������������� ruubygems build dependencies- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.3- fix build on non-Fedora with python3- Fix bz2 compression support for python3 (RhBug:1293652)- Revert reworked multiversion orphaned handling- Update to 0.6.15- Rebase to upstream b1ea392
- Enable bz2 compression support (Mikolaj Izdebski <mizdebsk@redhat.com>) (RhBug:1226647)- revert obsolete, as %python_provide does it (undocumented)- adjust obsolete for stupid packaging- python2-solv obsoletes python-solv (#1263230)- Rebuilt for https://fedoraproject.org/wiki/Changes/python3.5- Backport patches from upstream- Update to 0.6.14
- Backport patches from upstream- Update to 0.6.12- added compile flag to support rich dependencies
- new version adding MIPS support
- Distribute testsolv in -tools subpackage (Igor Gnatenko)
- Enable python3 bindings for fedora (Igor Gnatenko)- make bindings require the exact matching version of the lib (#1243737)- new version fixing segfault
- RbConfig fixed in the upstream (1928f1a), libsolv-ruby22-rbconfig.patch erased- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- new version fixing segfault- Rebuilt with new provides selection feature- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.2- Update to latest upstream release to fix a crash in PackageKit.- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebase to upstream 12af31a- Rebase to upstream 5bd9589- Rebase to upstream 2a5c1c4
- Filename selector can start with a star- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Rebase to upstream 6d968f1
- Fix RhBug:1049209- Rebase to 0.6.0, upstream commit f78f5de.- Rebuilt for https://fedoraproject.org/wiki/Changes/Ruby_2.1- Rebase to 0.6.0, upstream commit 05baf54.- Rebase upstream bcedc98
- Fix RhBug:1051917.- Rebase to 0.4.1, upstream commit a8e47f1.- Rebase to 0.4.0, upstream commit 4442b7f.
- support DELTA_LOCATION_BASE for completeness- Rebase to 0.4.0, upstream commit d49d319.- Perl 5.18 rebuild- Rebase to upstream a59d11d.- Add build flags, including Deb, Arch, LZMA and MULTI_SEMANTICS. (RhBug:985905)- Perl 5.18 rebuild- Rebase to upstream 228d412.
- Fixes hawkey github issue https://github.com/akozumpl/hawkey/issues/13- Rebase to upstream 209e9cb.
- Package the new man pages.- Run 'make test' with libsolv build.- Rebase to upstream 7399ad1.
- Fixes RhBug:905209- Rebase to upstream e372b78.
- Fixes RhBug:e372b78- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebase to upstream 6c9d3eb.
- Drop the solv.i stdbool.h fix integrated upstream.
- Dropped the job reasons fix.- Fix build problems with Perl bindings.- Rebuilt after a failed mass rebuild.- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- preliminary fix for JOB resons in solver_describe_decision().- Rebase to upstream 1617994.
- Support for RPM_ADD_WITH_HDRID.- Rebase to upstream d39a42b.
- Fix the epochs.
- Move the ruby modules into vendorarch dir, where they are expected.- Rebase to upstream 8cf7650.
- ruby bindings: fix USE_VENDORDIRS for Fedora.- Rebase to the upstream.
- Make repo_add_solv() work without stub repodata.- Rebuild for the new libdb package.- Rebuild for the new rpm package.- New upstream version, fix the .rpm release number.- New upstream version.- Adapted to Ruby 1.9.3 (workaround for broken CMake in Fedora and
  ruby template correction in bindings)- Initial packaging
- Based on Jindra Novy's spec file
- Based on upstream spec file	
�������0.7.20-6.el80.7.20-6.el8.build-ida41ef2a076fb9767824ed44e7c17321c0effaf50db70ab2422666bdc4ca19fd25d7a8a1bace05015libsolv.so.1libsolvext.so.1libsolvREADMElibsolvLICENSE.BSD/usr/lib//usr/lib/.build-id//usr/lib/.build-id/a4//usr/lib/.build-id/db//usr/lib64//usr/share/doc//usr/share/doc/libsolv//usr/s�x�������������x�����X���(
��������`�-X�$=����������������-X.X,X�			�x������������������X��(
p�X����B��$R����������������B�C�A��891f2a936c210ec05482aed17772483cd3fee2f9925b01662c49bfb46ab98306e188ea0604e21cb663c03ba84ff0cdb5b2939ae4f103ef1fbe7d571b699e0e7d5cfc47738dde9838c68df0e9f3e873fb1133ec758d1139fc6b2ef8ad6c4e33100a5f37fb8398f1b957a3b09d7bb6c3276dfef3fafd0fabb5c2d0df5db1d4e5df9a5fd4c3848d7bebaaa37b3da4380cb4fd7d1131721136b9e5301e559261a3caebca84850d7c62ad578e08a2e5532cc3f7f32ca3fffeb1fbbd175b17287e8ad1bbb36706a65df097012d4934f3ebb5290d9d60d825588d1ac1d46d5cdedbafd8e92be03614f6a4c537f8cd80ea616cdd15542c7dec171c78f5e0cc3b16e679a04204715bd1008699a3fd5e5d6ac408b223cf7da60f7c8bc06b5bc5ddc7a010d6fe4d3db0b49fd36e1118bfe8a9c34238ad5981addbe295a7b604b42c23a0e6a53eb32b1be6241338683a8ce6126eb7dea63fe097918bc92bc95ec34de5e198b4169b43d320d70bf61216571d4a0a37c6d9bbc62c0b9b71ead39ccc9b031ac9b44d8bed131f941a93a899b2535aa0cb0dcf13e4becaa9fd7ef2ae02bf732f7c5a5b09aa9fd66865e08ac72b90a8fc2a32146be3f2a9e2eb71d4ad61246355ad38b03e9f7f4d703a054e0bbe3c080a289997456b0ca041e2eb678043040dcf58d7aa49ee770ff1565b6b73773a33227ef0a251dcfa2c8f8834d4501d24f9125f4fe82ad965763f299df64aae7a087ac316480fae617870529536bb6aecf998a5d9366c1109b1818ea589950ad27416f98f713e43f952f8e1b5b3e23221b6801dc0f945fc27a1ee08a70acb349822a49f177d586849b98aebfc2610a7e058a2bd15857e2128f8a0f274fcc0a67105c2d78edeb3312ecabb5eddd798b89c8a1c90710961c1e65dc8a3b3e5364c51ff2b0082840a1efa7a7dbe0bb9c323cb34e707cc226e6b6a3cff96aa4ee0688a67c2be4a71a47124b0ce25ec34358642703ff05b546b2ac42b4f2081ab7610d8373dd94c6b78040cf4../../../../usr/lib64/perl5/auto/Unicode/Normalize/Normalize.so../../../../usr/lib64/perl5/auto/File/DosGlob/DosGlob.so../../../../usr/lib64/perl5/auto/Hash/Util/FieldHash/FieldHash.so../../../../usr/lib64/perl5/auto/DB_File/DB_File.so../../../../usr/lib64/perl5/auto/Hash/Util/Util.so../../../../usr/lib64/perl5/auto/Storable/Storable.so../../../../usr/lib64/perl5/auto/Compress/Raw/Bzip2/Bzip2.so../../../../usr/lib64/perl5/auto/Encode/KR/KR.so../../../../usr/lib64/perl5/auto/attributes/attributes.so../../../../usr/lib64/perl5/auto/GDBM_File/GDBM_File.so../../../../usr/lib64/perl5/auto/Fcntl/Fcntl.so../../../../usr/lib64/perl5/auto/Sys/Syslog/Syslog.so../../../../usr/lib64/perl5/auto/Data/Dumper/Dumper.so../../../../usr/lib64/perl5/auto/Sys/Hostname/Hostname.so../../../../usr/lib64/perl5/auto/Encode/EBCDIC/EBCDIC.so../../../../usr/lib64/perl5/auto/Math/BigInt/FastCalc/FastCalc.so../../../../usr/lib64/perl5/auto/Encode/Symbol/Symbol.so../../../../usr/lib64/perl5/auto/PerlIO/mmap/mmap.so../../../../usr/lib64/perl5/auto/mro/mro.so../../../../usr/lib64/perl5/auto/MIME/Base64/Base64.so../../../../usr/lib64/perl5/auto/Tie/Hash/NamedCapture/NamedCapture.so../../../../usr/lib64/perl5/auto/Encode/Unicode/Unicode.so../../../../usr/lib64/perl5/auto/threads/threads.so../../../../usr/lib64/perl5/auto/IPC/SysV/SysV.so../../../../usr/lib64/perl5/auto/B/B.so../../../../usr/lib64/perl5/auto/Encode/TW/TW.so../../../../usr/lib64/perl5/auto/Unicode/Collate/Collate.so../../../../usr/lib64/perl5/auto/SDBM_File/SDBM_File.so../../../../usr/lib64/perl5/auto/Encode/CN/CN.so../../../../usr/lib64/perl5/auto/Time/HiRes/HiRes.so../../../../usr/lib64/perl5/auto/File/Glob/Glob.so../../../../usr/lib64/perl5/auto/Time/Piece/Piece.so../../../../usr/lib64/perl5/auto/Encode/Encode.so../../../../usr/lib64/perl5/auto/threads/shared/shared.so../../../../usr/lib64/perl5/auto/I18N/Langinfo/Langinfo.so../../../../usr/lib64/perl5/auto/Cwd/Cwd.so../../../../usr/lib64/perl5/auto/Compress/Raw/Zlib/Zlib.so../../../../usr/lib64/perl5/auto/Devel/Peek/Peek.so../../../../usr/lib64/perl5/auto/NDBM_File/NDBM_File.so../../../../usr/lib64/perl5/auto/Socket/Socket.so../../../../usr/lib64/perl5/auto/re/re.so../../../../usr/lib64/perl5/auto/Encode/JP/JP.so../../../../usr/lib64/perl5/auto/ODBM_File/ODBM_File.so../../../../usr/lib64/perl5/auto/Opcode/Opcode.so../../../../usr/bin/perl../../../../usr/bin/perl5.26.3../../../../usr/lib64/perl5/auto/Digest/SHA/SHA.so../../../../usr/lib64/perl5/auto/Digest/MD5/MD5.so../..�x�������������hx����X�V�(
���������~����d�$�����������������d�d�d�hyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>Bernhard Rosenkrdnzer <bero@redhat.de>- Backport fix SSL_select_next proto from OpenSSL 3.2
  Fix CVE-2024-5535 
  Resolves: RHEL-45654- Backport implicit rejection mechanism for RSA PKCS#1 v1.5 to RHEL-8 series
  (a proper fix for CVE-2020-25659)
  Resolves: RHEL-17694- Fix CVE-2023-5678: Generating excessively long X9.42 DH keys or checking
  excessively long X9.42 DH keys or parameters may be very slow
  Resolves: RHEL-16536- Fix CVE-2023-3446: Excessive time spent checking DH keys and parameters
  Resolves: RHEL-14243
- Fix CVE-2023-3817: Excessive time spent checking DH q parameter value
  Resolves: RHEL-14237- Fixed Timing Oracle in RSA Decryption
  Resolves: CVE-2022-4304
- Fixed Double free after calling PEM_read_bio_ex
  Resolves: CVE-2022-4450
- Fixed Use-after-free following BIO_new_NDEF
  Resolves: CVE-2023-0215- Fixed X.400 address type confusion in X.509 GeneralName
  Resolves: CVE-2023-0286- Fix CVE-2022-2097: AES OCB fails to encrypt some bytes on 32-bit x86
  Resolves: CVE-2022-2097
- Update expired certificates used in the testsuite
  Resolves: rhbz#2100554
- Fix CVE-2022-1292: openssl: c_rehash script allows command injection
  Resolves: rhbz#2090371
- Fix CVE-2022-2068: the c_rehash script allows command injection
  Resolves: rhbz#2098278- Fixes CVE-2022-0778 openssl: Infinite loop in BN_mod_sqrt() reachable when parsing certificates
- Resolves: rhbz#2067145- Fixes CVE-2021-3712 openssl: Read buffer overruns processing ASN.1 strings
- Resolves: rhbz#2005402- Fixes bugs in s390x AES code.
- Uses the first detected address family if IPv6 is not available
- Reverts the changes in https://github.com/openssl/openssl/pull/13305
  as it introduces a regression if server has a DSA key pair, the handshake fails
  when the protocol is not explicitly set to TLS 1.2. However, if the patch is reverted,
  it has an effect on the "ssl_reject_handshake" feature in nginx. Although, this feature
  will continue to work, TLS 1.3 protocol becomes unavailable/disabled. This is already
  known - https://trac.nginx.org/nginx/ticket/2071#comment:1
  As per https://github.com/openssl/openssl/issues/16075#issuecomment-879939938, nginx
  could early callback instead of servername callback.
- Resolves: rhbz#1978214
- Related: rhbz#1934534- Cleansup the peer point formats on renegotiation
- Resolves rhbz#1965362- Fixes FIPS_selftest to work in FIPS mode. Resolves: rhbz#1940085
- Using safe primes for FIPS DH self-test- Update to version 1.1.1k- Use AI_ADDRCONFIG only when explicit host name is given
- Allow only curves defined in RFC 8446 in TLS 1.3- Remove 2-key 3DES test from FIPS_selftest- Fix CVE-2021-3450 openssl: CA certificate check bypass with
  X509_V_FLAG_X509_STRICT
- Fix CVE-2021-3449 NULL pointer deref in signature_algorithms processing- Fix CVE-2020-1971 ediparty null pointer dereference- Implemented new FIPS requirements in regards to KDF and DH selftests
- Disallow certificates with explicit EC parameters- Further changes for SP 800-56A rev3 requirements- Rewire FIPS_drbg API to use the RAND_DRBG
- Use the well known DH groups in TLS even for 2048 and 1024 bit parameters- Disallow dropping Extended Master Secret extension
  on renegotiation
- Return alert from s_server if ALPN protocol does not match
- SHA1 is allowed in @SECLEVEL=2 only if allowed by
  TLS SigAlgs configuration- Add FIPS selftest for PBKDF2 and KBKDF- Allow only well known DH groups in the FIPS mode- update to the 1.1.1g release
- FIPS module installed state definition is modified- add selftest of the RAND_DRBG implementation- fix incorrect error return value from FIPS_selftest_dsa
- S390x: properly restore SIGILL signal h�x�����0�������pg����X��(
���������z���(��$8����������������(�)�'��b84e20310f142338ea72aa6d8b75688681ea0d4b45aa0e8f87644855f734112d8ff9b4e42fc4287d5bb6b018a2d4576a7383cb0ff03607febebb22ed85e20c8cd934e7946ef9fdbb1d0007de52cd226f40296e03e535036906a748b622a828c8f41a639395cd88c5d56571619f9a81cd070ea08b12a4166ebd5dba938a05ccdfb42df1eb4a8eac8895d25667f73eff1ebeb5fa00da94e7663f0066012bb0b9522f2ce363ed66348c2486233cf8e50702aea59b737f7d32ac68864433946252d4001c6e8db25afc790fb0dc1caa06663c9885480e63708fdc806064e39d41432fe06c529abd1c3eb4d79a84be19a9d2be6f892f49478b936ad13c6f6b3dbd5cecb23e10c81aac312857af59307dbfcf2ff67d1c0ca671ead462a91152e7f855b53e57aba52c5572d9fe81a2a129fcf1f2a8049781c3dc56cfbb5373b270e134ff7d865c06382ff5a67f362d3a1b805710abe4667f3110413ce8480e525003f1de86ce1edc3891e8b6fee8f3029873bc4d23ab94b4f545cca420fece9674e3956a68e081089cd53a39e2a1ea0aeba50f148939b35db95bfc87482d6416fe8a93b3518174af42fc2643796cbfaf7fd0ee26de99d9a58f059b30b73e64f86983e0d728a343d4a89e31820e554b1f0aaa64842a156c0486f77b2bc9263fd8d2eb31b49b892e685a2622685f0db1f52fc83bfea6f0f78f27bafb41ea9816b06f0e9c3b5bb94ae02bd491e54b0b5d068afce3a4dbeaafaec2475b32e35d4ad37974526ccb2295248594e0a59c9b04789c86a4ea61450db28b49d222b6badb99e2485f43943117291c1c3d9af9d222b6badb99e2485f43943117291c1c3d9af.1b519d28e64cd72c01be2bab8ef34af59aa31be0eb72c551263ed75c3592bf6ee97b7193cd0b803b4c2a9c27a61d461d7d8abc060374f3d0cd93cbec3c95699abb089d63ec4395b9814f1d88b592740ddccb6c005d0465d0d07b495285a1f5a68c16aa864ce57a59ae7dbfafafd594375b1769e14da5d4fe8d032ab4c9b18c194418c0a964fa2c48ca1860859da99d3c3d0d6171f840e14fb6a4f38b490a627dee0b12d7ea2fd7cae12140a00da756abe0c14597fee4534ed175175d26b182e4de505564a26f85767ef3dbbac3ef6f3ff8d5fe2e8cb3050eb1fc1623dffc49ed5166a3a16af22eab118ab777a9455a009BB.pmConcise.pmShowlex.pmTerse.pmXref.pmConfig.pmConfig.podConfig_git.plConfig_heavy.plDynaLoader.pmFcntl.pmFileDosGlob.pmGlob.pmGDBM_File.pmHashUtilUtil.pmFieldHash.pmI18NLanginfo.pmIPCNDBM_File.pmO.pmODBM_File.pmOpcode.pmPOSIX.pmPOSIX.podPerlIOencoding.pmmmap.pmscalar.pmvia.pmSDBM_File.pmSysHostname.pmTieHashNamedCapture.pm_h2ph_pre.pharybase.pmasmasm-genericbitsperlong.phioctl.phioctls.phposix_types.phsocket.phsockios.phtermbits.phtermios.phbitsperlong.phioctl.phioctls.phposix_types.phposix_types_32.phposix_types_64.phposix_types_x32.phsocket.phsockios.phtermbits.phtermios.phunistd.phunistd_32.phunistd_64.phunistd_x32.phattributes.pmBB.soFcntlFcntl.soFileDosGlobDosGlob.soGlobGlob.soGDBM_FileGDBM_File.soHashUtilFieldHashFieldHash.soUtil.soI18NLanginfoLanginfo.soNDBM_FileNDBM_File.soODBM_FileODBM_File.soOpcodeOpcode.soPOSIXPOSIX.soPerlIOencodingencoding.sommapmmap.soscalarscalar.soviavia.soSDBM_FileSDBM_File.soSysHostnameHostname.soTieHashNamedCaptureNamedCapture.soarybasearybase.soattributesattributes.somromro.sobitsbyteswap.phendian.phioctl-types.phioctls.phlong-double.phpthreadtypes-arch.phpthreadtypes.phselect.phselect2.phsigaction.phsigcontext.phsigevent-consts.phsiginfo-arch.phsiginfo-consts-arch.phsiginfo-consts.phsignum-generic.phsignum.phsigstack.phsigthread.phsockaddr.phsocket.phsocket2.phsocket_type.phss_flags.phstdint-intn.phsyscall.phsyslog-ldbl.phsyslog-path.phsyslog.phthread-shared-types.phtypestypes.ph__sigset_t.ph__sigval_t.phclock_t.phclockid_t.phsig_atomic_t.phsigevent_t.phsiginfo_t.phsigset_t.phsigval_t.phstack_t.phstruct_iovec.phstruct_osockaddr.phstruct_rusage.phstruct_sigstack.phstruct_timespec.phstruct_timeval.phtime_t.phtimer_t.phtypesizes.phuintn-identity.phwaitflags.phwaitstatus.phwordsize.phendian.phfeatures.phgnustubs-64.phstubs.phlib.pmlinuxioctl.phposix_types.phstddef.phmachinemro.pmops.pmsignal.phstdarg.phstdc-predef.phstddef.phsyscdefs.phioctl.phselect.phsocket.phsyscall.phsyslog.phtime.phttydefaults.phtypes.phucontext.phwait.phsyscall.phsyslimits.phsyslog.phwait.phperl.1.gzperl5004delta.1.gzperl5005delta.1.gzperl5100�x�������������XW����X�{�(
���������kkd�${����������������kdldjd�nOIDs.3ssl.gzPROFESSION_INFO_set0_registrationNumber.3ssl.gzPROXY_CERT_INFO_EXTENSION_free.3ssl.gzPROXY_CERT_INFO_EXTENSION_new.3ssl.gzPROXY_POLICY_free.3ssl.gzPROXY_POLICY_new.3ssl.gzRAND_DRBG_bytes.3ssl.gzRAND_DRBG_cleanup_entropy_fn.3ssl.gzRAND_DRBG_cleanup_nonce_fn.3ssl.gzRAND_DRBG_free.3ssl.gzRAND_DRBG_generate.3ssl.gzRAND_DRBG_get0_master.3ssl.gzRAND_DRBG_get0_private.3ssl.gzRAND_DRBG_get0_public.3ssl.gzRAND_DRBG_get_entropy_fn.3ssl.gzRAND_DRBG_get_ex_data.3ssl.gzRAND_DRBG_get_ex_new_index.3ssl.gzRAND_DRBG_get_nonce_fn.3ssl.gzRAND_DRBG_instantiate.3ssl.gzRAND_DRBG_new.3ssl.gzRAND_DRBG_reseed.3ssl.gzRAND_DRBG_secure_new.3ssl.gzRAND_DRBG_set.3ssl.gzRAND_DRBG_set_callbacks.3ssl.gzRAND_DRBG_set_defaults.3ssl.gzRAND_DRBG_set_ex_data.3ssl.gzRAND_DRBG_set_reseed_defaults.3ssl.gzRAND_DRBG_set_reseed_interval.3ssl.gzRAND_DRBG_set_reseed_time_interval.3ssl.gzRAND_DRBG_uninstantiate.3ssl.gzRAND_OpenSSL.3ssl.gzRAND_add.3ssl.gzRAND_bytes.3ssl.gzRAND_cleanup.3ssl.gzRAND_egd.3ssl.gzRAND_egd_bytes.3ssl.gzRAND_event.3ssl.gzRAND_file_name.3ssl.gzRAND_get_rand_method.3ssl.gzRAND_keep_random_devices_open.3ssl.gzRAND_load_file.3ssl.gzRAND_poll.3ssl.gzRAND_priv_bytes.3ssl.gzRAND_pseudo_bytes.3ssl.gzRAND_query_egd_bytes.3ssl.gzRAND_screen.3ssl.gzRAND_seed.3ssl.gzRAND_set_rand_method.3ssl.gzRAND_status.3ssl.gzRAND_write_file.3ssl.gzRC4.3ssl.gzRC4_set_key.3ssl.gzRIPEMD160.3ssl.gzRIPEMD160_Final.3ssl.gzRIPEMD160_Init.3ssl.gzRIPEMD160_Update.3ssl.gzRSAPrivateKey_dup.3ssl.gzRSAPublicKey_dup.3ssl.gzRSA_OAEP_PARAMS_free.3ssl.gzRSA_OAEP_PARAMS_new.3ssl.gzRSA_PKCS1_OpenSSL.3ssl.gzRSA_PSS_PARAMS_free.3ssl.gzRSA_PSS_PARAMS_new.3ssl.gzRSA_bits.3ssl.gzRSA_blinding_off.3ssl.gzRSA_blinding_on.3ssl.gzRSA_check_key.3ssl.gzRSA_check_key_ex.3ssl.gzRSA_clear_flags.3ssl.gzRSA_flags.3ssl.gzRSA_free.3ssl.gzRSA_generate_key.3ssl.gzRSA_generate_key_ex.3ssl.gzRSA_generate_multi_prime_key.3ssl.gzRSA_get0_crt_params.3ssl.gzRSA_get0_d.3ssl.gzRSA_get0_dmp1.3ssl.gzRSA_get0_dmq1.3ssl.gzRSA_get0_e.3ssl.gzRSA_get0_engine.3ssl.gzRSA_get0_factors.3ssl.gzRSA_get0_iqmp.3ssl.gzRSA_get0_key.3ssl.gzRSA_get0_multi_prime_crt_params.3ssl.gzRSA_get0_multi_prime_factors.3ssl.gzRSA_get0_n.3ssl.gzRSA_get0_p.3ssl.gzRSA_get0_pss_params.3ssl.gzRSA_get0_q.3ssl.gzRSA_get_default_method.3ssl.gzRSA_get_ex_data.3ssl.gzRSA_get_ex_new_index.3ssl.gzRSA_get_method.3ssl.gzRSA_get_multi_prime_extra_count.3ssl.gzRSA_get_version.3ssl.gzRSA_meth_dup.3ssl.gzRSA_meth_free.3ssl.gzRSA_meth_get0_app_data.3ssl.gzRSA_meth_get0_name.3ssl.gzRSA_meth_get_bn_mod_exp.3ssl.gzRSA_meth_get_finish.3ssl.gzRSA_meth_get_flags.3ssl.gzRSA_meth_get_init.3ssl.gzRSA_meth_get_keygen.3ssl.gzRSA_meth_get_mod_exp.3ssl.gzRSA_meth_get_multi_prime_keygen.3ssl.gzRSA_meth_get_priv_dec.3ssl.gzRSA_meth_get_priv_enc.3ssl.gzRSA_meth_get_pub_dec.3ssl.gzRSA_meth_get_pub_enc.3ssl.gzRSA_meth_get_sign.3ssl.gzRSA_meth_get_verify.3ssl.gzRSA_meth_new.3ssl.gzRSA_meth_set0_app_data.3ssl.gzRSA_meth_set1_name.3ssl.gzRSA_meth_set_bn_mod_exp.3ssl.gzRSA_meth_set_finish.3ssl.gzRSA_meth_set_flags.3ssl.gzRSA_meth_set_init.3ssl.gzRSA_meth_set_keygen.3ssl.gzRSA_meth_set_mod_exp.3ssl.gzRSA_meth_set_multi_prime_keygen.3ssl.gzRSA_meth_set_priv_dec.3ssl.gzRSA_meth_set_priv_enc.3ssl.gzRSA_meth_set_pub_dec.3ssl.gzRSA_meth_set_pub_enc.3ssl.gzRSA_meth_set_sign.3ssl.gzRSA_meth_set_verify.3ssl.gzRSA_new.3ssl.gzRSA_new_method.3ssl.gzRSA_padding_add_PKCS1_OAEP.3ssl.gzRSA_padding_add_PKCS1_OAEP_mgf1.3ssl.gzRSA_padding_add_PKCS1_type_1.3ssl.gzRSA_padding_add_PKCS1_type_2.3ssl.gzRSA_padding_add_SSLv23.3ssl.gzRSA_padding_add_none.3ssl.gzRSA_padding_check_PKCS1_OAEP.3ssl.gzRSA_padding_check_PKCS1_OAEP_mgf1.3ssl.gzRSA_padding_check_PKCS1_type_1.3ssl.gzRSA_padding_check_PKCS1_type_2.3ssl.gzRSA_padding_check_SSLv23.3ssl.gzRSA_padding_check_none.3ssl.gzRSA_print.3ssl.gzRSA_print_fp.3ssl.gzRSA_private_decrypt.3ssl.gzRSA_private_encrypt.3ssl.gzRSA_public_decrypt.3ssl.gzRSA_public_encrypt.3ssl.gzRSA_security_b�x������`F����XJg�(
�1������d�$o����������������d�d~d�efghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~���������x�����8k�������5����X;Ț(
���������"��$v��������������������yped-arrays))bundled(npm(call-bind))bundled(npm(date-fns))bundled(npm(deep-equal))bundled(npm(define-data-property))bundled(npm(define-properties))bundled(npm(es-get-iterator))bundled(npm(file-selector))bundled(npm(focus-trap))bundled(npm(for-each))bundled(npm(function-bind))bundled(npm(functions-have-names))bundled(npm(get-intrinsic))bundled(npm(gopd))bundled(npm(has-bigints))bundled(npm(has-property-descriptors))bundled(npm(has-proto))bundled(npm(has-symbols))bundled(npm(has-tostringtag))bundled(npm(hasown))bundled(npm(internal-slot))bundled(npm(is-arguments))bundled(npm(is-array-buffer))bundled(npm(is-bigint))bundled(npm(is-boolean-object))bundled(npm(is-callable))bundled(npm(is-date-object))bundled(npm(is-map))bundled(npm(is-number-object))bundled(npm(is-regex))bundled(npm(is-set))bundled(npm(is-shared-array-buffer))bundled(npm(is-string))bundled(npm(is-symbol))bundled(npm(is-typed-array))bundled(npm(is-weakmap))bundled(npm(is-weakset))bundled(npm(isarray))bundled(npm(js-sha1))bundled(npm(js-sha256))bundled(npm(js-tokens))bundled(npm(json-stable-stringify-without-jsonify))bundled(npm(lodash))bundled(npm(loose-envify))bundled(npm(object-assign))bundled(npm(object-inspect))bundled(npm(object-is))bundled(npm(object-keys))bundled(npm(object.assign))bundled(npm(prop-types))bundled(npm(react))bundled(npm(react-dom))bundled(npm(react-dropzone))bundled(npm(react-is))bundled(npm(regexp.prototype.flags))bundled(npm(remarkable))bundled(npm(scheduler))bundled(npm(set-function-length))bundled(npm(set-function-name))bundled(npm(side-channel))bundled(npm(sprintf-js))bundled(npm(stop-iteration-iterator))bundled(npm(tabbable))bundled(npm(throttle-debounce))bundled(npm(tslib))bundled(npm(uuid))bundled(npm(which-boxed-primitive))bundled(npm(which-collection))bundled(npm(which-typed-array))bundled(npm(xterm))bundled(npm(xterm-addon-canvas))cockpit-kdumpcockpit-networkmanagercockpit-selinuxcockpit-shellcockpit-sosreportcockpit-systemcockpit-systemdcockpit-tunedcockpit-users



/usr/bin/date/usr/bin/pwscoreNetworkManagercockpit-bridgegrepkexec-toolsrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadow-utilssossudo1.6310.5-1.el8_103.0.4-14.6.0-14.0-15.2-14.14.3hfp�f�@e��e�6@e��e�L@e|?�eg'�eT��eB=�e/�e�@e
�d�i�d��d�
�d���d� �d��@d��@d��@d���dx�@dcp@dRL�d?�d-b�d��d?@d	�@c��c�c��c�0�c���c���c��@c\�ct�ch�@cO�c*��c@c��c�b�b�c@b��@b��@b�U�b��@b��b|��bj��bj��bV�@bDF@b1�@b�b�@a�r@a�a�@aՈ@a��@a�)@a��@ay?@aim@af�@aTU@aA�@a/k@a�@a
�@`�@`�@`�@`�"@`��@`�8@`�	@`��@`�N@`v�@`dd@`Q�@`?z@`>(�`3��`-@`�`@`	l�_���_м@_���_���_��@_���_��@_ts@_a�@_O�@_=@_*�@_%Y@_��_*@_�@^��@^�@@^�b�^��@^�V@^��@^�l@^��@^��@^r
@^j$@^_�@^M#@^:�@^0"@^,-�^(9@^�@]�}@]�e@]��@]�{@]�W�]�@]��@]�@]v>�]o�@]]2@]J�@]9��]8H@]%�@\�@\��\�@\��@\��@\�@\mA@\Z�@\R�@\?�\5�@\I�[��@[�@[ٙ@[���[��[�:@[��@[j�@[a��[`O@[\Z�[Xf@[GB�[3|@[!@Z�@Z�@Z�3@Zľ@Z�I@Z��@Z}�@Zz�@Zz�@Zhu@Zc/@ZV@Z1@Z�Z
}�Z�@Y�B@Y��Y�p@Y��Yé�Y��@Y��@Y���Yx�@Yq�Y_w�YG��Y:��X��@X�s�X��@X�C�X�	@X��X�e@X��@XX�XQ4@X6�@X,J@X$a@X��X=�XT�W�@W�@W�@W�h�W�E@W��@W��W~D@Ws�@Wi,@WP�WH6�W>�@W4p@W)�@W!�@W�W�@V��@V��@V�@V�v�V���V��@Vy;@Vs�@Vii@Va�@VLh@V8��V0��V'~@VC�V	@V�V�@VB�U�Y�U�p�U�6@Uݪ@U��U�5@U�L@U��@U��@U��@U�K@U��U��@U��@U�a@Ux&�UlI@Ue��U_@U\w@US<�UJ@U:0@U6;�U/�@U-@U#�U�U�U:�U:�UF@U�U@U
]@U�U�U
�@U	h�U@U"�T��T�
�T��@T��@T��@T��@T��@T��@T��@T��@T~�@Ts�Te�TcK�TZ@TZ@TZ@T?�@T7�@T5'@T"�@Tw�T=@T�S�v�S�G�S�S�j@S��@S�;@S�@Sϣ�S�R@SǺ�S��@S�E�S�Q@S�h@S�"@S��@S���S8@S|�@Sy�@SsZ�SM@S=M@S5d@R�'�R��@R��@Martin Pitt <mpitt@redhat.com> - 310.5-1Martin Pitt <mpitt@redhat.com> - 310.4-1Martin Pitt <mpitt@redhat.com> - 310.3-1Packit <hello@packit.dev> - 310-1Packit <hello@packit.dev> - 309-1Packit <hello@packit.dev> - 308-1Martin Pitt <mpitt@redhat.com> - 307-1Packit <hello@packit.dev> - 306-1Packit <hell�x��������������%����X��(
��������h^���h�$x����������������hgi�8)- have fdisk compiled on sparc and arm- added beos partition type to fdisk- incorporate fdisk on all arches- restore PAM functionality at end of login (Bug #201)- patch top build on the arm without PAM and related utilities, for now.
- build hwclock only on intel- upgraded to version 2.9- build for Raw Hide (slang-1.2.2)
- patch kbdrate wackiness so it builds with egcs- patched more to use termcap- added warning about alpha/bsd label starting cylinder- use sigsetjmp/siglongjmp in more rather then sig'less versions- explicit attrs for setuid/setgid programs- sln is now included in glibc- add cbm1581 floppy definitions (problem #787)- remove /etc/nologin at end of shutdown/halt.- add mount/losetup.- update to 2.8 with 2.8b clean up. hostid now defunct?- "more" now works properly on sparc- Fix "fdisk -l" fault on mounted cdrom. (prob #513)- translations modified for de, fr, tr- manhattan rebuild- more didn't suspend properly on glibc
- use proper tc*() calls rather then ioctl's- fixed a security problem in chfn and chsh accepting too 
  long gecos fields- removed "." from default path- added (again) the vipw patch- minor cleanups for glibc 2.1- added vfat32 filesystem type to list recognized by fdisk- don't build clock on the alpha 
- don't install chkdupexe- Update to new pam standard.
- BuildRoot.- added rootok and setproctitle patches
- updated pam config files for chfn and chsh- updated MCONFIG to automatically determine the architecture
- added glibc header hacks to fdisk code
- rdev is only available on the intel- update to util-linux 2.7, fixed login problems- Merged Red Hat changes into main util-linux source, updated package to
  development util-linux (nearly 2.7).- LOG_AUTH --> LOG_AUTHPRIV in login and shutdown- Moved to new pam and from pam.conf to pam.d- pam.patch differentiated between different kinds of bad logins.
  In particular, "user does not exist" and "bad password" were treated
  differently.  This was a minor security hole./bin/sh/sbin/ldconfig�����������2.32.1-46.el82.32.1-46.el8.build-id9ca46ccf1b771b2ec51035a7433d34b6cf6b1bfalibblkid.so.1libblkid.so.1.1.0libblkidCOPYING/usr/lib//usr/lib/.build-id//usr/lib/.build-id/9c//usr/lib64//usr/share/doc//usr/share/doc/libblkid/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9ca46ccf1b771b2ec51035a7433d34b6cf6b1bfa, strippedASCII text$PPPPPPPPPPPP	P	P
P
PPPPPRRR	R
RRRRR
RRRRRRRutf-8cefcd22c55c886fe48d8c5b92e89d82681463092dd26fe3e4c0d5a5add4cc451?����^�3!�^���P,��*����%�f�
	*����%��l�/_�����8�	�k���'^�gT��ލ��1\M�`�y�H�hȹkKg�5����M���YGL�"��Q	W<�j'��ĄA��ąRf�pXKm���nf��J�^P�bSɒ��
��C� �8H�-yB$�&��]�m�2���Ƥ��iw�wՆ��n����۾��	Sc��A"+���D�-�
�5;cC���gr�~���?d��f����H�N����
�&��Q¢�;����
!)m�/a���?6��E�3�Ux���C�Mÿ�����IX'{�k5��r��tJ7�>�?$���������
�zN� ���Y].'�<�3&�y�4D"�OWh]F�֛?�	�վ3V�9U#�w��E����1��)���Α��ɜ����M��~�8Q����Bi��j7����AίCh�b�#�6Z���A��s�� ��g>
fW�A��R�S�~Q\(.b�f#����2'8�0 8/}���͍dg��/F�1�/�e�gՉ3!�^���P,��*����%�f�
	*����%��_�`jP�]�����v���D�c��z�&���%AZ�6U���U�!��P���"�7�#��O�=���M�u
��I��@^84�na�I� VC1�m*�6
��x�������������8����X���(
����������������W�$o�����������������W�WX�	

netstat.build-id02af365b659337a181e3bbc74c2081265a555a592ccb6154db43d8767dfa239c350c2120d02d465230f7800e8fc735d08c5f616808e7cbfdc95dfd2b40b7c9f8c4d55ac1108b0f1b54719ef7335de15963228349dc9a2c7d5608c8ab36cf98f6b09212df66d1da8dc35a2689564d55e21240382c810db0c768a7554a18ea9a7f506cadfa3d7a902349677c6c7a00217c1ffe409891288ea1c88b4abf972e1365814b605f356d262b51145367bec0e383ff3d983eb49a3a51086a05d35b08781e98d7ca2279eb4f86ee6cd6a112511ef4c948c1a73a115ecbf7e9e38ef6dcfaeb39c9920deba0f183ae63cf05dbe1fe8carp-ethers.servicearpether-wakeifconfigipmaddriptunnelmii-diagmii-toolnameifplipconfigrouteslattachnet-toolsCOPYINGnet-tools.monet-tools.monet-tools.monet-tools.monet-tools.moethers.5.gzarp.8.gzifconfig.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzethers.5.gzarp.8.gzifconfig.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzethers.5.gzarp.8.gzether-wake.8.gzifconfig.8.gzipmaddr.8.gziptunnel.8.gzmii-diag.8.gzmii-tool.8.gznameif.8.gznetstat.8.gzplipconfig.8.gzroute.8.gzslattach.8.gzarp.8.gzifconfig.8.gznetstat.8.gzroute.8.gz/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/02//usr/lib/.build-id/2c//usr/lib/.build-id/30//usr/lib/.build-id/40//usr/lib/.build-id/63//usr/lib/.build-id/66//usr/lib/.build-id/68//usr/lib/.build-id/7a//usr/lib/.build-id/81//usr/lib/.build-id/b4//usr/lib/.build-id/ee//usr/lib/.build-id/f6//usr/lib/systemd/system//usr/sbin//usr/share/licenses//usr/share/licenses/net-tools//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/de/LC_MESSAGES//usr/share/locale/et_EE/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/man/de/man5//usr/share/man/de/man8//usr/share/man/fr/man5//usr/share/man/fr/man8//usr/share/man/man5//usr/share/man/man8//usr/share/man/pt/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ee6cd6a112511ef4c948c1a73a115ecbf7e9e38e, strippeddirectoryASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2ccb6154db43d8767dfa239c350c2120d02d4652, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7a00217c1ffe409891288ea1c88b4abf972e1365, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=40b7c9f8c4d55ac1108b0f1b54719ef7335de159, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=632283�x������������������X���(
PP������P$���c�$s����������������cbd�h check to call make check- remove unused patches- remove floppy from util-linux- fix #948274 - interruption code 0x4003B in libmount.so.1.1.0- upgrade to the release 2.23-rc2- libblkid ntfs bugfix for build on s390- add upstream patches for to fix umount and mount.<type>- upgrade to the release 2.23-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.23/v2.23-ReleaseNotes
- add nsenter and blkdiscard
- remove tunelp- fix  #912778 - "runuser -l" doesn't register session to systemd- fix #902512 - Dependency failed for /home (and blkid fails to tell UUID)
- refresh old patches- improve convertion to mtab symlink in post script
- spec file cleanup (based on #894199)- fix #882305 - agetty: unstable /dev/tty* permissions
- fix #885314 - hexdump segfault
- fix #896447 - No newlines in piped "cal" command
- fix libblkid cache usage (upstream patch)
- fix #905008 - uuidd: /usr/sbin/uuidd has incorrect file permissions- fix #889888 - wipefs does not completely wipe btrfs volume- upgrade to upstream maintenance release 2.22.2- sources cleanup- fix #872787 - su: COMMAND not specified- backport upstream runuser(1)
- enable su(1)- apply pathes from upstream stable/v2.22 branch
- fix #865961 - wipefs -a should use O_EXCL- upgrade to the release 2.22.1- remove obsolete references to e2fsprogs- upgrade to the release 2.22
- enable eject(1) from util-linux, obsolete original eject package
- fix #853164 - setuid program should have full RELRO
- fix #851230 - probe_ntfs: /usr/sbin/blkid was killed by SIGSEGV- upgrade to the release 2.22-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.22/v2.22-ReleaseNotes
- add sulogin, utmpdump, lslocks, wdctl- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- replace udev dependenceis with systemd- upgrade to bugfix release 2.21.2
- fix #814699 - namei(1) incorrectly resolves relative symlinks
- fix #820707 - Impossible to unmount nfsv4/krb5 mounts after network disconnect
- fix #816877 - libmount does not close device fd before mount(2)
- fix #822705 - unable to login after installing- upgrade to bugfix release 2.21.1- upgrade to release 2.21- fix #788703 - /run/blkid does not exist- upgrade to the release 2.21-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.21/v2.21-ReleaseNotes
- add {fsck,mkfs}.minix
- add new command chcpu(8)
- add new command prlimit(1)
- enable raw(8) command
- move 60-raw.rules from /etc from /usr/lib/udev/rules.d
- move blkid cache from etc to /run/blkid- install everything in /usr
  https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fix #748216 - util-linux requires pam >= 1.1.3-7
- remove ddate(1)- Rebuilt for glibc bug#747377- upgrade to the release 2.20.1
  ftp://ftp.infradead.org/pub/util-linux/v2.20/v2.20.1-ReleaseNotes- upgrade to the release 2.20- upgrade to the release 2.20-rc2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-rc2-ChangeLog- upgrade to the release 2.20-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.20/v2.20-ReleaseNotes- fix #716483 - /var/tmp --(BIND-mounted)--> /tmp disrupts/hangs bootup
- fix #709681 - failure to mount if a mount point ends with a slash in /etc/fstab
- fix #709319 - 'mount -a' mounts already mounted directories
- fix kernel version parsing- upgrade to the release 2.19.1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-ReleaseNotes- upgrade to the release 2.19.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19.1-rc1-ChangeLog- fix #682502 - Broken source URL to floppy tarball, new version available
- upgrade to floppy-0.18- upgrade to the release 2.19
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-ReleaseNotes
- remove /sbin/mount.tmpfs -- integrated to mount(8)- fix #665062 - add support for the postlogin PAM stack to util-linux-ng- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- upgrade to the release 2.19-rc3
  ftp://ftp.kernel.org/pub/linux/utils/util-linux/v2.19/v2.19-rc3�x�����xI������������X�v�(
8��pd�$`����������������pdqdod�ustom.3ssl.gzEVP_PKEY_meth_set_digestsign.3ssl.gzEVP_PKEY_meth_set_digestverify.3ssl.gzEVP_PKEY_meth_set_encrypt.3ssl.gzEVP_PKEY_meth_set_init.3ssl.gzEVP_PKEY_meth_set_keygen.3ssl.gzEVP_PKEY_meth_set_param_check.3ssl.gzEVP_PKEY_meth_set_paramgen.3ssl.gzEVP_PKEY_meth_set_public_check.3ssl.gzEVP_PKEY_meth_set_sign.3ssl.gzEVP_PKEY_meth_set_signctx.3ssl.gzEVP_PKEY_meth_set_verify.3ssl.gzEVP_PKEY_meth_set_verify_recover.3ssl.gzEVP_PKEY_meth_set_verifyctx.3ssl.gzEVP_PKEY_missing_parameters.3ssl.gzEVP_PKEY_new.3ssl.gzEVP_PKEY_new_CMAC_key.3ssl.gzEVP_PKEY_new_mac_key.3ssl.gzEVP_PKEY_new_raw_private_key.3ssl.gzEVP_PKEY_new_raw_public_key.3ssl.gzEVP_PKEY_param_check.3ssl.gzEVP_PKEY_paramgen.3ssl.gzEVP_PKEY_paramgen_init.3ssl.gzEVP_PKEY_print_params.3ssl.gzEVP_PKEY_print_private.3ssl.gzEVP_PKEY_print_public.3ssl.gzEVP_PKEY_public_check.3ssl.gzEVP_PKEY_security_bits.3ssl.gzEVP_PKEY_set1_DH.3ssl.gzEVP_PKEY_set1_DSA.3ssl.gzEVP_PKEY_set1_EC_KEY.3ssl.gzEVP_PKEY_set1_RSA.3ssl.gzEVP_PKEY_set1_engine.3ssl.gzEVP_PKEY_set_alias_type.3ssl.gzEVP_PKEY_sign.3ssl.gzEVP_PKEY_sign_init.3ssl.gzEVP_PKEY_size.3ssl.gzEVP_PKEY_type.3ssl.gzEVP_PKEY_up_ref.3ssl.gzEVP_PKEY_verify.3ssl.gzEVP_PKEY_verify_init.3ssl.gzEVP_PKEY_verify_recover.3ssl.gzEVP_PKEY_verify_recover_init.3ssl.gzEVP_SealFinal.3ssl.gzEVP_SealInit.3ssl.gzEVP_SealUpdate.3ssl.gzEVP_SignFinal.3ssl.gzEVP_SignInit.3ssl.gzEVP_SignInit_ex.3ssl.gzEVP_SignUpdate.3ssl.gzEVP_VerifyFinal.3ssl.gzEVP_VerifyInit.3ssl.gzEVP_VerifyInit_ex.3ssl.gzEVP_VerifyUpdate.3ssl.gzEVP_aes.3ssl.gzEVP_aes_128_cbc.3ssl.gzEVP_aes_128_cbc_hmac_sha1.3ssl.gzEVP_aes_128_cbc_hmac_sha256.3ssl.gzEVP_aes_128_ccm.3ssl.gzEVP_aes_128_cfb.3ssl.gzEVP_aes_128_cfb1.3ssl.gzEVP_aes_128_cfb128.3ssl.gzEVP_aes_128_cfb8.3ssl.gzEVP_aes_128_ctr.3ssl.gzEVP_aes_128_ecb.3ssl.gzEVP_aes_128_gcm.3ssl.gzEVP_aes_128_ocb.3ssl.gzEVP_aes_128_ofb.3ssl.gzEVP_aes_128_wrap.3ssl.gzEVP_aes_128_wrap_pad.3ssl.gzEVP_aes_128_xts.3ssl.gzEVP_aes_192_cbc.3ssl.gzEVP_aes_192_ccm.3ssl.gzEVP_aes_192_cfb.3ssl.gzEVP_aes_192_cfb1.3ssl.gzEVP_aes_192_cfb128.3ssl.gzEVP_aes_192_cfb8.3ssl.gzEVP_aes_192_ctr.3ssl.gzEVP_aes_192_ecb.3ssl.gzEVP_aes_192_gcm.3ssl.gzEVP_aes_192_ocb.3ssl.gzEVP_aes_192_ofb.3ssl.gzEVP_aes_192_wrap.3ssl.gzEVP_aes_192_wrap_pad.3ssl.gzEVP_aes_256_cbc.3ssl.gzEVP_aes_256_cbc_hmac_sha1.3ssl.gzEVP_aes_256_cbc_hmac_sha256.3ssl.gzEVP_aes_256_ccm.3ssl.gzEVP_aes_256_cfb.3ssl.gzEVP_aes_256_cfb1.3ssl.gzEVP_aes_256_cfb128.3ssl.gzEVP_aes_256_cfb8.3ssl.gzEVP_aes_256_ctr.3ssl.gzEVP_aes_256_ecb.3ssl.gzEVP_aes_256_gcm.3ssl.gzEVP_aes_256_ocb.3ssl.gzEVP_aes_256_ofb.3ssl.gzEVP_aes_256_wrap.3ssl.gzEVP_aes_256_wrap_pad.3ssl.gzEVP_aes_256_xts.3ssl.gzEVP_aria.3ssl.gzEVP_aria_128_cbc.3ssl.gzEVP_aria_128_ccm.3ssl.gzEVP_aria_128_cfb.3ssl.gzEVP_aria_128_cfb1.3ssl.gzEVP_aria_128_cfb128.3ssl.gzEVP_aria_128_cfb8.3ssl.gzEVP_aria_128_ctr.3ssl.gzEVP_aria_128_ecb.3ssl.gzEVP_aria_128_gcm.3ssl.gzEVP_aria_128_ofb.3ssl.gzEVP_aria_192_cbc.3ssl.gzEVP_aria_192_ccm.3ssl.gzEVP_aria_192_cfb.3ssl.gzEVP_aria_192_cfb1.3ssl.gzEVP_aria_192_cfb128.3ssl.gzEVP_aria_192_cfb8.3ssl.gzEVP_aria_192_ctr.3ssl.gzEVP_aria_192_ecb.3ssl.gzEVP_aria_192_gcm.3ssl.gzEVP_aria_192_ofb.3ssl.gzEVP_aria_256_cbc.3ssl.gzEVP_aria_256_ccm.3ssl.gzEVP_aria_256_cfb.3ssl.gzEVP_aria_256_cfb1.3ssl.gzEVP_aria_256_cfb128.3ssl.gzEVP_aria_256_cfb8.3ssl.gzEVP_aria_256_ctr.3ssl.gzEVP_aria_256_ecb.3ssl.gzEVP_aria_256_gcm.3ssl.gzEVP_aria_256_ofb.3ssl.gzEVP_bf_cbc.3ssl.gzEVP_bf_cfb.3ssl.gzEVP_bf_cfb64.3ssl.gzEVP_bf_ecb.3ssl.gzEVP_bf_ofb.3ssl.gzEVP_blake2b512.3ssl.gzEVP_blake2s256.3ssl.gzEVP_camellia.3ssl.gzEVP_camellia_128_cbc.3ssl.gzEVP_camellia_128_cfb.3ssl.gzEVP_camellia_128_cfb1.3ssl.gzEVP_camellia_128_cfb128.3ssl.gzEVP_camellia_128_cfb8.3ssl.gzEVP_camellia_128_ctr.3ssl.gzEVP_camellia_128_ecb.3ssl.gzEVP_camellia_128_ofb.3ssl.gzEVP_camellia_192_cbc.3ssl.gzEVP_camellia_192_cfb.3ssl.gzEVP_camellia_192_cfb1.3ssl.gzEVP_camellia_192_cfb128.3ssl.gzEVP_camellia_192_cfb8.3ssl.gzEV�x�������������������X��(
�������������<��$,����������������<�=�;��rray)perl(Tie::StdHandle)perl(Tie::StdHash)perl(Tie::StdScalar)perl(Tie::SubstrHash)perl(Time::gmtime)perl(Time::localtime)perl(Time::tm)perl(UNIVERSAL)perl(Unicode::UCD)perl(User::grent)perl(User::pwent)perl(_charnames)perl(arybase)perl(attributes)perl(autouse)perl(base)perl(blib)perl(bytes)perl(bytes_heavy.pl)perl(charnames)perl(deprecate)perl(diagnostics)perl(dumpvar.pl)perl(encoding::warnings)perl(feature)perl(fields)perl(filetest)perl(if)perl(less)perl(lib)perl(locale)perl(mro)perl(ops)perl(overload)perl(overload::numbers)perl(overloading)perl(perl5db.pl)perl(sigtrap)perl(sort)perl(subs)perl(vars)perl(vmsish)perl(warnings::register)perl-interpreterperl-interpreter(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@




@libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libdl.so.2()(64bit)libgdbm.so.6()(64bit)libgdbm_compat.so.4()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libm.so.6(GLIBC_2.23)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libutil.so.1()(64bit)perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(:VERSION)perl(B)perl(B::Concise)perl(B::Op_private)perl(B::Terse)perl(Carp)perl(Class::Struct)perl(Config)perl(Cwd)perl(Exporter)perl(ExtUtils::Constant::Base)perl(ExtUtils::Constant::Utils)perl(ExtUtils::Constant::XS)perl(Fcntl)perl(File::Basename)perl(File::Path)perl(File::Spec)perl(File::Spec::Functions)perl(I18N::LangTags)perl(IO::File)perl(IPC::Open3)perl(Opcode)perl(POSIX)perl(Scalar::Util)perl(Symbol)perl(Text::Tabs)perl(Text::Wrap)perl(Tie::Handle)perl(Tie::Hash)perl(Tie::StdHandle)perl(Time::tm)perl(Unicode::Normalize)perl(XSLoader)perl(_charnames)perl(bytes)perl(charnames)perl(constant)perl(feature)perl(if)perl(integer)perl(overload)perl(parent)perl(re)perl(strict)perl(subs)perl(threads)perl(threads::shared)perl(unicore::Name)perl(utf8)perl(vars)perl(warnings)perl(warnings::register)perl-libsperl-libs(x86-64)perl-macrosrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)5.0.05.10.15.24.05.3.05.5.05.6.05.7.05.7.35.8.05.9.15.9.41.011.104:5.26.3-423.el8_103.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3he@c���ama�`�9@_��@_ܙ�_��@\	@[�<@[�]�[CN@[��Z��@ZԐ@Z��@Z}�@Zy��Zs@Zo�Zc/@Z\��ZT��Y��Y��Y��Y���Y|x�Yy�YS�@YG��Y6�@Y0�X�D�X��@X��X��@X��X���X|��Xwo�Xo��XW�X@�X#�X&�W�i�W��@W��W�P�W��W��W~D@W~D@WzO�Wm �Wj}�Wg�Wb��W_�W=��W<Y@W3�W'A@W�@V�@V�x�V��V�=@Vp�Vn�@V&,�V�@V�@Uĝ�U���U��@U��U���U���Ux&�Up=�Un�@UlI@U.R�U/@U/@U�@U
�@U�T�s@T�~�T�-@T��Tܕ�Tи@T�7�T|X@Tl�@Td�@TcK�TP�TH�T&@T�T=@TH�S��S�@S�S׌�S�\�S��S���SF��S>��R�R��@R�a@R�&�R�&�R�@R�v@Rfh�R-�@R
�Q��Q��@Q��Q�@Qک�Q�c�Q��Q��Q�b�Q�@Q�y�Q�?@Q��Q��Q��@Qzl@QeT@Qd�Q^��Q^��QP<@QLG�QJ�@QHS@QC
@QA��Q5�@Q"�Q�Q�Q�@Q�Q�@Q�@Q��Q	@Q	@Q��Qs�P��@P�P�@P�Z�P�Z�P��@P��P~��P`K@P\V�P[@PXb@PS@PPy@PO'�PG>�P7l�P(�@P#�@P#�@P	H@P
�O�@O�O�R�OЗ�O�F@O�F@OȮ�OȮ�O�]@O�t@O���O�~�O��@O�@O� �OC�@O/��O(@O�@O�@N�x�N�N��@N�1�N��@N�=@N�H�N��@N�0�N�S@N�
@N�$@N��@N��@N���N���N��@Ny�Nq�NoE�N\�NG��N;�@N2��N.�@N)f@N%q�N!}@N��Np�N*�N��M�6@M�6@M�6@M��@M���M���M�M�M�M�)�M��M��@M��@M��@M��@MT�M_��MQ0@MA^@M@�M@�M>�@�x������������������X��(
���������$=��������������������om> - 1.4.12-3Tomáš Mráz <tmraz@redhat.com> - 1.4.12-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.12-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-9Tom Callaway <spot@fedoraproject.org> - 1.4.11-8Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-7Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-6Ville Skyttä <ville.skytta@iki.fi> - 1.4.11-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.11-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.11-1Tomáš Mráz <tmraz@redhat.com> - 1.4.10-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.10-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.10-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.9-1Václav Pavlín <vpavlin@redhat.com> - 1.4.8-13Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-12Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-11Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.8-10Tomáš Mráz <tmraz@redhat.com> - 1.4.8-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-8Karsten Hopp <karsten@redhat.com> 1.4.8-7Rex Dieter <rdieter@fedoraproject.org> 1.4.8-6Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-5Tomáš Mráz <tmraz@redhat.com> - 1.4.8-4Tomáš Mráz <tmraz@redhat.com> - 1.4.8-3Tomáš Mráz <tmraz@redhat.com> - 1.4.8-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.8-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-3Tomáš Mráz <tmraz@redhat.com> - 1.4.7-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.7-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4.6-9Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-8Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-7Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-6Tomas Mraz <tmraz@redhat.com> - 1.4.6-5Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.6-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-4Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.5-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.4-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.2-1Tomas Mraz <tmraz@redhat.com> - 1.4.1-3Tomas Mraz <tmraz@redhat.com> - 1.4.1-2Marcela Mašláňová <mmaslano@redhat.com> - 1.4.1-1Tomas Mraz <tmraz@redhat.com> - 1.4-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.4-3Marcela Mašláňová <mmaslano@redhat.com> - 1.4-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-2Marcela Mašláňová <mmaslano@redhat.com> - 1.3-1Marcela Mašláňová <mmaslano@redhat.com> - 1.2-8Tomas Mraz <tmraz@redhat.com> - 1.2-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.2-6Marcela Mašláňová <mmaslano@redhat.com> - 1.2-5Marcela Mašláňová <mmaslano@redhat.com> - 1.2-4Marcela Maslanova <mmaslano@redhat.com> - 1.2-3Marcela Maslanova <mmaslano@redhat.com> - 1.2-2Marcela Maslanova <mmaslano@redhat.com> - 1.2-1Tomas Mraz <tmraz@redhat.com> - 1.1-3Marcela Maslanova <mmaslano@redhat.com> - 1.1-2Marcela Maslanova <mmaslano@redhat.com> - 1.1-1Marcela Maslanova <mmaslano@redhat.com> - 1.0-6Marcela Maslanova <mmaslano@redhat.com> - 1.0-5Marcela Maslanova <mmaslano@redhat.com> - 1.0-4Marcela Maslanova <mmaslano@redhat.com> - 1.0-3Marcela Maslanova <mmaslano@redhat.com> - 1.0-2Marcela Maslanova <mmaslano@redhat.com> - 1.0-1- Bump release because of CI issues
- Related: RHEL-2609- Add `optimization_to_close_fds.patch`
- Resolv�x�������������������X�i�(
0���p�}d�$m����������������}d~d|d��x�������������������X�&�(
����������������d�$P�����������������d�d�d�3aa99513563c3ed8e88582175b27757b896e0e768461332d9fc4547683eaad3af2c5060922abc41bcd141ff973e2f00e49020407d94f74c5e23aa80cd3ae972f93d700e9f97f9c08cad381c8a169e1c4d5ce4185eac595fa2fed0d293e561077ddc972f833c0ec9089ca67c590e057beb1f4ea065c71feba4a6554dfce74770ae18fa11093820b557acf07f42ecad850a66463c2b0d187fe1d12a7f665ed6297d65b2b102a1533d64dcfb486b2bbeefe8aeb31665b59beeeaed0b422729b0bab9e21e64a3e121594d960b085f30e45f18e49729b7645d868e9b56d234983ce5f5535027282844710ebc1d5644301ee78698a4cc0f0698ac2dfc350c3801e2601e508b88559f4ead59eaea55aa001c436e9413a9fe074551d7344db003301da77f4e3493843c3386a757b1d82316d6a1f2da35a7bc52008c5fce38c5c56a52e7a40893ae64d258ed36f8e03051172c8ff4fb82b06c832f292c49e80fdcd37dddf16aeae5826a3da8f2dc17eed9ca2a0df0257ccd9edf80f907594428d3beac09d5a551593486cc292990ee4442d509b7ba6945ba327f569074749b732e05535278808c3a67f50c89415e2f90996b02ebf4d084037bf9a8ab35aa0e2fc62d48ed92c5550142b33ca2740eb85067acae771aa32aa121e6563075ece970fc9434ece1ad2401ccc1a112fd50ff29b84ae7c2c5590599570fa0e87450be784223c8145137e29f9ae0da86cefe845fddc47dfe4cd7b5a3dc7cad4c6cf1a22ade1ad1615e50aabbb42178ff576e8769dc54bde14e5883d67e8cfac5b1a9aca7f536913932d3925f67c7267e8e080d9b2eae80b2b6195a559c662c365f218832c242dcedb6cb560f5179d051af3de97510219aae13be50589e0308981e79e290b30dcc84bf58adba59bf87a72f5060b2a3399c6baa45498ee644fd7c97671c9a4f711c15034cc76bc36a9146601ebdc003c9ebb30f21f0720d24d260d24e4baa3019f804483b2743da07cb22d0de3092bb2b9fe743a3435bb7038b7c39d14035715d40e1be6468082d6a846dee41857921527ded3805c85d14f5738db78c954b193997508f1203f75931f0d88c4a46bace2a096a0108fef6282978ae245c17aef8194c3e6a8e8877b165d6aa0ae07178d857d1e2079f624a2f12e57f9e945ee1fd69aedff9dc49308ab4da828be33ab98f6bb6b550aa9a4543420daa06df91b7b825835800fb0075b2a31ee550f7272ce60edb2b027e9b534b7330aaa9ca54b6b976d5e1bdc96cda669a2ba2b8839208dfe2f46eb01c3c1421c70b5403a920b23cffa641aaa2e298a5438afaf1536879328c3d1889c407774d34422579184a6aef451990a6ec44aa4a0c52d6cdacacf8b5f4e0a9c6f28d0c98343235171b2126e31a06096270da5327f520f1d1307bf1e18bccd4ec76d5142aa99c9e47fb8b9b8352235738edc8b6275afde0dd44fe419bc6441d95a8479c9e64a75c1bb6a74c0a9381ecf4ba34ef0597aa8c9d2f1f7658952befcddcae6ba5938e7e22050e7be126cd7c480e13df7aff9adddf99e1ab51e95c059b6152ebdc52548f5085411684d49847429d657f6d13c45d0ebd6c6a06a17ec369d4c15c9c944bca6b8628b29180ef3549a2f37599450414a40cb04a647b93db0415871aad5554bad9d54fba5e19524506d2bf6510326683de6b3df98656454878a8a4726dc01a142f268c77f7e568423b314135671f4fd68c4e9d1bc938e3cf62b9ac9732e2bd5efc161a0d9ec73c726969fb92f9b2ee6bad2bdc4f540355a6a951d5dc80cd6c2580ea431b08645d4e94ee84a08c4ff50c62d8f00493e4a7fff70605289ecce79541b8e00d0e4ca6162e9c5d3832af0af64289eb924185e36ee16b529ccb59abfb5d03ef387e031c531beeb78f3315e760e7c1fea72c8e3c0489e0248d0289690f49acd2c8324726cb5869e0335b3cde82d0240a0d264fc252582530c5fe88198b04482470c6f22725a997e459e757053d70c3d993ce25eb190d420aa81d254034fdec4091a25817a0078907f652a0450d33d441bc218d8f9cc8719bf10bd01b709e79a28d21221d69c5997999f5f1529068bb0b65f5528e96fad597f9d69d3c15beccf726a3ab6f1b668249d79a367a2e120bca83cc20183b379a8b820167c82de47676953294c570ed0fed5e9a5e9ebe0024d9890e79d4d33556df21ae2165c25e2c7378ac8ebbb91e6d5e568dc34821648098aae0f9d2285d16742ae6933657eaeb845ce2f05b2a1e1b5bead134600c180e56034fbbe8fd2a1283675d7ae60891c508c8ada9183384c63c09ded6ecdd961033e746463bd35cc2060ee2530d95d74d8ab3293bff7f0826e31b11a5036bebe9b34e1148da0e48b1f9c4106d273cc8d6041199a96dfb0644cdc08935930ed37ec312832128ce18cdf147ffd5ee5f4d999d708f61386cb04f3e787d9dda5cfc89710d3da942a4a3af0bb1996d01b94a8f7a081b34ebd28dc6c9ecf39731f55dde290db5a24d387919cbe�x�������������p�����X�]�(
��������0�������d�$�����������������d�d�d�l number to
  Makefile.certificate (#151188)
- make ca-bundle.crt a config file (#118903)- libcrypto shouldn't depend on libkrb5 (#135961)- rebuild- new upstream source, updated patches
- added patch so we are hopefully ABI compatible with upcoming
  0.9.7f- Support UTF-8 charset in the Makefile.certificate (#134944)
- Added cmp to BuildPrereq- generate new ca-bundle.crt from Mozilla certdata.txt (revision 1.32)- Fixed and updated libica-1.3.4-urandom.patch patch (#122967)- rebuild- rebuild- rebuild- remove der_chop, as upstream cvs has done (CAN-2004-0975, #140040)- Include latest libica version with important bugfixes- rebuilt- Updated ICA engine IBM patch to latest upstream version.- build for linux-alpha-gcc instead of alpha-gcc on alpha (Jeff Garzik)- handle %{_arch}=i486/i586/i686/athlon cases in the intermediate
  header (#124303)- add security fixes for CAN-2004-0079, CAN-2004-0112- Fixed libica filespec.- ppc/ppc64 define __powerpc__/__powerpc64__, not __ppc__/__ppc64__, fix
  the intermediate header- add an intermediate <openssl/opensslconf.h> which points to the right
  arch-specific opensslconf.h on multilib arches- rebuilt- Updated libica to latest upstream version 1.3.5.- Update ICA crypto engine patch from IBM to latest version.- rebuilt- rebuilt- Fixed libica build.- add "-ldl" to link flags added for Linux-on-ARM (#99313)- updated ca-bundle.crt: removed expired GeoTrust roots, added
  freessl.com root, removed trustcenter.de Class 0 root- Fix link line for libssl (bug #111154).- add dependency on zlib-devel for the -devel package, which depends on zlib
  symbols because we enable zlib for libssl (#102962)- Use /dev/urandom instead of PRNG for libica.
- Apply libica-1.3.5 fix for /dev/urandom in icalinux.c
- Use latest ICA engine patch from IBM.- rebuild- rebuild (22 wasn't actually built, fun eh?)- re-disable optimizations on ppc64- add a_mbstr.c fix for 64-bit platforms from CVS- add -Wa,--noexecstack to RPM_OPT_FLAGS so that assembled modules get tagged
  as not needing executable stacks- rebuild- re-enable optimizations on ppc64- remove exclusivearch- only parse a client cert if one was requested
- temporarily exclusivearch for %{ix86}- add security fixes for protocol parsing bugs (CAN-2003-0543, CAN-2003-0544)
  and heap corruption (CAN-2003-0545)
- update RHNS-CA-CERT files
- ease back on the number of threads used in the threading test- rebuild to fix gzipped file md5sums (#91211)- Updated libica to version 1.3.4.- rebuild- free the kssl_ctx structure when we free an SSL structure (#99066)- rebuild- lower thread test count on s390x- rebuild- disable assembly on arches where it seems to conflict with threading- Updated libica to latest upstream version 1.3.0- rebuild- rebuild- ubsec: don't stomp on output data which might also be input data- temporarily disable optimizations on ppc64- backport fix for engine-used-for-everything from 0.9.7b
- backport fix for prng not being seeded causing problems, also from 0.9.7b
- add a check at build-time to ensure that RSA is thread-safe
- keep perlpath from stomping on the libica configure scripts- thread-safety fix for RSA blinding- rebuilt- Added libica-1.2 to openssl (featurerequest).- fix building with incorrect flags on ppc64- add patch to harden against Klima-Pokorny-Rosa extension of Bleichenbacher's
  attack (CAN-2003-0131)- add patch to enable RSA blinding by default, closing a timing attack
  (CAN-2003-0147)- disable use of BN assembly module on x86_64, but continue to allow inline
  assembly (#83403)- disable EC algorithms- update to 0.9.7a- add fix to guard against attempts to allocate negative amounts of memory
- add patch for CAN-2003-0078, fixing a timing attack- Add openssl-ppc64.patch- EVP_DecryptInit should call EVP_CipherInit() instead of EVP_CipherInit_ex(),
  to get the right behavior when passed uninitialized context structures
  (#83766)
- build with -mcpu=ev5 on alpha family (#83828)- rebuilt- Added IBM hw crypto support patch.- add missing bui�x������������������X�ʜ(
`��M����!�$�����������������!�!�!�- update Archive::Tar to 1.38- 462444 update Test::Simple to 0.80- move libnet to the right directory, along Net/Config.pm- do not create directory .../%{version}/auto- 457867 remove required IPC::Run from CPANPLUS - needed only by win32
- 457771 add path- CGI.pm bug in exists() on tied param hash (#457085)
- move the enc2xs templates (../Encode/*.e2x) to -devel, (#456534)- 455933 update to CGI-3.38
- fix fuzz problems (patch6)
- 217833 pos() function handle unicode characters correct- rebuild for new db4 4.7- remove db4 require, it is handled automatically- 453646 use -DPERL_USE_SAFE_PUTENV. Without fail some modules f.e. readline.- 451078 update Test::Harness to 3.12 for more testing. Removed verbose 
test, new Test::Harness has possibly verbose output, but updated package
has a lot of features f.e. TAP::Harness. Carefully watched all new bugs 
related to tests!- bump the release number, so that it is not smaller than in F-9- CVE-2008-2827 perl: insecure use of chmod in rmtree- 447371 wrong access permission rt49003- make config parameter list consistent for 32bit and 64bit platforms,
  add config option -Dinc_version_list=none (#448735)
- use perl_archname consistently
- cleanup of usage of *_lib macros in %install- 449577 rebuild for FTBFS- 448392 upstream fix for assertion- sparc64 breaks with the rpath hack patch applied- 447142 upgrade CGI to 3.37 (this actually happened in -21 in rawhide.)- sparc64 fails two tests under mysterious circumstances. we need to get the
  rest of the tree moving, so we temporarily disable the tests on that arch.- create the vendor_perl/%{perl_version}/%{perl_archname}/auto directory 
  in %{_libdir} so we own it properly- fix CPANPLUS-Dist-Build Provides/Obsoletes (bz 437615)
- bump version on Module-CoreList subpackage- forgot to create the auto directory for multilib vendor_perl dirs- own multilib vendor_perl directories
- mark Module::CoreList patch in patchlevel.h- 437817: RFE: Upgrade Module::CoreList to 2.14- xsubpp now lives in perl-devel instead of perl.- back out Archive::Extract patch, causing odd test failure- add missing lzma test file- conditionalize multilib patch report in patchlevel.h
- Update Archive::Extract to 0.26
- Update Module::Load::Conditional to 0.24- only do it once, and do it for all our patches- note 32891 in patchlevel.h- get rid of bad conflicts on perl-File-Temp- use /usr/local for sitelib/sitearch dirs
- patch 32891 for significant performance improvement- Add perl-File-Temp provides/obsoletes/conflicts (#433836),
  reported by Bill McGonigle <bill@bfccomputing.com>
- escape the macros in Jan 30 entry- Autorebuild for GCC 4.3- disable some futime tests in t/io/fs.t because they started failing on x86_64
  in the Fedora builders, and no one can figure out why. :/- create %{_prefix}/lib/perl5/vendor_perl/%{perl_version}/auto and own it
  in base perl (resolves bugzilla 214580)- Update Sys::Syslog to 0.24, to fix test failures- add some BR for tests- 5.10.0 final
- clear out all the unnecessary patches (down to 8 patches!)
- get rid of super perl debugging mode
- add new subpackages- first attempt at building 5.10.0�x�������������`�����X��(
��������������$ �������������������37574379, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=4d3dddeacec65e1a9392128f48a9b9f928c84d1b, strippedUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)
R
R
RRRRRRRRRRRR
R
RRRRRRRRRRRR
RRR	RRRR
RRRRRRutf-8e3c94b344f27f7d3f51ed53055e8939f9856e27a6944caf042668a84c24c5f60?���P�\�3!�^���P,��*����%�f�J
	*����%�>x�ULIqy�N�k������n��h���脂BX�#�b/F[f�s� 0�u0ME��k:\���ʇ�.y��Fҋlj���ԔEg��q�⽗���ld�C[b���Q�z���B�=� �!�Ye�x�Ǟ��(4��2��]B���.0w�;L1��نd\��<�Jm�|a��B��A/%i�޴ �@�Uo�]q�1����ge$�������0֢_"�4c2MH�^�w)T�qn�1�iF�|ӗ�RRD/{�OR��W�]���=�2��ʝ��j�A��u~8�v8�*�M^"�D����������c)!h*�!�YjBIQ
㹞Gnw���A���=;5���7�p�ϫ�H��3W2���*d�!w��m���	�Iz.�n��+&��[�Da��xY�!׽J@�%�t��5�{l�����Yч�w��O �
i�ʪB�El����=�bC���K�ݒ�*
L?JњL⛿�
�nŲR��'�e��Ⱥ^��n�/1j6e�[]�P�o|�ә�3!�^���P,��*����%�f�J
	*����%����'�S+��Ə�3\����z��u��2�S�'�����c�F�]+ެ�z�2���m��l��I��a_4��� ��r[`������fmuW�jG�ۙ
�@�ۊ��v3�ަS�;<45��I�Hrzf�-�CV"���A|%�\��"�L��ۦDT,�3*j*[j9Vh{(*����n��ъ�G3�a^���=Z�y�-elʘy����g�Q�]"��LM1#(qqZ0\%��nla��C������2s��>��E�>����d�m��5�PYSs�3�i;��\v��q���.r��#��P�*��2ս�X�Q�%���}]��ߤ��h6�� ���PA�8�n��2�r��,�e�����O�I�`o~���1V0:G�i���y0���ޙuG��7�b�����|�HI�~��K��g���5%��sƿ�m���>��˹J™2����⦡��;��g���rm�:���_K`���bk�׃v���ǟ�73566674b8d742c637e16b909cd7865640f9c88e9a1b2f01c5027656e699540c81234488e9a244666550107372af902734e56febbfX�/�XfX�74e90712499db1a89edhU<8&7032f08d9b6488ccd861f332450ab58272d75a�s&7007512a5d17e237151568b07f8e7524728a78rva8�?I��:���0)70=+Uz�&6fd23b315915705e6153ad578f5f10101abba7aW�g�&6fbc5cd7e0ab6af4264752a5d92b525fc929d71fcUd&6f94ec2a21e12c23fc80fc8bd7c0e106a4c56a226g&6f8c4e86e8c48432f60eb77b33905491b2c5bf�&6f59c16e1a7b54c9f08870aba4ad7599b90d5caW���&6f4f89c740a40dc40bb21797f12b57397486d9�>.�b@&6f47a3d3cc942058bfb2fe0cc76f980cf54302ska�&6f3a3c30c1f68625a3deb6a87b1d3f7bec5452aW�0�
�8��	��J6f=L��&6eff496e1438c21be8d946cea59a7b200e2f64=���3&6e3887599f1a28d6be6bf291d2e6f150909356com�'�&6e3531c604c895837478c36eec2284f2b230dd�6��ud�.O6e=Qc&6df174808211131f415c4fbf07d775bf941838f8b�t&6deb60a2f2af66db58bc601bafe5745115b9fe@V���e&6de92fd8b6c43dfc5581556b1325f881ee7d97oje��&6dd1f20f501de2c89c824be98d9b9fee72dbb1@?���F&6dc1020927f867b8e7228256b2b1ff9542a589roj���&6d5789f1d97e366f0433bbe17df5dd6a2a50f7@S���&6d00c5f9371e4a9da21ffbd73e6810fc7fc023aW�@�Yub����,���1T6d=V��&6c8d65376137a38b00559dca80378d66c9bdb4=��-�&6c0947b656643a48eb0ed63daf34a708532e98�;	(�u_����g6c=i36&6bc5fd3b69c20038816ac9a196a7194b9fb5785�
�&6b924a727d6f237b0daabc897c4d870b79bf91�A�'�&6b569cf9370b368b32c0ee5f423a1b98ef8e1a�u]� 6b4J��&6aeb1dbbbd7511f3e8b52f00881771f8b5cfc2aW�UP&6ae81efb80a74594d209644f63488d6a686818764�x��������������o����X��(
�������H��������$v��������������������pace unnecessarily
- module-setup.sh: don't source $dracutfunctions
- logger: source the logger file individually
- dracut-module-setup.sh: enable ForwardToConsole=yes in fadump mode- Always include watchdog-modules
- mkdumprd: Ensure kdumpbase is added
- Move watchdog detect and install code to module-setup.sh
- Add a helper to omit non-mandatory dracut module
- Move some dracut module dependencies checks to module-setup.sh
- Set watchdog's pretimeout to zero in kdump kernel
- kdump-lib.sh: Use a more generic helper to detect omitted dracut module
- Fix the watchdog drivers detection code
- Add a helper for detecting watchdog drivers
- Remove a redundant nfs check
- kdumpctl: split the driver detection from fs dection function
- kdump.service: use ConditionKernelCommandLine=crashkernel
- Revert "Append both nofail and x-systemd.before to kdump mount target"
- Revert "Don's try to restart dracut-initqueue if it's already failed"
- Fix dump_fs mount point detection and fallback mount
- kdump.conf: Update doc about core_collector for ssh target
- Save the final failure information to log file if saving vmcore failed
- Doc: Improve the kdump sysconfig document
- kdumpctl: fix a variable expansion in check_fence_kdump_config()
- Fedora 33 rhpkg build bug- makedumpfile: add support for ARMv8.2 LVA 52 bits- Doc: improve mkdumprd man page- Rework on dracut-module-setup.sh: Use systemctl call to replace ln_r- dracut-module-setup.sh: Use systemctl call to replace ln_r- Don's try to restart dracut-initqueue if it's already failed
- fadump-howto: update about 'nocma' and 'off' options for 'fadump=' parameter
- dracut-module-setup.sh: use auto6 for ipv6
- module-setup.sh: enable vlan on team interface
- Fix rootfs detection in dump_fs
- Remove RHEL-only patch: kexec-tools-2.0.18-makedumpfile-arm64-Add-support-for-ARMv8.2-LVA-52-bi.patch
- Rebase to makedumpfile-1.6.8 (step1)- Doc: improve the usage documentation of the logger
- Update the kdump sysconfig
- Capitalize the configuration name of log level
- Add the rd.kdumploglvl option to control log level in the second kernel
- Appropriately converts logger numeric level to syslog log level
- Remove unused log levels for kdump logger
- Add sanity checks for the log levels
- Add code comments to help better understanding
- Doc: add a documentation for the usage of logger
- Improve debugging in the kdump kernel
- kdumpctl: add the '-d' option to enable the kexec loading debugging messages
- kdump.sysconfig: add the kdump logger configurations
- enable the logger for kdump
- introduce the kdump logger from the dracut- arm64: Enable 'kexec_file_load' by default
- Fix, Add a kernel install hook to clean up kdump initramfs- module-setup.sh: Instead of drop journalctl log, just don't read kmsg
- s390x: enable the kexec file load by default
- increase makdumpfile default message level to 7
- Rework check_config and warn on any duplicated option
- kdumpctl: Error out if path is set more than once.
- Don't drop journalctl content if failure action is "shell"
- dracut-module-install: Move systemd conf install code to a function
- kdump-lib.sh: Remove is_atomic
- Refactor kernel image and initrd detection code
- early-kdump: Use consistent symbol link for kernel and initramfs
- kdump-lib: strip grub device from kdump_bootdir
- kdumpctl: fix driver change detection on latest Fedora
- Revert "kdump-lib: disable efifb if hyperv_fb is in use"
- kdump-lib.sh: detect secure boot on s390
- Add a kernel install hook to clean up kdump initramfs- kdump-lib: disable efifb if hyperv_fb is in use- sadump, kaslr: fix failure of calculating kaslr_offset due to an sadump format restriction- kdumpctl: exit if either pre.d or post.d is missing- ppc64/kdump: use kexec_file_load when secureboot is enabled
- kdump_pre: make notes more precise
- dracut-kdump.sh: exit shell when machine reboot
- kdump.conf: fix a grammar issue
- kdumpctl: detect modification of scripts by its directory's timestamp
- module-setup.sh: suppress false alarm
- kexec-tools.spec: make the existence of p�x�������������P_����X���(
���������p���"X�$2����������������"X#XJA gU�duce cpu_set_to_range() (#1734787)
- systemctl: present CPUAffinity mask as a list of CPU index ranges (#1734787)
- shared/cpu-set-util: only force range printing one time (#1734787)
- execute: dump CPUAffinity as a range string instead of a list of CPUs (#1734787)
- cpu-set-util: use %d-%d format in  cpu_set_to_range_string() only for actual ranges (#1734787)
- core: introduce NUMAPolicy and NUMAMask options (#1734787)
- core: disable CPUAccounting by default (#1734787)
- set kptr_restrict=1 (#1689346)
- cryptsetup: reduce the chance that we will be OOM killed (#1696602)
- core, job: fix breakage of ordering dependencies by systemctl reload command (#1766417)
- debug-generator: enable custom systemd.debug_shell tty (#1723722)- core: never propagate reload failure to service result (#1735787)
- man: document systemd-analyze security (#1750343)
- man: reorder and add examples to systemd-analyze(1) (#1750343)
- travis: move to CentOS 8 docker images (#1761519)
- travis: drop SCL remains (#1761519)
- syslog: fix segfault in syslog_parse_priority() (#1761519)
- sd-bus: make strict asan shut up (#1761519)
- travis: don't run slow tests under ASan/UBSan (#1761519)
- kernel-install: do not require non-empty kernel cmdline (#1701454)
- ask-password: prevent buffer overrow when reading from keyring (#1752050)
- core: try to reopen /dev/kmsg again right after mounting /dev (#1749212)
- buildsys: don't garbage collect sections while linking (#1748258)
- udev: introduce CONST key name (#1762679)
- Call getgroups() to know size of supplementary groups array to allocate (#1743230256 KB
- Consider smb3 as remote filesystem (#1757257)
- process-util: introduce pid_is_my_child() helper (#1744972)
- core: reduce the number of stalled PIDs from the watched processes list when possible (#1744972)
- core: only watch processes when it's really necessary (#1744972)
- core: implement per unit journal rate limiting (#1719577)
- path: stop watching path specs once we triggered the target unit (#1763161)
- journald: fixed assertion failure when system journal rotation fails (#9893) (#1763619)
- test: use PBKDF2 instead of Argon2 in cryptsetup... (#1761519)
- test: mask several unnecessary services (#1761519)
- test: bump the second partition's size to 50M (#1761519)
- shared/sleep-config: exclude zram devices from hibernation candidates (#1763617)
- selinux: don't log SELINUX_INFO and SELINUX_WARNING messages to audit (#1763612)
- sd-device: �x��������������N����X�B�(
�������8d��$��������������������function_cpulist2devs.cpython-36.opt-1.pycfunction_cpulist2devs.cpython-36.pycfunction_cpulist2hex.cpython-36.opt-1.pycfunction_cpulist2hex.cpython-36.pycfunction_cpulist2hex_invert.cpython-36.opt-1.pycfunction_cpulist2hex_invert.cpython-36.pycfunction_cpulist_invert.cpython-36.opt-1.pycfunction_cpulist_invert.cpython-36.pycfunction_cpulist_online.cpython-36.opt-1.pycfunction_cpulist_online.cpython-36.pycfunction_cpulist_pack.cpython-36.opt-1.pycfunction_cpulist_pack.cpython-36.pycfunction_cpulist_present.cpython-36.opt-1.pycfunction_cpulist_present.cpython-36.pycfunction_cpulist_unpack.cpython-36.opt-1.pycfunction_cpulist_unpack.cpython-36.pycfunction_exec.cpython-36.opt-1.pycfunction_exec.cpython-36.pycfunction_hex2cpulist.cpython-36.opt-1.pycfunction_hex2cpulist.cpython-36.pycfunction_kb2s.cpython-36.opt-1.pycfunction_kb2s.cpython-36.pycfunction_regex_search_ternary.cpython-36.opt-1.pycfunction_regex_search_ternary.cpython-36.pycfunction_s2kb.cpython-36.opt-1.pycfunction_s2kb.cpython-36.pycfunction_strip.cpython-36.opt-1.pycfunction_strip.cpython-36.pycfunction_virt_check.cpython-36.opt-1.pycfunction_virt_check.cpython-36.pycfunctions.cpython-36.opt-1.pycfunctions.cpython-36.pycrepository.cpython-36.opt-1.pycrepository.cpython-36.pycbase.pyfunction_assertion.pyfunction_assertion_non_equal.pyfunction_calc_isolated_cores.pyfunction_check_net_queue_count.pyfunction_cpuinfo_check.pyfunction_cpulist2devs.pyfunction_cpulist2hex.pyfunction_cpulist2hex_invert.pyfunction_cpulist_invert.pyfunction_cpulist_online.pyfunction_cpulist_pack.pyfunction_cpulist_present.pyfunction_cpulist_unpack.pyfunction_exec.pyfunction_hex2cpulist.pyfunction_kb2s.pyfunction_regex_search_ternary.pyfunction_s2kb.pyfunction_strip.pyfunction_virt_check.pyfunctions.pyrepository.pyloader.pylocator.pymerger.pyprofile.pyunit.pyvariables.pystorage__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycfactory.cpython-36.opt-1.pycfactory.cpython-36.pycinterfaces.cpython-36.opt-1.pycinterfaces.cpython-36.pycpickle_provider.cpython-36.opt-1.pycpickle_provider.cpython-36.pycstorage.cpython-36.opt-1.pycstorage.cpython-36.pycfactory.pyinterfaces.pypickle_provider.pystorage.pyunits__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pycmanager.cpython-36.opt-1.pycmanager.cpython-36.pycmanager.pyutils__init__.py__pycache____init__.cpython-36.opt-1.pyc__init__.cpython-36.pyccommands.cpython-36.opt-1.pyccommands.cpython-36.pycconfig_parser.cpython-36.opt-1.pycconfig_parser.cpython-36.pycglobal_config.cpython-36.opt-1.pycglobal_config.cpython-36.pycnettool.cpython-36.opt-1.pycnettool.cpython-36.pycplugin_loader.cpython-36.opt-1.pycplugin_loader.cpython-36.pycpolkit.cpython-36.opt-1.pycpolkit.cpython-36.pycprofile_recommender.cpython-36.opt-1.pycprofile_recommender.cpython-36.pyccommands.pyconfig_parser.pyglobal_config.pynettool.pyplugin_loader.pypolkit.pyprofile_recommender.pyversion.pytuned.servicetuned.conftunedaccelerator-performancetuned.confawstuned.confbalancedtuned.confdesktoptuned.confepyc-edatuned.conffunctionshpc-computetuned.confintel-ssttuned.conflatency-performancetuned.confnetwork-latencytuned.confnetwork-throughputtuned.confoptimize-serial-consoletuned.confpowersavescript.shtuned.confrecommend.d50-tuned.confthroughput-performancetuned.confvirtual-guesttuned.confvirtual-hosttuned.conftuneddefirqaffinity.pytunedtuned-admtuned-admcom.redhat.tuned.conftunedAUTHORSCOPYINGREADME.mdTIPS.txttuned-main.conf.5.gztuned.conf.5.gztuned-profiles.7.gztuned-adm.8.gztuned-gui.8.gztuned.8.gzcom.redhat.tuned.policytunedgrub200_tunedtunedtuned/etc/modprobe.d//etc//etc/tuned//run//usr/lib/kernel/install.d//usr/lib/python3.6/site-packages//usr/lib/python3.6/site-packages/tuned//usr/lib/python3.6/site-packages/tuned/__pycache__//usr/lib/python3.6/site-packages/tuned/admin//usr/lib/python3.6/site-packages/tuned/admin/__pycache__//usr/l�x�������������@>����X�ɜ(
�S �������!�$�����������������!�!�!�
- update Compress::Raw::Zlib to 2.023
- update IO::Compress::Base, and IO::Compress::Zlib to 2.015 (#542645)- 542645 update IO-Compress-Base- back out perl-5.10.0-spamassassin.patch (#528572)- add /perl(UNIVERSAL)/d; /perl(DB)/d to perl_default_filter auto-provides
  filtering- update Storable to 2.21- update our Test-Simple update to 0.92 (patch by Iain Arnell), #519417
- update Module-Pluggable to 3.9- fix macros.perl *sigh*- Remove -DDEBUGGING=-g, we are not ready yet.- add helper filtering macros to -devel, for perl-* package invocation
  (#502402)- Add configure option -DDEBUGGING=-g (#156113)- 510127 spam assassin suffer from tainted bug- 494773 much better swap logic to support reentrancy and fix assert failure (rt #60508)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- fix generated .ph files so that they no longer cause warnings (#509676)
- remove PREREQ_FATAL from Makefile.PL's processed by miniperl
- update to latest Scalar-List-Utils (#507378)
- perl-skip-prereq.patch: skip more prereq declarations in Makefile.PL files- re-enable tests- move -DPERL_USE_SAFE_PUTENV to ccflags (#508496)- #504386 update of Compress::Raw::Zlib 2.020- update File::Spec (PathTools) to 3.30- fix #221113, $! wrongly set when EOF is reached- do not use quotes in patchlevel.h; it breaks installation from cpan (#495183)- update CGI to 3.43, dropping upstreamed perl-CGI-escape.patch- fix CGI::escape for all strings (#472571)
- perl-CGI-t-util-58.patch: Do not distort lib/CGI/t/util-58.t
  http://rt.perl.org/rt3/Ticket/Display.html?id=64502- Move the gargantuan Changes* collection to -devel (#492605)- update module autodie- update Digest::SHA (fixes 489221)- drop 26_fix_pod2man_upgrade (don't need it)
- fix typo in %define ExtUtils_CBuilder_version- apply Change 34507: Fix memory leak in single-char character class optimization
- Reorder @INC, based on b9ba2fadb18b54e35e5de54f945111a56cbcb249
- fix Archive::Extract to fix test failure caused by tar >= 1.21
- Merge useful Debian patches- remove compatibility obsolete sitelib directories
- use a better BuildRoot
- drop a redundant mkdir in %install
- call patchlevel.h only once; rm patchlevel.bak
- update modules Sys::Syslog, Module::Load::Conditional, Module::CoreList,
  Test::Harness, Test::Simple, CGI.pm (dropping the upstreamed patch),
  File::Path (that includes our perl-5.10.0-CVE-2008-2827.patch),
  constant, Pod::Simple, Archive::Tar, Archive::Extract, File::Fetch,
  File::Temp, IPC::Cmd, Time::HiRes, Module::Build, ExtUtils::CBuilder
- standardize the patches for updating embedded modules
- work around a bug in Module::Build tests bu setting TMPDIR to a directory
  inside the source tree- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add /usr/lib/perl5/site_perl to otherlibs (bz 484053)- build sparc64 without _smp_mflags- limit sparc builds to -j12- update IPC::Cmd to v 0.42- 455410 http://rt.perl.org/rt3/Public/Bug/Display.html?id=54934
  Attempt to free unreferenced scalar fiddling with the symbol table
  Keep the refcount of the globs generated by PerlIO::via balanced.- add missing XHTML.pm into Pod::Simple- 295021 CVE-2007-4829 perl-Archive-Tar directory traversal flaws
- add another source for binary files, which test untaring links- to fix Fedora bz 473223, which is really perl bug #54186 (http://rt.perl.org/rt3//Public/Bug/Display.html?id=54186)
  we apply Changes 33640, 33881, 33896, 33897- change summary according to RFC fix summary discussion at fedora-devel :)- update File::Temp to 0.20- Include fix for rt#52740 to fix a crash when using Devel::Symdump and
  Compress::Zlib together- rt#33242, rhbz#459918. Segfault after reblessing objects in Storable.
- rhbz#465728 upgrade Simple::Pod to 3.07- also preserve the timestamp of AUTHORS; move the fix to the recode
  function, which is where the stamps go wrong- give Changes*.gz the same datetime to avoid multilib conflict- remove Tar.pm from Archive-Extract
- fix version of Test::Simple in spec
- update Test::Simple
�x��������������-����X�_�(
����������d�$�����������������d�d�d�support s390- remove -Wa,* and -m* compiler flags from the default Configure file (#20656)
- add the CA.pl man page to the perl subpackage- always build with -mcpu=ev5 on alpha- add a symlink from cert.pem to ca-bundle.crt- add a ca-bundle file for packages like Samba to reference for CA certificates- remove libcrypto's crypt(), which doesn't handle md5crypt (#19295)- add unzip as a buildprereq (#17662)
- update m2crypto to 0.05-snap4- fix some issues in building when it's not installed- make sure the headers we include are the ones we built with (aaaaarrgh!)- add Richard Henderson's patch for BN on ia64
- clean up the changelog- fix the building of python modules without openssl-devel already installed- byte-compile python extensions without the build-root
- adjust the makefile to not remove temporary files (like .key files when
  building .csr files) by marking them as .PRECIOUS- break out python extensions into a subpackage- tweak the makefile some more- disable MD2 support- disable MDC2 support- tweak the disabling of RC5, IDEA support
- tweak the makefile- strip binaries and libraries
- rework certificate makefile to have the right parts for Apache- use %{_perl} instead of /usr/bin/perl
- disable alpha until it passes its own test suite- move the passwd.1 man page out of the passwd package's way- update to 0.9.5a, modified for U.S.
- add perl as a build-time requirement
- move certificate makefile to another package
- disable RC5, IDEA, RSA support
- remove optimizations for now- Bero told me to move the Makefile into this package- add lib*.so symlinks to link dynamically against shared libs- update to 0.9.5
- run ldconfig directly in post/postun
- add FAQ- Fix build on non-x86 platforms- move /usr/share/ssl/* from -devel to main package- inital packaging
- changes from base:
  - Move /usr/local/ssl to /usr/share/ssl for FHS compliance
  - handle RPM_OPT_FLAGS�x�������������0����X�}�(
�'�������z��������$t�������������������� <nhorman@redhat.com> - 1.101-45Neil Horman <nhorman@redhat.com> - 1.101-44Jarod Wilson <jwilson@redhat.com> - 1.101-43Jarod Wilson <jwilson@redhat.com> - 1.101-42Neil Horman <nhorman@redhat.com> - 1.101-41Neil Horman <nhorman@redhat.com> - 1.101-40Neil Horman <nhorman@redhat.com> - 1.101-39Neil Horman <nhorman@redhat.com> - 1.101-38Neil Horman <nhorman@redhat.com> - 1.101-37Neil Horman <nhorman@redhat.com> - 1.101-36Neil Horman <nhorman@redhat.com> - 1.101-35Neil Horman <nhorman@redhat.com> - 1.101-34Neil Horman <nhorman@redhat.com> - 1.101-33Neil Horman <nhorman@redhat.com> - 1.101-32Neil Horman <nhorman@redhat.com> - 1.101-30Neil Horman <nhorman@redhat.com> - 1.101-30Jesse Keating <jkeating@redhat.com> - 1.101-29Neil Horman <nhorman@redhat.com> 1.101-27.fc6Neil Horman <nhorman@redhat.com> -1.101-19Neil Horman <nhorman@redhat.com> -1.101-17Bill Nottingham <notting@redhat.com> - 1.101-16Thomas Graf <tgraf@redhat.com> - 1.101-15Thomas Graf <tgraf@redhat.com> - 1.101-14Jeremy Katz <katzj@redhat.com> - 1.101-13Thomas Graf <tgraf@redhat.com> - 1.101-12Thomas Graf <tgraf@redhat.com> - 1.101-11Thomas Graf <tgraf@redhat.com> - 1.101-10Thomas Graf <tgraf@redhat.com> - 1.101-9Jeff Moyer <jmoyer@redhat.com> - 1.101-8Jesse Keating <jkeating@redhat.com> - 1.101-7.1.1Thomas Graf <tgraf@redhat.com> - 1.101-7.1Thomas Graf <tgraf@redhat.com>Thomas Graf <tgraf@redhat.com>Jesse Keating <jkeating@redhat.com>Thomas Graf <tgraf@redhat.com> - 1.101-5Jeff Moyer <jmoyer@redhat.com> - 1.101-4Jeff Moyer <jmoyer@redhat.com> - 1.101-3Jeff Moyer <jmoyer@redhat.com>- Use the correct regex to match eth.*- mkdumprd: Fix makedumpfile parameter check- dracut-module-setup: Skip initrd-cleanup and initrd-parse-etc in kdump- dracut-module-setup.sh: also install the driver of physical NIC for Hyper-V VM with accelerated networking- kdumpctl: Only returns immediately after an error occurs in check_*_modified- powerpc: update kdumpctl to load kernel signing key for fadump
- powerpc: update kdumpctl to remove deletion of kernel signing key once loaded- Introduce a function to get reserved memory size- Add lvm thin provision to kdump supported-kdump-targets.txt- mkdumprd: Use the correct syntax to redirect the stderr to null
- mkdumprd: call dracut with --add-device to install the drivers needed by /boot partition automatically for FIPS
- Add NICs that handle DNS queries to the allowlist- Revert "Revert "Append both nofail and x-systemd.before to kdump mount target"- dracut-module-setup.sh: skip installing driver for the loopback interface
- Reduce kdump memory consumption by only installing needed NIC drivers- Revert "Append both nofail and x-systemd.before to kdump mount target"- Only rename the virtual Azure Hyper-V network interface- Don't rename Azure Hyper-V network interface- sadump: fix failure of reading memory when 5-level paging is enabled- Rebase makedumpfile to 1.7.2- sysconfig: add zfcp.allow_lun_scan to KDUMP_COMMANDLINE_REMOVE on s390- dracut-module-setup: Fix invalid rd.znet command line entry
- dracut-module-setup: Fix persistent nic name on s390- Don't check fs modified when dump target is lvm2 thinp
- Add dependency of dracut lvmthinpool-monitor module
- lvm.conf should be check modified if lvm2 thinp enabled
- Add lvm2 thin provision dump target checker
- Fix the sync issue for dump_fs- kdump.conf: use a simple generator script to maintain
- Reduce kdump memory consumption by not letting NetworkManager manage unneeded network interfaces- mkdumprd: Improve error messages on non-existing NFS target directories
- fadump: avoid non-debug kernel use for fadump case- kdumpctl: make the kdump.log root-readable-only- kdump-lib: Add the CoreOS kernel dir to the boot_dirlist
- kdump-lib: attempt to fix BOOT_IMAGE detection
- kdump-lib: change how ostree based systems are detected
- kdump-lib: clear up references to Atomic/CoreOS- kdump-lib: use non-debug kernels first- kdump-lib.sh: Check the output of blkid with sed instead of eval- kdump.sysconfig*: add ignitio�x������������������X���(
8�������.���o!�$����������������o!n!p!�98725220364f8ad92896db57954e47c60186205f594791cfa614fa446cfbd749cb80f143148a24ea8618619bd9ba374117201d9b7ea3ed7ac68d0706eb5746e6189f816d4d074d2206ab40a1de8dbe8d51b4bee6fecd545e1a7eb18e5af55605b76a43ba94b841d3546df264088bd407820560521a22e05b4baf8b68ab2d79e39956b466bebb13de754c00d6715cefe3207b61967b9f4f2be80275c07dfb687d3687f69bb6a81d7d36a62df352255281420f6bcca86ebc4d5f47700dc9bffd0b973d5dc56e0e8aec04688ba377fb4eab196d9648af8102aa0acf54dc88225ad7a037c4f56014700ca07dda13556b6331ca018946149d8e9c09e299cb02212ef59e46b1d5d61c17ccf3c95bca6ff2c7d935a1e5d5918cbc37fb68e25221b81754f852179cecc47e3f636cf7b1a4b0df21c1f573866a225ed89733d3e524a413a7b7cf34e46360789a48c9a97cdcc98c094e58212b7b09a9c7c1022fd99d7a46e91e609c75d3e8bd0b2587460dac6ae4eac1bfad7bea0b80f38fa0c61bed9eeac2a73c14cc998af877b5083a094a2fad4ef21447f657dfc3b3aec86555c3929a0eae913af3e3939192d1df75524bb68d51eaedfd07e037c3003c1e55d3ff7d12f009c0e805764588991867460a489ac25bb767a5e4a65eedf34fef02f89990a075b69acbb1828b0fab5373e1f1ca7e1a56f6116fb05a41bf605337556e6ab783550b9d6be3a42f543b6dfb92b32ef4e25019e93fd51d4b14fea6f8e805b13b98636c3ba655c88be46dff6d81de0145d82bafca3ecee8e9b2904ef1667ba6110a846ed4e05d0f9710ff1fcabfe49827682ef7d05640ca8b9329d003c99d2ea63de24ba61a39adc2ba54eae4f246a674bb63b6ad0f1636f81e3df5e6003e017c3c9a794624dae79dc45e0b786b1f6629abcc4ee01c6b0eec0b138269a0fa5f919da45d1b51ac81b0c23d43b9a22e7736338dda57699c16adbdcceb78f9edd006b97025f12ae12a3e0907c1fcf54d23386cd3c1680105108a70f59d32b3a9589dff81582331ca4e0f52eb2fe914f27c91395679c9bf5fb4297167e154a750a7f8551315fa0bc88b7e4406d1d6dc1bca67619513006b53549c4fae77b7ba006170169fb589bd901a530917e85655276ecf1c02b20a264dc1a9e5aba038af5b3d95cb04903e62d789b1547947155bea3f067ffc2f8929f43268da2b6d15d4dce7a7cee8300feaff3b47f9146023fbee052bda0b8bede709598ce65d0197f451c33336f3522c4cd57769a111eda3714299fbc1b9cb711cf12d2c5e893fda44e1d7e064e281f411fa3dedb08e299cc1b99bc30b107d8289fda392c9d41059b654d40959d0d28ff5aeec1a2ffb6f39ada14aca04618127bf6d986d9cf2f599658b8e0f19028d73daf178555b21b44323dd41e08f4a0b4e209046e31fed61ad56dd7fce8cd057a5d0cbf93b8117fdf102b8696e21b1601ad7add1ed9379d41a5245ec0b3aaf36fe448789e2b61a27039ed3abf1e00ba33552fe733c703e3ca7d08165d55fdd884ba009c813f60dfe5184e0a1a22d35bc3e073f632f2af2881e9ee5d1325eb971cdd4ace9e45b90b037787a6b04cda6c4f6fa86769781ae4c8ba68882f55ef5a529a2fa767e4d41364c57c3b051284f4793210bdcd26fe0c58ba5ed2a188e84073c4a712dc77307c7a26211e675875323383f45e9f65394b6920bdba1db5f3aa881316ac7312d7bf932ed67482e3b643f40508ac4bbffb5bd9e53be190b791f8d3e3165d13cae81a96a448b02d1e5d918ef0285292fabbf9c32d196549788d28fababee6d6817986ff0b32070ee93ef726851c97325ea0ccc5cae1c402224ca1dcdae833d4ec7ed09f1a6994f88a6c3d49a3ad2c3259a6c4154064c2d642d48cc21a37f9d2f752d9d5e732149f9d34dd6371e837007f821dc02c563993d374017bca5ac3cabec7adb83f7b5a2dd4944f8724142d98fe7cc78595aa8d5019480d7f988d984924d36fda6acde92870f910fe6d64ed1f423ed1b91e9c364a45e17f3625c6d5d23e43476e0be24985c1ce73a76b060de5883a6eb061e489048635492973cd41714e9b12259691b528873b2fe6eb474d0818d8d1885ad4254841af12500add234763193d3835b496460fcfb064782761caf443d0bddffbbb7caf9c5d3a4c147cea9759bebb57075acc136c10e264f80c68c2505813fe4fbc5f45089bd101a12d3e23d71e4302a2f00e551fb17bdee2b0fd1b0f0d0ffd544d3a7b5e3be1c5b9c31ab2664bd977f0dc8d8dea43fb70cc3db8001f80941bce5992b651412bd684377cffacfd1ec6cf6d47778873e98c341bb54ce82d29fb326508ef606ea91225f661d8a6d7783371cb003bba513283459172d21ce19cb9acc4fe4b2da487fb465dc4c821e74970ecf607b02426c3ce40c37ac1441d51df391c4d7dfde4ee27af9cb7cc0b8f7cb28277ce0f82ccd675a3f4cc20f89b3cccad00edb0109f41f153e99466154bf12e3f57d87e557be10fa8b7d39a766f790e24eda7ecdb5ae94413d4ef5a85f18dbaaa82a2e8d5f30f93dd7194fc52bf0f847835553331768dbbd6ac9a0b0447ac1b6387d126ff1755a978f0e2a3cf56ff8c58f453dce867f491635b1d732377442a067d6e519a07464c603ba7c9b9bcd96a9a7adec89b83455149dd07fa43977588a591988a4ebe3a7c159a07b7308f3089085791714f700df1a68de73bf459af5b3eae294b141166d37e3cc3afc96d100fb6df22e7984ed0d2a7c6038d6a44c8a32e6ba20068c0eabd3dc3cc8cd2fe82b5f0fe76092f440457672926d71bf4ed5d652c388f4163825�x������������� �����X���(
�b������0)������-��$=����������������-�.�,��PUTENV to ccflags (#508496)- #504386 update of Compress::Raw::Zlib 2.020- update File::Spec (PathTools) to 3.30- fix #221113, $! wrongly set when EOF is reached- do not use quotes in patchlevel.h; it breaks installation from cpan (#495183)- update CGI to 3.43, dropping upstreamed perl-CGI-escape.patch- fix CGI::escape for all strings (#472571)
- perl-CGI-t-util-58.patch: Do not distort lib/CGI/t/util-58.t
  http://rt.perl.org/rt3/Ticket/Display.html?id=64502- Move the gargantuan Changes* collection to -devel (#492605)- update module autodie- update Digest::SHA (fixes 489221)- drop 26_fix_pod2man_upgrade (don't need it)
- fix typo in %define ExtUtils_CBuilder_version- apply Change 34507: Fix memory leak in single-char character class optimization
- Reorder @INC, based on b9ba2fadb18b54e35e5de54f945111a56cbcb249
- fix Archive::Extract to fix test failure caused by tar >= 1.21
- Merge useful Debian patches- remove compatibility obsolete sitelib directories
- use a better BuildRoot
- drop a redundant mkdir in %install
- call patchlevel.h only once; rm patchlevel.bak
- update modules Sys::Syslog, Module::Load::Conditional, Module::CoreList,
  Test::Harness, Test::Simple, CGI.pm (dropping the upstreamed patch),
  File::Path (that includes our perl-5.10.0-CVE-2008-2827.patch),
  constant, Pod::Simple, Archive::Tar, Archive::Extract, File::Fetch,
  File::Temp, IPC::Cmd, Time::HiRes, Module::Build, ExtUtils::CBuilder
- standardize the patches for updating embedded modules
- work around a bug in Module::Build tests bu setting TMPDIR to a directory
  inside the source tree- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add /usr/lib/perl5/site_perl to otherlibs (bz 484053)- build sparc64 without _smp_mflags- limit sparc builds to -j12- update IPC::Cmd to v 0.42- 455410 http://rt.perl.org/rt3/Public/Bug/Display.html?id=54934
  Attempt to free unreferenced scalar fiddling with the symbol table
  Keep the refcount of the globs generated by PerlIO::via balanced.- add missing XHTML.pm into Pod::Simple- 295021 CVE-2007-4829 perl-Archive-Tar directory traversal flaws
- add another source for binary files, which test untaring links- to fix Fedora bz 473223, which is really perl bug #54186 (http://rt.perl.org/rt3//Public/Bug/Display.html?id=54186)
  we apply Changes 33640, 33881, 33896, 33897- change summary according to RFC fix summary discussion at fedora-devel :)- update File::Temp to 0.20- Include fix for rt#52740 to fix a crash when using Devel::Symdump and
  Compress::Zlib together- rt#33242, rhbz#459918. Segfault after reblessing objects in Storable.
- rhbz#465728 upgrade Simple::Pod to 3.07- also preserve the timestamp of AUTHORS; move the fix to the recode
  function, which is where the stamps go wrong- give Changes*.gz the same datetime to avoid multilib conflict- remove Tar.pm from Archive-Extract
- fix version of Test::Simple in spec
- update Test::Simple
- update Archive::Tar to 1.38- 462444 update Test::Simple to 0.80- move libnet to the right directory, along Net/Config.pm- do not create directory .../%{version}/auto- 457867 remove required IPC::Run from CPANPLUS - needed only by win32
- 457771 add path- CGI.pm bug in exists() on tied param hash (#457085)
- move the enc2xs templates (../Encode/*.e2x) to -devel, (#456534)- 455933 update to CGI-3.38
- fix fuzz problems (patch6)
- 217833 pos() function handle unicode characters correct- rebuild for new db4 4.7- remove db4 require, it is handled automatically- 453646 use -DPERL_USE_SAFE_PUTENV. Without fail some modules f.e. readline.- 451078 update Test::Harness to 3.12 for more testing. Removed verbose 
test, new Test::Harness has possibly verbose output, but updated package
has a lot of features f.e. TAP::Harness. Carefully watched all new bugs 
related to tests!- bump the release number, so that it is not smaller than in F-9- CVE-2008-2827 perl: insecure use of chmod in rmtree- 447371 wrong access permission rt49003- make config parameter list consistent for 32bit and 64bit platforms,
  ad�x�������������������X���(
P�������
���k!�${����������������k!j!l!�b51feaa57516b7fe10742fd4f38fdd08f74f87af36ba424dbac62d0b2e8a042ccc4c8af2d55404c8088de4a344f7c5149a58d518b6fbfbe870dac3497ad12ad774046ed9e25ab1f8c892144d777fcff065630a9b689a3a4676f048a11b8f24c44bb3cb20453548999f118bde7def64a6a41066e2b4ac0fcc6102a0902ee3948f415b55e974cee437be0fec71917862207509a5d4dcbfe7d06c7ac1503daa218837eb80df5a7262211647c634ce6bf7c3c49c2f8499a1c966b7e9ed3d2e110dbedd00331b6f23383ad51685882af50893f924dd5cf588389094d11cb08a7be56905c6cd78783b771877ea198988eb9f074300ed6974d022ec06c755e4e83b206773b4bbd98c91012db5ad56bebfd1e98a41e829bfa88bc8d24b6af30be8bf88c029b0509e1a7dd804af838035272514f9edababc4629ce365301e0ebb8fa13e1c7927b58b0febe5fcf0e17258a03006ee35489bf93ce8c311e68afd0ccc8eb7204b4c911854a4072e1b54df9bb9f251ce46fc182e45e6a9d9e6fbe837b48058ac2e4b328991fed9e46faaeb05b66919c9069e1e5579a270f8e98033f86c5ca1ec661b806efa2c2b68be1d91f12aebe960f6bb7072f5dcd2843e285195f09dd379c4003a543a954bbced910cc24a9631ff98632b415a8d3a388507dd0cb1b726e8774639940f0d8fb3395eb4ca01b69e6424e897bf9e486711172243b9ae2c935a9f510d7f2c278679a55406a45a9628b63205c39c30c2ae8954cbf34a7412f75b1523283490f44c4d9d3a71595702a760ee0599002aa5351f9b82cf633523284b28bd02d23ac16394df4c51efe7c49fd8ddaba8f9c290ae68de38065db1e3a3be17a8e53549a812195c8d3e2399bf896e2b9e5c9b01d5946687e562158d966a223d8fdc1f3fc8acbeb01b22f1b3328c051b8274cd0f3be05645869425b2f7a91a85b42152e1ba9c1a81652dca9e3f5248c373df00f320bde68ca6964aba56093047d4abfbe16584935d5f5e1601cabafcc2ad6bb6d73bf13e2e672a519a8f3277faae5f4038049e80410a543a7ccd8a4588617380e1cf54bc19e40dac720378d93b5e5f9b8cbbba186f08752ef2cd75aad8bd9770188f7ec5a905529c56036ac9af61c4445d5c1645fe4dd0bfb9a0c67fe0e21449bcb99989d65b1b4dd3f3045247a6f5612ec5cc9cdb8c2090e63828a0cba4419f4851aa230900b4f01aa4ac85d0147b4f900865d67709990791abde072bfd0b86b5e02cba0dd2b6120467a495a61952beae59929df8b162edcadb3d7951328bd2b0039a585d8edfa3f694d23b49d9491fa70650acb8914d4b1ca956dd62e24966de785bad3144c2493fd8be0e20ab887513569f56ee4054e4e8df52978b2313292938da772f85400107540753a601bdf002ab78bf0e41bf58b453bbed302817f3ff1bfbde925df5b4b0a284f2779b91c52157e280ba5f677a584a3bf0ca636056a1316c9e1084c7d80a4b476998c8dd15c91ccb150c8b27a0185d490628a1c39aa5e1eabd627dd782eae6e556d98f00f56cfa4b25b3632025e1b9b25b29fcb4242641632d697bd64e3335a8566bd23a7f6a39718e6822b11c605096b3b4191258fdcf87ed467acfd60a3843be971f1ea48f10f8fe79bda020dc28a8f0500bd2baa2d965943d11270037221c36328a7552a5895be8492c8d8c4f35858b7b38c90d6c773571df2c7aa106dd1de77cc830ab35d9d49b3a38d1f788b84ab087bad231fb75430b97d14131cbe5d6114d5c224aa74bf4a9113b65261220024bde69d9535595bbc8822fb13a214b54e144a9114a297d285207cd189b1e6b5d5e39f7a5cd78bf2d6a8784f9951069c4de087767aba803fac39d4ad50666628df989171c5fc36dff241dffb825fbbf301f0865b44d0178bf06b8d64db81f4970e70e8af616d221d0d0135abe2f789b46b30c8a8bd5eb5dcde4c28158c98cdcc7bb1445e9dd1b9aeb758ee3eee6a76d7d4d6813386b902881af5599410fb1fde8ce4bcb4dcc4f5096be533b6d51823a66974ead1646abc3ea448bfaf11d4c6b22d1b8062fd004ce20f18cb75b709da8166a85a7b38cb9e91f473ecd268ce85f24eb7f2c42bac734031887e217d3925e85db56a1d5e11358c3bb2863c74c3a66b2ab981cd39c42c19cf57d79a16afde0166cecefe177c99222906101818096bb189359eabd27a8882ce1d7848b4d3bd04a1c6c086dc1a2376e836d80d2b5046f573004d7b34a2de113f79ddcd9e882c78836fb5907a144b5b45b914103c5a8f19acaeff22500c335a28056962204a19668b9d1067ddda412066d8b6e8a13ff527b24b2bf2405972a6b54cb97d730e2f66fe20c6a566718bf0578c96b833e99e502fca4c95abba40456941347c1f766d5c027bac027e55c296b5af3e6a04f32681fb2ac17540894ad26048cba0d55333a3584e950e79fa494927933a7c2cbfaed0a1a527c3c16c3eea4ac9858bb4bb03388af33b1599e9a7a11d89d0d8a8ce5d51520e54aa60d0fa136f1f46b4f22ed85d3516bd2f058cb4aabf34b5d35b88a585fc158a375fb9fec1335a923a339dccb5b62cfce18b8a628de3554de6f41a2ec7009b7bafc4cc77c59a75b4f6a7a64626d8d162ee7dd8ac7d19dc6b58e6efe8af6df385a175a5e56b87ff984e1efc6ee11716e6c206ceeb6403e2801c2987b860885b69ae6fd831ac0b5b0cd249388591b2cd91996fb7dea644201f661855e03e1c75e03197dc7c71433f2fcb6a5fb3066e30ff3b7175bc7a4836e83f3f1dd5b1aa8ea084f673cc57dcfa45f191433e06fc714ecbb2917bc6056ab1481�x������������������X��(
��������q����d�$^�����������������d�d�d�'
z�U ""
��d%%'
��+"�����
&b0
�'.P$$�
�#�!)�!	�
�	��%�	s'	�
\	�		!!	�#%(}
8H�#########
**p*�":
K""	�"��<
�
�%%	s(�	A!!%%^
2
K"	�	"	+""#..
��""#$$	�
�'
(	u
�i�'%%'��
+"	=&"&&�&"�+*%%'
K'!!'%'%  '%%'"++""
�&
�'.'$$###	U@	�%Mf
��
�$!!!!!!!���""""b"""""
�""�"
�"""<
v	
%%%%%%  $$$$$$% N $$%$$%$%%   $w	�%%%%%%%%%%%	�%%%%%%%%%%%%%�%#################�#####	e�	�	�
��
K
�   e
� 	� �   $
O
�
�"  D
� 
�	E�x�������������������X�b�(
�p����9�������d�$�����������������d�d�d��x������������������X���(
K�����l!�$|����������������l!k!m!�4e8071117daa1462fc00c18a8ee4679c98976dec4e84dd5601df776f9e2e8ebf2e6c30b2c72f681ea9f5a5445c1f68fc00cd8b492a731be5d61b46d5bcbd542a98a556bbeda921171189343d3b89540907c4c16ad7acde7370e2458c83848818e973a5ab895a5f32a9c6835ac08fde1c59e2302c5ba3731ebafa49a7c8b187aa3579c5ad85458dc1d4a69f8f3d385275c551f14e87fc6d4d01b918852f43944746059e08f2f5e7c811906f79743662e4d63ba6f4f9e196eca25b0e03977b03700c72a50c6e67d05301882ba0e229ed1c00dc4722407744290e420f1dae71f59fb1d262003f36dcf41b36f8eac8ccea53562b78eb3d8ee53d51135fd7eb0c9b2b1a998d5a12e37c48b06543c0b0a30b855c91c6cc6f2ed3d29cdc6c8e654a54ae7038f66b6875413dfdb9b7a47fffaff9480ad4e883f97e4654b8df54edc7e0aecd2e4d41172704c12cf192866a6b488af15474f63973d8f1064a77a91b1c33c1a785be5eba71869d55529020360216990274c84dcecef61df6c6685ecff97746427deb37fd0b9846fd2a0813ea78699535120bcb6c92840e9d20977b49e93ab07c16cab1f67198dd0a76ce372a9c9a7ea30c5aaef280e92f64a7d78aa08002fefb3ca633966af7afc32e0c6829fb97d3d4b889a0fe0bcbabcd764e16e7fd37d4f4438a6a475727f3bdb0c0bfcac1dfba2112c52e53db8ba690bbd66378d9f96244acebcee2a568453bec65393aa6ced34cdad76bccb51e85616e8481036622fefcc5505f487cf3d96e1aead216ec5746a1488f1da79c6968353d9b0efd7da7732d2bc3f0c936b427036064dcd4e8295cddde295b05bea95544f63e71e7d19c8b08322d7333685b93948a089c872c003887ea0639af99bfb37a70055c7ed70c95a216497cd206f4ec57039eb39d815f7a2685b587ee3b5345b547682d3abeac1da6495707516cceab022541ced1d3f4264c243312d70ddb5e449743658cdb9e3287620aa69947d1643a0b5f85dbd0c05036e7ca0181d18f06d1833f3ef3b3b1f45b849e242f9b016b50bd1ce87258e1ff5b5d80f15554c6c72e898f56258ccbe67702de4c22b7247fde4e104d1797fa2159b23ca85e4db0a06b705888603798d11ff62a45026ecbb8eb4ccee42f89b5052665959ebcce0bcb342dc876167e26798530373099b7077d2ae2eb88e8ece8dc80f5a9494b542741f1b1eb098a0073a803ef2f7209aa3d6835691f4f70a115dfe3d079b83951eb8b39aafcf5c17c006236c79702c592c7b12b2b1960532beeac06b376980de29e885cb74cd8eea47d3420055c7bc034860fc47ad6ef9207f58b101706718465fcc2201e7452c4d2c0770ec0f1caa0a91e2888512c29119b66cbca86468a2b3fe0a50649d4ac9160a3c2b928bf51ca14c7a9efa9fd698455a9f209da48d6048398a0016ed900db3dfda98e238499d755d98a25bb6e14a7911a8539b5eeb15f14e7509566324e475cfe7923aeda62c940ded47065649e9d182e9fdbeec515166db38bcfc7266bdb3258cdbce7dcc1876bfc922b8b56adbb1c68871299c6d9b5c873cffe7d13f6eead7e91f4a2c5f59d2b7aa1294d4f78299176c84753bc2876070c7678a1327a5054c74dc01ee40f24f1522e5d49ed948ea588bace5df645f90af72ad22f40f17a5c9f8c2588208f872080271ea3ca841f273a891c9bc72a10d9fae6d9016c4b4cca3c8dbb48f762c3f9ec8614b4ebb811db513aee2140ef2d8c485787c98d1e16c4af1084bdc312e75d64afd644146d3312aeba74c35291c286a54d77133c9cf485bdb056003e8081ed4b784274a05e6636ed115c450a71ca7e097a0a0ca718f87a9b14b61f7413d9c11c5da7bf19c00185ec3967092aca6c621e5e120cfbb3362fa6b7a3158a7a96c0089af3a93e203fa18303e6da44bf0d2922b5bd5c5f19f171e4387c8ac4ef009a30e91f6146df197ff662dfc991203285679bb3ff129c2f389d77fa668142af8c821364ae36e231b574f2338895f4187ec48396d64bfe2a00c2257e000042e196cb0dafbc787fbcb8db02a2e012b27de8c6ef3ddf300b57848196855a260a2c9e8897f2158273280fa3bafbade0ca4bef08d345742c57c194f837c2270aa8b5ece4569da7e292dcdcfcfc741e63241085df8fe4532d427fc2ef98c9951ea5a168fe50f09c00fab153d671bb6f6c5e3e93bf4bfe5aa53cd390311fdf280b780a9662ed794cd7d55b52e67565df7b2696f22417d33e662a314b04ff8077ef67b485137c33baab7162269e5b8723bf08a5d597b9d35d6d38616a6c381e56e438bad92ba0ba8fab15005ff67b9ce3bc16b66d531bf042fd43f31d5bb4ba1b8664ceab0dde3f3e5ae7c60f84c58ba6ce2bdecaf9fe803dfb7491487e37ce76609a37e99f89da43544a00633c4e578fd39c102588807709ffea4223b2f2afb8be03ae7a3e856bc954e762f1db761354e6a572bcf60a9d0a7269162591d5a37beec2086e4a60ff53cb9bd0a2f4791af7c6f9eaf72c3598d06fc57479347dec5d080152e2db562d29d65dbe2b6a62e8ba73f1897976fcafc37b57f4c638409b483c8b660a985dfddb9e436ed41627e1f058e0e47f9a96c5cd41b28b5222c466d15cf1cb162fd8b55b36cf25635b77bbcc4c394eaa6a3b35d49547d7936c0cf95da8d5ff968b66cfb9d9f2f00c32afc16fdf4a77da78db810a8c16ec3a1b9f4f85a4b5ad23d5fee6e6424d0c0c7753e69930f48381cdd6aae6b81a099e4fd47d765e1f9fb57cb2f2a3d9a2e3e9968d73fe0de421cdc289a6959f995fe73b07e3e470beda39d24184ff08b9d0977e�x�����x�����������X&��(
���������5Y�$%����������������5Y6Y4Y�urrent_time.3ssl.gzX509_cmp_time.3ssl.gzX509_delete_ext.3ssl.gzX509_digest.3ssl.gzX509_dup.3ssl.gzX509_free.3ssl.gzX509_get0_authority_issuer.3ssl.gzX509_get0_authority_key_id.3ssl.gzX509_get0_authority_serial.3ssl.gzX509_get0_extensions.3ssl.gzX509_get0_notAfter.3ssl.gzX509_get0_notBefore.3ssl.gzX509_get0_pubkey.3ssl.gzX509_get0_serialNumber.3ssl.gzX509_get0_signature.3ssl.gzX509_get0_subject_key_id.3ssl.gzX509_get0_tbs_sigalg.3ssl.gzX509_get0_uids.3ssl.gzX509_get_X509_PUBKEY.3ssl.gzX509_get_ex_data.3ssl.gzX509_get_ex_new_index.3ssl.gzX509_get_ext.3ssl.gzX509_get_ext_by_NID.3ssl.gzX509_get_ext_by_OBJ.3ssl.gzX509_get_ext_by_critical.3ssl.gzX509_get_ext_count.3ssl.gzX509_get_ext_d2i.3ssl.gzX509_get_extended_key_usage.3ssl.gzX509_get_extension_flags.3ssl.gzX509_get_issuer_name.3ssl.gzX509_get_key_usage.3ssl.gzX509_get_pathlen.3ssl.gzX509_get_proxy_pathlen.3ssl.gzX509_get_pubkey.3ssl.gzX509_get_serialNumber.3ssl.gzX509_get_signature_info.3ssl.gzX509_get_signature_nid.3ssl.gzX509_get_subject_name.3ssl.gzX509_get_version.3ssl.gzX509_getm_notAfter.3ssl.gzX509_getm_notBefore.3ssl.gzX509_issuer_and_serial_cmp.3ssl.gzX509_issuer_name_cmp.3ssl.gzX509_load_cert_crl_file.3ssl.gzX509_load_cert_file.3ssl.gzX509_load_crl_file.3ssl.gzX509_new.3ssl.gzX509_pubkey_digest.3ssl.gzX509_set1_notAfter.3ssl.gzX509_set1_notBefore.3ssl.gzX509_set_ex_data.3ssl.gzX509_set_issuer_name.3ssl.gzX509_set_proxy_flag.3ssl.gzX509_set_proxy_pathlen.3ssl.gzX509_set_pubkey.3ssl.gzX509_set_serialNumber.3ssl.gzX509_set_subject_name.3ssl.gzX509_set_version.3ssl.gzX509_sign.3ssl.gzX509_sign_ctx.3ssl.gzX509_subject_name_cmp.3ssl.gzX509_time_adj.3ssl.gzX509_time_adj_ex.3ssl.gzX509_up_ref.3ssl.gzX509_verify.3ssl.gzX509_verify_cert.3ssl.gzX509_verify_cert_error_string.3ssl.gzX509v3_add_ext.3ssl.gzX509v3_delete_ext.3ssl.gzX509v3_get_ext.3ssl.gzX509v3_get_ext_by_NID.3ssl.gzX509v3_get_ext_by_OBJ.3ssl.gzX509v3_get_ext_by_critical.3ssl.gzX509v3_get_ext_count.3ssl.gzcustom_ext_add_cb.3ssl.gzcustom_ext_free_cb.3ssl.gzcustom_ext_parse_cb.3ssl.gzd2i_ACCESS_DESCRIPTION.3ssl.gzd2i_ADMISSIONS.3ssl.gzd2i_ADMISSION_SYNTAX.3ssl.gzd2i_ASIdOrRange.3ssl.gzd2i_ASIdentifierChoice.3ssl.gzd2i_ASIdentifiers.3ssl.gzd2i_ASN1_BIT_STRING.3ssl.gzd2i_ASN1_BMPSTRING.3ssl.gzd2i_ASN1_ENUMERATED.3ssl.gzd2i_ASN1_GENERALIZEDTIME.3ssl.gzd2i_ASN1_GENERALSTRING.3ssl.gzd2i_ASN1_IA5STRING.3ssl.gzd2i_ASN1_INTEGER.3ssl.gzd2i_ASN1_NULL.3ssl.gzd2i_ASN1_OBJECT.3ssl.gzd2i_ASN1_OCTET_STRING.3ssl.gzd2i_ASN1_PRINTABLE.3ssl.gzd2i_ASN1_PRINTABLESTRING.3ssl.gzd2i_ASN1_SEQUENCE_ANY.3ssl.gzd2i_ASN1_SET_ANY.3ssl.gzd2i_ASN1_T61STRING.3ssl.gzd2i_ASN1_TIME.3ssl.gzd2i_ASN1_TYPE.3ssl.gzd2i_ASN1_UINTEGER.3ssl.gzd2i_ASN1_UNIVERSALSTRING.3ssl.gzd2i_ASN1_UTCTIME.3ssl.gzd2i_ASN1_UTF8STRING.3ssl.gzd2i_ASN1_VISIBLESTRING.3ssl.gzd2i_ASRange.3ssl.gzd2i_AUTHORITY_INFO_ACCESS.3ssl.gzd2i_AUTHORITY_KEYID.3ssl.gzd2i_AutoPrivateKey.3ssl.gzd2i_BASIC_CONSTRAINTS.3ssl.gzd2i_CERTIFICATEPOLICIES.3ssl.gzd2i_CMS_ContentInfo.3ssl.gzd2i_CMS_ReceiptRequest.3ssl.gzd2i_CMS_bio.3ssl.gzd2i_CRL_DIST_POINTS.3ssl.gzd2i_DHparams.3ssl.gzd2i_DHxparams.3ssl.gzd2i_DIRECTORYSTRING.3ssl.gzd2i_DISPLAYTEXT.3ssl.gzd2i_DIST_POINT.3ssl.gzd2i_DIST_POINT_NAME.3ssl.gzd2i_DSAPrivateKey.3ssl.gzd2i_DSAPrivateKey_bio.3ssl.gzd2i_DSAPrivateKey_fp.3ssl.gzd2i_DSAPublicKey.3ssl.gzd2i_DSA_PUBKEY.3ssl.gzd2i_DSA_PUBKEY_bio.3ssl.gzd2i_DSA_PUBKEY_fp.3ssl.gzd2i_DSA_SIG.3ssl.gzd2i_DSAparams.3ssl.gzd2i_ECDSA_SIG.3ssl.gzd2i_ECPKParameters.3ssl.gzd2i_ECParameters.3ssl.gzd2i_ECPrivateKey.3ssl.gzd2i_ECPrivateKey_bio.3ssl.gzd2i_ECPrivateKey_fp.3ssl.gzd2i_EC_PUBKEY.3ssl.gzd2i_EC_PUBKEY_bio.3ssl.gzd2i_EC_PUBKEY_fp.3ssl.gzd2i_EDIPARTYNAME.3ssl.gzd2i_ESS_CERT_ID.3ssl.gzd2i_ESS_ISSUER_SERIAL.3ssl.gzd2i_ESS_SIGNING_CERT.3ssl.gzd2i_EXTENDED_KEY_USAGE.3ssl.gzd2i_GENERAL_NAME.3ssl.gzd2i_GENERAL_NAMES.3ssl.gzd2i_IPAddressChoice.3ssl.gzd2i_IPAddressFamily.3ssl.gzd2i_IPAddressOrRange.3ssl.gzd2i_IPAddressRange.3ssl.gzd2i_ISSUING_DIST_�x������������������X���(
@Q������(����r!�$b����������������r!q!s!�6.3../../libperl.so.5.26.3��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x�������������h�����X�6�(
�)"���$g�����������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroottuned-2.22.1-6.el8_10.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������config(tuned)tuned@ 	@@@




/bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/usr/libexec/platform-pythonconfig(tuned)dbusethtoolgawkhdparmiproutekmodpolkitpython(abi)python3-dbuspython3-gobject-basepython3-linux-procfspython3-perfpython3-pyudevpython3-syspurposerpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)systemdsystemdsystemdutil-linuxvirt-whatvirt-what2.22.1-6.el8_103.63.0.4-14.6.0-14.0.4-14.0-15.2-14.14.3# remove ktune from old tuned, now part of tuned
/usr/sbin/service ktune stop &>/dev/null || :
/usr/sbin/chkconfig --del ktune &>/dev/null || :tuned2.0-0g{�g;,@f4�e�@e�@e�C�e�7@e�N@e��d��d�@c�l@c��@c�b�{@b�L@b��@b�@b��a�r@`�@`�@`��`/�@_�H@_�0@_u�^��^�)@^�b�^�(@^x��^C�^=Q@^�@^r�]��@]�@]V��]V��]��]�@\o�@\4��\�@\U@\
�\	@[�1�[�1�[��[��@[j�@[E�@[D��[CN@[<��[0�@[o�Z�n�Z�@Z��@Y��@Yy�Yu�@Y.�X�@X���X�@W�v@W��@W��@W�@W�@V���V��@U�5@U��@U�@U�@UB@U/@T��T�|�T?�@T+�Sc@R|�@Rz/@QHS@Q0�@Qh@P�!@P���P��@Pr�@P�@O�/@O�/@Oz�@Ou�@Pavol Žáčik <pzacik@redhat.com> - 2.22.1-6Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.1-5Pavol Žáčik <pzacik@redhat.com> - 2.22.1-4.1Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.1-4Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.1-3Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.1-2Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.1-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.22.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.21.0-1Jaroslav Škarvada <jskarvad@redhat.com> - 2.21.0-0.1.rc1Jaroslav Škarvada <jskarvad@redhat.com> - 2.20.0-1Jaroslav Škarvada <�x��������������w����X��(
��������0������i�$y����������������ih&�mϱm
�����lu��:
��
�8�&]LBɿY=���
�@��_^eN��<��˝��f�^�a�^��Q�=��3i��To&K9�eG�'�	P�4��?�I׭[�Ru�]D˟�92�t���[�%�>p�u��l�Z$
1i"�@��TA��Q�z+���eG�7�{V?~)�p�|��BR�ӡ�����7�2N���FіP������`�m�.?�����Κ)yv3h,ڍ��=��6O�	֎�j�*z%�"ޅ����
�kP�i���<��K+SzR~���2*������Ssq?�<�{�3�F�.%p� ��v���N��^5.A��8��3_��hG����%�ŰPP_��k%h1@�0�u���ah����V^�P�<��%�#C�f0���Rfbac21015d11b9523b89929117bb5bfcb92fe3a37e5be3b56f0f682de6ced94bcf8223a0f151ce51cd7bbc3cc9076cbedeb39e1bfX�*D4fX�t point
- better wide chars usage in the cal command (based on the old 'moremisc' patch)- rebuilt- rebuilt- update to upstream version 2.13-pre6
- fix #172203 - mount man page in RHEL4 lacks any info on cifs mount options- fix #171337 - mkfs.cramfs doesn't work correctly with empty files- rebuild- updated version of the patch for hwclock audit- fix #171337 - mkfs.cramfs dies creating installer image- update to upstream 2.13pre5
- remove separated cramfs1.1 (already in upstream package)
- remove odd symlink /usr/bin/mkcramfs -> ../../sbin/mkfs.cramfs
- fix #170171 - ipcs -lm always report "max total shared memory (kbytes) = 0"* fix #170564 - add audit message to login- fix #169628 - /usr/bin/floppy doesn't work with /dev/fd0
- fix #168436 - login will attempt to run if it has no read/write access to its terminal
- fix #168434 - login's timeout can fail - needs to call siginterrupt(SIGALRM,1)
- fix #165253 - losetup missing option -a [new feature]
- update PAM files (replace pam_stack with new "include" PAM directive)
- remove kbdrate from src.rpm
- update to 2.13pre4- fix #170110 - Documentation for 'rsize' and 'wsize' NFS mount options
		is misleading- fix #166923 - hwclock will not run on a non audit-enabled kernel
- fix #159410 - mkswap(8) claims max swap area size is 2 GB
- fix #165863 - swsusp swaps should be reinitialized
- change /var/log/lastlog perms to 0644- /usr/share/misc/getopt/* -move-> /usr/share/doc/util-linux-2.13/getopt-*
- the arch command marked as deprecated
- removed: elvtune, rescuept and setfdprm
- removed: man8/sln.8 (moved to man-pages, see #10601)
- removed REDAME.pg and README.reset
- .spec file cleanup
- added schedutils (commands: chrt, ionice and taskset)- fix #159339 - util-linux updates for new audit system
- fix #158737 - sfdisk warning for large partitions, gpt
- fix #150912 - Add ocfs2 support
- NULL is better than zero at end of execl()- fix #157656 - CRM 546998: Possible bug in vipw, changes permissions of /etc/shadow and /etc/gshadow
- fix #159339 - util-linux updates for new audit system (pam_loginuid.so added to util-linux-selinux.pamd)
- fix #159418 - sfdisk unusable - crashes immediately on invocation
- fix #157674 - sync option on VFAT mount destroys flash drives
- fix .spec file /usr/sbin/{hwclock,clock} symlinks- rebuild against new libe2fsprogs (and libblkid) to fix cramfs auto-detection- rebuild- fix #156597 - look - doesn't work with separators- fix #154498 - util-linux login & pam session
- fix #155293 - man 5 nfs should include vers as a mount option
- fix #76467 - At boot time, fsck chokes on LVs listed by label in fstab
- new Source URL
- added note about ATAPI IDE floppy to fdformat.8
- fix #145355 - Man pages for fstab and fstab-sync in conflict- enable build with libblkid from e2fsprogs-devel
- remove workaround for duplicated labels- Fixed nfs mount to rollback correctly.- added /var/log/lastlog to util-linux (#151635)
- disabled 'newgrp' in util-linux (enabled in shadow-utils) (#149997, #151613)
- improved mtab lock (#143118)
- fixed ipcs typo (#151156)
- implemented mount workaround for duplicated labels (#116300)- rebuilt- Changed nfsmount to only use reserve ports when necessary
  (bz# 141773)- Update to util-linux-2.12p. This changes swap header format
  from - you may need to rerun mkswap if you did a clean install of
  FC3.- Update to util-linux-2.12j- Corrected a buffer overflow problem with nfs mounts.
  (bz# 141733)- Patches for various bugs.- Made NFS mounts adhere to the IP �x�������������Xg����X���(
������� ����h!�$x����������������h!i!�H,�?%�d���� �	$�	H��������������	2�>�S�Y`?
\?	�?
X?T?�?
��?��?�?�>�`?�\���h�8(�o8�x�9И�:O�G�?H�?I�?X�DY٘\��?]��?^�>Rb�bd��e��f��l��t��?u�?v�
w�?x�?y$�'�%\�%`�%f�%�%�%�6'�(6
*<*e�*�*�?,�g,�h,�Cperl-libs5.26.3423.el8_10The libraries for the perl run-timeThe is a perl run-time (interpreter as a shared library and include
directories).h�02x64-builder03.almalinux.org](vAlmaLinuxAlmaLinux(GPL+ or Artistic) and HSRL and MIT and UCDAlmaLinux Packaging Team <packager@almalinux.org>Unspecifiedhttp://www.perl.org/linuxx86_64)'!H�pX���`-�1X��8
2P#U,��$;��>��$3HA�H� V�M�<�7\�H�P'�6�z�v� )@=�h��o�K46�S|!=+G}-�M�;�Z�?�v3@��18
wI��[-�f�Y��t!�(rjfD�/
�	�T*�� �N~a#F���w
���b����<M�J7co�s2
a^�&�<
)�"�f���4�R���i4O����+�9t�	(�)Xb�I���	�6,$Z!&R�������<2�rruggg[�:�t	Y�(*H6��L`Jb>6���~��4$��&0&:�D00:9�o- ����t�R	tD����l��n-~iEG�k���
u{-3H�R&&p0d*/V<�&4���^0$[n9nb-b&���1��CF��� K�k�ZRpn���~f7��7H"�J��(v2@0F@H�Hv���P&LJv�!>D2&vn�l0	���(�vVB*0@tX��l����]&bb0�4xD��4>����*2��^X�(@x7!��[#�{��A�������A�A�A�A�큤A�A�A큤����A큤��������������A큤����A큤��������������A큤��������������������������������������������������������������������������������A�A큤������������������������������A큤A큤������������������������A큤A큤A큤A큤����A큤A�x��������������V����X���(
���������Cs'�$c����������������s't'r'�e for pidfiles for all daemons.
- Correct LV list order used by lvconvert when splitting a mirror.
- Check if LV with specified name already exists when splitting a mirror.
- Fix suspend/resume logic for LVs resulting from splitting a mirror.
- Fix possible hang when all mirror images of a mirrored log fail.
- Adjust auto-metadata repair and caching logic to try to cope with empty mdas.
- Update pvcreate, {pv|vg}change, and lvm.conf man pages about metadataignore.
- Prompt if metadataignore with vgextend or pvchange would adjust vg_mda_copies.
- Adjust vg_mda_copies if metadataignore given with vgextend or pvchange.
- Speed up the regex matcher.
- Use "nowatch" udev rule for inappropriate devices.
- Document LVM fault handling in lvm_fault_handling.txt.
- Clarify help text for vg_mda_count.
- Add more verbose messages while checking volume_list and hosttags settings.
- Add log_error when strdup fails in {vg|lv}_change_tag().
- Do not log backtrace in valid _lv_resume() code path.- Remove log directly if all mirror images of a mirrored log fail.
- Randomly select which mdas to use or ignore.
- Add printf format attributes to yes_no_prompt and fix a caller.
- Always pass unsuspended dm devices through persistent filter to other filters.
- Move test for suspended dm devices ahead of other filters.
- Fix another segfault in clvmd -R if no response from daemon received. (2.02.68)
- Remove superfluous suspended device counter from clvmd.
- Fix lvm shell crash when input is entirely whitespace.
- Update partial mode warning message.
- Preserve memlock balance in clvmd when activation triggers a resume.
- Restore the removemissing behaviour of lvconvert --repair --use-policies.- Fix vgremove to allow removal of VG with missing PVs. (2.02.52)
- Add metadata/vgmetadatacopies to lvm.conf.
- Add --metadataignore to pvcreate and vgextend.
- Add vg_mda_copies, pv_mda_used_count and vg_mda_used_count to reports.
- Describe --vgmetadatacopies in lvm.conf and other man pages.
- Add --[vg]metadatacopies to select number of mdas to use in a VG.
- Make the metadata ignore bit control read/write metadata areas in a PV.
- Add pvchange --metadataignore to set or clear a metadata ignore bit.
- Refactor metadata code to prepare for --metadataignore / --vgmetadatacopies.
- Ensure region_size of mirrored log does not exceed its full size.
- Preload libc locale messages to prevent reading it in memory locked state.
- Fix handling of simultaneous mirror image and mirrored log image failure.- Fix udev rules to handle spurious events properly.
- Add Requires: udev >= 158-1 (needed for the change in udev rules).- Have device-mapper-libs require device-mapper (circular) for udev rules.
- Clear exec_prefix.
- Use early udev synchronisation and update of dev nodes for clustered mirrors.
- Add lv_path to reports to offer full /dev pathname.
- Avoid abort when generating cmirror status.
- Fix clvmd initscript status to print only active clustered LVs.
- Fix segfault in clvmd -R if no response from daemon received.
- Honour log argument when down-converting stacked mirror.
- Sleep to workaround clvmd -S race: socket closed early and server drops cmd.
- Exit successfully when using -o help (but not -o +help) with LVM reports.
- Add man pages for lvmconf, dmeventd and non-existent lvmsadc and lvmsar tools.
- Add --force, --nofsck and --resizefs to lvresize/extend/reduce man pages.
- Fix lvm2cmd example in documentation.
- Fix typo in warning message about missing device with allocated data areas.
- Add device name and offset to raw_read_mda_header error messages.
- Allow use of lvm2app and lvm2cmd headers in C++ code.- Require partial option in lvchange --refresh for partial LVs.
- Don't merge unchanged persistent cache file before dumping if tool scanned.
- Avoid selecting names under /dev/block if there is an alternative.
- Fix semctl parameter (union) to avoid misaligned parameter on some arches.
- Fix clvmd initscript restart command to start clvmd if not yet running.
- Handle failed restart of clvmd using -S switch properly.�x�������������HF����X���(
0R�������'������p!�$`����������������p!o!q!�31a656376b76c41bf043dcbdfbf61f9120612f579702c5f179f9677f4fd67aef63fa3c88ad69805564a4a8d438352335794377f689f866cd93cf215f338b1f0fe52d5912abfb4ab9f960dfea020396b05f5558a8ac448fde0b5f94e3c29623484b1b2e8e88649a85579cc6c12e32facee37ac5c311b345234a4004d720bd28a8349caae8ca82acd190abd41c3c88c13bde37158857263371248f0184311dabf6bb118226a94c198ac52281349d66d00bf6cade3e6125dc982bee68aa9d6cc8ba2a06d06867a11ab7b4cdffd6fd2b22abf0abe3b379b6a87cc168271d0e0edb8d868a50de737c3f1334742d2bdb61e0222ac57920d1b64e2035d501eb34704d9a0c312a8a3e3477eb1e309f6c976df89bb642d58fa42eaff000dde8cbad401a369a0322590d1428b71a286048ffd941d9ae3696583d5332a503a895e95f16ebdf745cc064b83edcfe8cb360e6562c3ce0041fcf54f04e4d1ca7dfd51ca0560ebd5570dfbc36fbb6514ed1d69a09f28e2ff0988661a8fd329dc95433c6998891d6228d4badbec7e0aa2ec98fcb4b727b98e1a23d7d94f975c29041775f5a3afd700f99d63d891ef9b85258a09a0e5d4c1bcbc2bebffb52e9c49359a88d1bd0de16b60667544177b40e7175c2cf5940aad6d5f46ff27b2036c3cd0c0236b7c7bc3259a8169198ab60082797dbc93485b730222b44d2ec6c868bffae0efe4ad0f51b04e09e7d4c5b22d6b0041365ad017bb3c1703b0da6e5c43897548d8b71517483f4f0c6598b499902013880d90afb071d749f3ab1c575d280c3c7abebe425832de7920089d12f1ff9f5432c7e3c18e119cda2bbc55a9094bc3bb27ba3cd41d130eaa26f77811ff7c81eb3cbb61844fa63a7b54df9e23ff5e24e0ba40b140351549a177f6244f70a7568595c449f49f5610dd90df8058b34defa7fd591bbea9bd98b1d44642e2a537bb0b973b5e65e0aff8d6655c0814752ca78d9d255be68312128acb93fbbf91a0b0ac20049ee2f3d50fff5acd161eae24b356af7b4b7ffd949141344893bb51850435239813d410e7f2e1465826b19329f038505dd5d512f5e2cfa833615211dd877e2bbf47f7a965dde51ce869d576ad276742519bec6cdcc1e006b1b03a710b7970ce8c881d35018a47aa9a371d9903e78daf9a6d2f78fd6c7b0677e29f37a64c13f2bf3e466f311ee90f0b7fbccab073a54c5790a0259619ecd0a160a8cc9974519c8aaef4940a7cdb23a48c11ad27255f28c7c9be58c4c3180ca3f899af02ea13ae4ac9e3bbb5b3a97146d5f784818ccbae5acecfa0ffeef23de3f4c1993b1def915b2e183e7e606c7005f1f7f1a374d3336c56bc0f78181e84d70b6a9502a4ac7d7419fa3296fc0e4d77c43b4715bb49fba522a6b2a3cfb1dca7639a2fb23a5364f76eb4a0ae8a585bc1bb288d298024a562b012adca85026d8739eebe8c765ff166fd79f37da37076035a9d8b1932d33a57937a66ec7612a373cb6be1b3f05c8e36e8af7f1df163c968b665034592670512fe850ca07e86b7040a77066a90f1a75eab0846ef4aadf707d15fb4b147f1206e23a5cfbf80b749fe2dcdacea63482c3a84fc3f8619a43c2e00c42581065e3459603ae69a1c97f9c204e3a00c51c643e1f984ad93d188efe99f63297ae16627086e0fd9ef0a60137501915d69cfdc9d0213f1f68895bfbeafddd7260feaca221d40487d90f85e08352621989e21dff842524d4d343ce9543bb1ff872c5ee6336a61a7c9d1182d84ac1fc635c868460e23213c38f39867146387390bf9f643c86040230015dab4e9f46a5faec141bf39e309f2ff073e87f3e1ff1eaaf51f629c389b79d2160fe8e8d765c943598d5932604a0a7117c1bc0d1b865350bba29f155827c2dee0adb9a8b83b509fc4bde4c86c791e67f7a184edb34616f310489c6bde8e110b613d15628a7d311adb97f59ba0a3b8da68930dd6039ebcb873d43e8158685179fd41758f1d688333ab358bed16d5cf109afc7ef1b3286e4feca01461fe72b1596a89843363ba07a68b84b21049719f8e51bd12efdcfabd47bf14308bf8ab87acfb1967742487c2364e399a0df015e3cef0683b825317e4de66b93fdee377fb547a23bfe525fc1dd287f29536517f7780ed37d8524d0da2a8ba8cb324087bc0071a474be404f1b7f2fecd16f002f04ae23d6a058924c960d58c9d9694d4952ff7543ef100f22438cac6eded76d2d5126564088dc308854ac6475901d7829378c256fa6ec29e57ba4a33eb299b5e947b029ca64a99d0a5bb5f2e455b35513056b5435488278cc5f04b4fac9b3f7a853d92842c6730dc449bcf54a1b3e99a4ce0ad6d7884dda17ef0c3aaaf98543fffb1a83133ad7b6de7c0f7dd03463c54e4a295636dfa440a51d2b41a2a89f887f65d342e36203166214fdd67d8187f74cd4766e25b09e6890beb86d2a24c6ca8cf1ad86df74501c303c92b7ce7f5fbe3ca7b37f27105e0bd1fa81f8fab3edcc7685b541495d3cfc1dda698543edb07a700c04bac42952b08d01b78439d4fa25f67e0123c44a00010c0e5a6aa2c95ac6b8163176a616fb7e6ff95e93eb040ab4cdb57bdce4d0cb031bdb6aa3669585fdceb9a76262a4b0fd0f98b28385bd11987598f663a1efce913bf6eee7cc5acaa0ebf55f247d409132cb6b5fcbe80204d9a317f95fdb05a3f1d3cb49e25a857d7dd9001aa62c6368bb6c2803396a7e882af71bba5528b72c2f2d18eaa433e82469716a881b59806592a8e0b147b0f1a67b0163568eb77738ad3db6f64cf402cfc4bf300f5442b1ee79c9fa2f1de738afdcbb8e72deb3b1�x������������`5����X"�(
���������K���V�$F����������������VUW�g../../../../usr/bin/ipcs../../../../usr/sbin/fstrim../../../../usr/bin/mountpoint../../../../usr/sbin/agetty../../../../usr/sbin/delpart../../../../usr/bin/look../../../../usr/bin/setarch../../../../usr/bin/nsenter../../../../usr/sbin/swaplabel../../../../usr/bin/chmem../../../../usr/bin/isosize../../../../usr/sbin/addpart../../../../usr/sbin/blockdev../../../../usr/sbin/swapoff../../../../usr/bin/uuidgen../../../../usr/bin/raw../../../../usr/bin/utmpdump../../../../usr/bin/scriptreplay../../../../usr/bin/login../../../../usr/sbin/sfdisk../../../../usr/sbin/sulogin../../../../usr/bin/namei../../../../usr/bin/cal../../../../usr/bin/findmnt../../../../usr/sbin/runuser../../../../usr/sbin/blkdiscard../../../../usr/bin/getopt../../../../usr/sbin/fsck.minix../../../../usr/sbin/fsck.cramfs../../../../usr/sbin/mkswap../../../../usr/sbin/fdisk../../../../usr/bin/lslogins../../../../usr/bin/more../../../../usr/bin/lsmem../../../../usr/bin/fallocate../../../../usr/sbin/mkfs.cramfs../../../../usr/bin/ipcrm../../../../usr/sbin/switch_root../../../../usr/bin/lsblk../../../../usr/bin/last../../../../usr/sbin/chcpu../../../../usr/sbin/rfkill../../../../usr/bin/taskset../../../../usr/sbin/swapon../../../../usr/sbin/rtcwake../../../../usr/bin/mount../../../../usr/bin/rev../../../../usr/bin/rename../../../../usr/sbin/mkfs.minix../../../../usr/bin/colcrt../../../../usr/sbin/ctrlaltdel../../../../usr/sbin/cfdisk../../../../usr/sbin/blkzone../../../../usr/bin/whereis../../../../usr/sbin/ldattach../../../../usr/bin/write../../../../usr/sbin/mkfs../../../../usr/bin/chrt../../../../usr/bin/lsipc../../../../usr/bin/eject../../../../usr/bin/flock../../../../usr/bin/unshare../../../../usr/sbin/pivot_root../../../../usr/bin/lscpu../../../../usr/bin/lslocks../../../../usr/bin/wall../../../../usr/bin/mesg../../../../usr/bin/fincore../../../../usr/bin/renice../../../../usr/bin/uuidparse../../../../usr/bin/column../../../../usr/bin/script../../../../usr/bin/col../../../../usr/sbin/nologin../../../../usr/sbin/fsck../../../../usr/sbin/fdformat../../../../usr/bin/setterm../../../../usr/bin/kill../../../../usr/sbin/findfs../../../../usr/bin/mcookie../../../../usr/sbin/resizepart../../../../usr/bin/ionice../../../../usr/sbin/hwclock../../../../usr/sbin/zramctl../../../../usr/sbin/blkidhwclocksuY�x�������������8%����X���(
���r�������W�$n�����������������W�W�W�dated to netplug-1.2.6 for security update and fixes.- Updated netplugd to latest upstream version.
- Fixed execshield problem in main.c of netplugd.- Fixed several possible buffer overflows (#120343)- fixed compilation with gcc34- add chkconfig call in post and preun, fix init script (#116555)- Added netplug-1.2.1 to net-tools (FR #103419).- rebuilt-rebuilt- interface option now works as described in the man page (#61113).- rebuilt- Fixed trailing blank bug in hostname output (#101263).
- Remove -O2 fir alpha (#78955).
- Updated netstat statistic output, was still broken.- rebuilt- fix ether-wake.c build with gcc 3.3
- rebuilt- rebuilt- Bumped release and rebuilt- Fixed ether-wake usage output (#55801).- fix build with gcc 3.3- Fixed wrong manpage (#55473).- Added inet6-lookup patch from John van Krieken (#84108).
- Fixed outdated link in ifconfig manpage (#91287).- Fixed incorrect address display for ipx (#46434).
- Fixed wrongly installed manpage dirs (#50664).- Fixed nameif problem (#85748).- Fixed -s parameter.
- Fix /proc statistics for -nic operation.
- Fixed -i operation in general.- Disable smp build.- rebuilt- Rebuild
- Copyright -> License.- Rebuild- Added patch from Norm for a corrected output.- automated rebuild- automated rebuild- fix nstrcmp() to be correct in the case where there are many devices 
  of the same type, eg, "eth10" > "eth1"  (#61436)- do *not* use SIOCDEVPRIVATE for MII ioctls- include wake-on-lan wakeup utility, ether-wake by Donald Becker- itterate to 1.60- use find_lang macro
- less specific locale dirs for man pages- don't use this version of rarp, doesn't work with our 2.4.- fixed man page typo, closing bug #25921- applied twaugh's patch to close bug #25474
- which was a buffer length bug.- locales not initialized correctly (#20570).
- arp: document -e option (#22040).- update to 1.57.
- MTU (and other) option(s) not parsed correctly (#9215).
- allow more granularity iwth --numeric (#9129).- automatic rebuild- update to 1.56.
- FHS packaging.- update to 1.55.- rebuild for sparc baud rates > 38400.- fix description- fix "netstat -ci" (#6904).
- document more netstat options (#7429).- update to 1.54.
- enable "everything but DECnet" including IPv6.- update to 1.53.- plug "netstat -c" fd leak (#3620).- plug potential buffer overruns.- patch to recognize ESP and GRE protocols for VPN masquerade- update to 1.52.- update interface statistics continuously (#1323)- auto rebuild in the new build environment (release 2)- update to 1.51.
- strip binaries.- update to 1.50.
- added slattach/plipconfig/ipmaddr/iptunnel commands.
- enabled translated man pages.- update to 1.49.- update to 1.48.- update to 1.47.- update to 1.46- build root
- include ethers.5- upgraded to 1.45
- patched hostname.c to initialize buffer
- patched ax25.c to use kernel headers- translations modified for de, fr, tr- added config patch- changed to net-tools 1.432
- removed old glibc 2.1 patch- added extra patches for glibc 2.1- included complete set of network protocols (some were removed for
  initial glibc work)- updated glibc patch for glibc 2.0.5- built against glibc
- updated to 1.33/bin/sh	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLcsdeetfrptdededededededefrfrfrfrfrfrfrptptptpt2.0-0.52.20160912git.el82.0-0.52.20160912git.el8�x������������������X�	�(
�y������`�q�$a����������������qpr�C_MESSAGES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/et/LC_MESSAGES//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/id/LC_MESSAGES//usr/share/locale/it/LC_MESSAGES//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/locale/zh_TW/LC_MESSAGES//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

 !"#$%&'()*+,-./0123456789:;<=>?@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@�x�������������(����X��(
���������i������O�$_����������������ONP�
��I'�/'=��������������������������������������������������������������������������������������A�A���A�A�A�A�A�A�A�A���A���A�A�A�A�A�A�A�A���A�A�A�A�A�A���A�A�A���A�A�A�A�A�A�A���A�A�A���A�A�A�A���A�A�A�A�A���A�A�A���A�A�A�A�A�A�A�A�A���A�A�������A�A�A�A�A���A�A���A�A���A�����A�A���A�A�A�A�A���A�A�A�A�������������������������������������������������큤��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������A큤����������A큤����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�[LsJ[LtE[��[+v�[��[��fG�Y��SY��S[��Y��SY��SfG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG�fG��x�������������������X��(
����D��$T����������������D�E�C��e24f2abf4b21f656b33a206304959e84bd43716fe1e1a4e04bce0381d803cf91740ef8af01041085ad785c537b707ae8e57036a321e2c5ef14ea4587339900f839bed5724ce8be94c6acc2d486124a1cff28c9cc506ab7db20b422fb99c50e6bfae7f837fffc1350fec42d274c49b68fc8e5d18325f9799d2a8ae37f6b2842ef78a4f4dd88340d595c16306f8ec407ca9df1aca8b9659e18b4709a0838bd54f4b2fbbd591b4fb0ceddf976f500e872b10879f69b65f18b7da5fe8e03b0b7dd4ea4072cd617df8a6becbf4a8f2d005f99d4977c4f8b89e3cccaf0f07303654e3f2dcab276e4aa421f3c7f8916be04df9717564fe44875d4e404a86ba59a0a5fe1db7a344e6a034668f4ae942c25c349f4d99ce8d304e7f6b07c824f546d0bba590c50f2cb0c51982665afe9d10819b4fe926489d6fb346c73df771db272b58a6b775f6ef158a4904a83dc43f5a653a12a8e58326da20ccd456e2e9b03909e25160eb615d0fb2b46cc3f371830e41221e1debd4884c950f666c3cf792fd5cd11b91812daf5abcfdba283ee9fb8130e3d575167a76087bb4d0233a0b0b01252a5a5743a1ca3e179f0470822917c261b6dd22a4b481d2126cbfb857ed2615c071ef86b995ba3495ccb518b71cd96f74d3e1c6b386a017a3f790459594bca96e284c031a8c70d547844dbd7a55822b8fa31c557a3ddd13dddd28fb23669fc0ea6cd58e9ebef59dc48f4a95d46a49dc15d831180122e3dbcc51e70635209e1639798df492b4339e857c172412c0fad662ed5af1382e470391796379aa8e8809fd7830c7a50cca142a93f487c324163e5702189b978b8a177a534dbd5ff677399f9f0ba47c1203f0e159672462f4f43530e9e5aa6416114738fcb540f8036e67db219741326a41e3606b0f5138bd0870424bad99417b941d59d665e670ac26e47d8b10ec6f9551232252bae4290872773decf76601f84a3ec424fb10edbe20529a31c8c70b8a529dca9b5e5c590e51c30f8bef663cc27f0293dd7050a9b8d6f98a8a9c11b0c6c3efda27f6d13b5c5adb70c14dc306de507145d800a2226aaa8991895b7b60db806020d9ab873891a4b458cac37c50904cced439b499569e005c0a3a007913cddc5d3557f89337490d62015ebbbd5478b80d7f005c846f09280030c00842e32e0f8b30d7ecb9fa461d132d5eb5754db5e32cf607bd1ebb3c2e7d3df6dd95fcb92c0270eae29e7a5cf0ca50d34ea2d7624b871e5ebc5562db90c9055cd0bfd90cbcdbf5962093c123cf10ded6237cae2f07e0ca1f44affb4d144a5c8319dc36041a40107253a2b9bbb38e1ee86297b9ce6a4c4e9d69a6fa0150375e54216ec2cf076c37d38620c3e9346cf374e95d57880d7364a56c812390940dd7574ead12fb64125aedbc546f37f83f40ede3081fd60b4eb080eaacd52fd12810386c108b0f2120bf85364834d5c85350632cf41f686ef642bb7445dd36db72709e4cda7ab282275deaecf5a6934b57bd3c638536b483b3f182df7176a808a43694f2b7ced152bc7b327d31b7391649d762505cb14b22f03ed9259ff9b340c8413e2b998c03ba18f80244a13501d2bd1e64a538d63869581f70ac7888251d4e185303b32f8954adf4622ce26198f1c805d85f5c2b3984b521b2296908b812c6803cf91740ef8af01041085ad785c537b707ae8e57036a321e2c5ef14ea458739c72e4a4a7db49cfc16c6890751366edeb76c570f500774bd34ddc1557584f9b0cabadfbc3890da3fca4bba1dc560a22be75ffb18c82a32a3dc6c7b2a8c649e3512cc76e2a808c80e45d1b21bbe597dac92b1daf3fcd5af9b3d5f8a03c4b539d0a2f4f1a41bbe379fe7faf558bcff541f070801cd0355e3237743f88c94d135bb3f5a6a4d57b15e9f194a2393bf75ad6533fde799d053f51ccf90f10ff6a5ec6aa39ae8b78898857a1228b41586d32cbe4f0b776d046b8c36502b0789650a3438c44ef340244f55294ffd61c2f93205d8aef21657e618d33c048b36999581590e4dd710176f012b13e8dad9f61c33bc708b72d45853fa2d823b09e314f5fdba2041db2285aed20c33415d9d40eeb35397a4a5cefc53082f53c23c3936a7e51d64321ffdc99802a742d14d351a224b93ab2628a53f1aa4b30c80aa00481672af9ab8d1e37f5d8220ee3aa79ee294a65d7ad125a800445f733b4c102a840ee181d76921e090c9f0e3faccf2d59813cdbd7a10026df79a97257440198e571f265e19d1dbe18667b5d5ae0b9994f6dd2c7a8d3e08ce34d7e7f81b2dcfc166080b99ff6e93b8041e616206a702da252d70523c622242d3c4a2c684839902102b4fb392e1b838cd24c59d38e9879a5aa191b3c5e3e6e3806c0e2f80c8e96cf9a4ecadd958dc8c2a6292a00a81c26cb1c5ee5d2da1b545da673ee8010507e4b3839bdf18b38656872a508e8a1e8eb29105e95acda79f02d80e547a07a755cadc6384a2b722bae3e739da8977d7e249f84587791b8b854a1b641ae5bad6ca38b6ad24300009013c1377fa2f37de0a2c34add4df59ea8599b3c86bb9c0b2876e86ab12ed73f6bd39941db8c2dfd8795a5224e00aa4e9cc26eeffc01876bcbf08f4f8fe7900dbc14a9ef1bb7edef3e89965136d0125ddfb05134ab838b6c7b228fcc002b82d9ac861b91d4d738a77f08a08953844c63ce4d76c8da5434f04c15d3b0d0f46ab86a5d958c9d40beb059b09db1d2c8b9317ad6007ffd6c7f30e339069a4e00666987cbd016faa99b252ceab50c34e0d4268daa2d0fe583824e92b439592e6ce0eb7a3e144af242f161cdae4bb571457df8b7cbd4b042777�x������������������X��(
8�"eX�$u����������������eXdX4!"*+,3<GNX	
	RRRRR
RRRRRRR
RRRRRRR
RRRRRRR
RRRRRR
RRRRRRRRR
RRRRRRRRR
RRRRRRRR	R
RRRRRRRRRRR
RR
RRRRR
RRRRRRRRR	R
RRRRRRRRR
Rutf-82edde1e605094bb00da865dee9ac9f9009e4f5b433cb5d80993bf50d79354d0f?�����ĉ3!�^���P,��*����%�f��Y
	*����%�ж�-Ę�CG���J�U�d=���6�=f��=<��d��yK�A}t��&A �H�m:���]+��\3�wz�$L���K
b�e��o�{q��o��T�bN�Aʆv�kg.�>'	�)��v*�����VŅ�����g>�ʍ�D���<�6,����%b�Iu��ַG��/���t�ڑ�ܓ~*��[��'atX���)�4m�
/q��?�G�,+v�~����Nw�v�N�y5���K��H�q}؀�����vA�GK���b#���x/u�,��E%/S^��R���V��s�ʹ�dq��Iq�$�ԜbAO�9��*ϢD!'i�	�z+e�zoɨ�k	��Gd�l���g��
/�1�Q�[��p�3WR�����9�]n��{0�J�C)�2+�SO{��n#r򮧉o�_�{#u7{`AT�������p4ހb��}�?<���;we�t	�K�H�\�I-�TP&ʞ�HU��2�d�=�?%�6��
�?K2�?�
�JB\6r��K��-��3!�^���P,��*����%�f��Y
	*����%�g,��䪒���z �#n<����3*�fk>-Wi��K�_:p15"H�.j��#�"̖��L��CoIտ��O#y�.F���I�w
G�j_�y�S�˅��=Y0�����bggg�2Vo҅(��=D�:y��0�gn ,m��\Eዝ�K�:�`�F��i�[�5�x>����m�}���H��-�z=�Y��'ߤ��H ��
���m��(��;ak���b<
Nŧ�?�9�lev�N�#]#iٗ>���k������S���P�#D�+�W�n���<[6���i �a���+��H��H��,���![�=~�a�(Q.���ڲF��.1*��X�p9c `a�����95�+�M>�ن��˾2h�D}TLnvp�;h��t��]ӲU�����?ˌ���A.��М5l�^�ַ�'��(
�aG�3qW\��8!Sϝ�WUL����k{D�B��k��h[�vͱ�y���	?�WS�҇dO��rt
�mEK-��x�_��8eef92081e4d4be704c598dbd535580c80d6d75d42e7074b708ad9d68b2cda4ca10c502df99ae41c876eee18f487352a760179d8f��
͠f��n-coded variant of get_device (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Declare closing variable as boolean (Jonathan Toppins) [1685307]
- [infiniband] IB/core: Add an unbound WQ type to the new CQ API (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Add generic function to fill in flow action object (Jonathan Toppins) [1685307]
- [infiniband] RDMA/uverbs: Add UVERBS_ATTR_CONST_IN to the specs language (Jonathan Toppins) [1685307]
- [netdrv] ibmvnic: Fix completion structure initialization (Steve Best) [1697103]
- [rpmspec] redhat: limit headers_install_all to arches we care about (Denys Vlasenko) [1692404]
- [lib] ida: Add new API (Jonathan Toppins) [1697588]
- [edac] EDAC: Drop per-memory controller buses (Frank Ramsay) [1686477]
- [edac] EDAC: Don't add devices under /sys/bus/edac (Frank Ramsay) [1686477]
- [x86] x86/platform/UV: Use efi_runtime_lock to serialise BIOS calls (Frank Ramsay) [1677695]- [pci] �x�������������������X�<�(
�������� ���������$m����������������������� mode
    resolves: rhbz#1259039
  - realtime: added check for isolcpus sanity
    resolves: rhbz#1264128
  - pm_qos: fixed exception if PM_QoS is not available
    resolves: rhbz#1296137
  - plugin_sysctl: reapply system sysctl after Tuned sysctl are applied
    resolves: rhbz#1302953
  - atomic: increase number of inotify watches
    resolves: rhbz#1322001
  - realtime-virtual-host/guest: added rcu_nocbs kernel boot parameter
    resolves: rhbz#1334479
  - realtime: fixed kernel.sched_rt_runtime_us to be -1
    resolves: rhbz#1346715
  - tuned-adm: fixed detection of no_daemon mode
    resolves: rhbz#1351536
  - plugin_base: correctly strip assignment modifiers even if not used
    resolves: rhbz#1353142
  - plugin_disk: try to workaround embedded '/' in device names
    related: rhbz#1353142
  - sap-hana: explicitly setting kernel.numa_balancing = 0 for better performance
    resolves: rhbz#1355768
  - switched to polkit authorization
    resolves: rhbz#1095142
  - plugins: added scsi_host plugin
    resolves: rhbz#1246992
  - spec: fixed conditional support for grub2 to work with selinux
    resolves: rhbz#1351937
  - gui: added tuned icon and desktop file
    resolves: rhbz#1356369- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- new-release
  - plugin_cpu: do not show error if cpupower or x86_energy_perf_policy are missing
  - plugin_sysctl: fixed quoting of sysctl values
    resolves: rhbz#1254538
  - tuned-adm: added log file location hint to verify command output
  - libexec: fixed listdir and isdir in defirqaffinity.py
    resolves: rhbz#1252160
  - plugin_cpu: save and restore only intel pstate attributes that were changed
    resolves: rhbz#1252156
  - functions: fixed sysfs save to work with options
    resolves: rhbz#1251507
  - plugins: added scsi_host plugin
  - tuned-adm: fixed restart attempt if tuned is not running
  - spec: fixed post scriptlet to work without grub
    resolves: rhbz#1265654
  - tuned-profiles-nfv: fix find-lapictscdeadline-optimal.sh for CPUS where ns > 6500
    resolves: rhbz#1267284
  - functions: fixed restore_logs_syncing to preserve SELinux context on rsyslog.conf
    resolves: rhbz#1268901
  - realtime: set unboud workqueues cpumask
    resolves: rhbz#1259043
  - spec: correctly remove tuned footprint from /etc/default/grub
    resolves: rhbz#1268845
  - gui: fixed creation of new profile
    resolves: rhbz#1274609
  - profiles: removed nohz_full from the realtime profile
    resolves: rhbz#1274486
  - profiles: Added nohz_full and nohz=on to realtime guest/host profiles
    resolves: rhbz#1274445
  - profiles: fixed lapic_timer_adv_ns cache
    resolves: rhbz#1259452
  - plugin_sysctl: pass verification even if the option doesn't exist
    related: rhbz#1252153
  - added support for 'summary' and 'description' of profiles,
    extended D-Bus API for Cockpit
    related: rhbz#1228356- packaging fixes for rpm-4.12.90
- dropped qemu-kvm-tools-rhev requirement (not in Fedora)- new-release
  related: rhbz#1155052
  - plugin_scheduler: work with nohz_full
    resolves: rhbz#1247184
  - fixed realtime-virtual-guest/host profiles packaged twice
    resolves: rhbz#1249028
  - fixed requirements of realtime and nfv profiles
  - fixed tuned-gui not starting
  - various other minor fixes- new-release
  resolves: rhbz#1155052
  - add support for ethtool -C to tuned network plugin
    resolves: rhbz#1152539
  - add support for ethtool -K to tuned network plugin
    resolves: rhbz#1152541
  - add support for calculation of values for the kernel command line
    resolves: rhbz#1191595
  - no error output if there is no hdparm installed
    resolves: rhbz#1191775
  - do not run hdparm on hotplug events if there is no hdparm tuning
    resolves: rhbz#1193682
  - add oracle tuned profile
    resolves: rhbz#1196298
  - fix bash completions for tuned-adm
    resolves: rhbz#1207668
  - add glob support to tuned sysfs plugin
    resolves: rhbz#1212831
  - add tuned-ad�x������������������X���(
��������H����a�$q����������������a`b�e release
- fix #1829245 - mount -a tries to mount already mounted cifs shares when we cannot query up to root dir- improve CI tests portability to rhel-8 kernel- add git to BuildRequires due to autosetup -Sgit- fix spec file typo- fix test for #1739443- fix #1739443 - lscpu reports wrong hypervisor in nested virt on s390x
- fix #1743555 - command chfn adds some useless commas with GECOS information into /etc/password- fix error path in mountinfo patch (#1751447)- cleanup mountinfo libmount patch (#1751447)- fix #1751447 - improve /proc/self/mountinfo reliability- fix #1739179 - partx failed on nvme devices with exit code 1- fix #1734553 - blkid_get_dev() leak file descriptor to underlying block device
- fix #1719069 - findmnt warning "recommended root FS passno is 1" for XFS- fix #1732769 - lscpu not showing Physical socket, chips information- fix #1681062 - improve loopdev use in gating tests- fix #1699310 - rpm -V setup fail on /var/log/lastlog
- fix #1702712 - pam_env bypassed for root user when using su- fix #1681062 - implement gating tests- fix #1658206 - improve dependence between subpackages- fix #1656437 - Failing tests from testsuite
- fix #1653781 - unable to umount by loop backing file
- fix #1655650 - RHEL8.0 - fdisk -l shows the conflicting partitions name for the mpath
- fix #1653413 - blkid: add --no-part-details to not return metadata from empty partitions- fix #1624877 - libuuid: name-based UUIDs are not compatible with RFC4122- fix #1614967 - Lslogins doesn't fail with nonexisting username
- cleanup patches list- fix #1614364 - losetup: /dev/loop1: failed to set up loop device
- fix #1614852 - mount man page says sync option has no effect for ext4
- fix #1614843 - Man page of logger is missing -S option- refresh lastlog patch 
- fix #1595882 - wipefs should erase also secondary LUKSv2 header* rebuild to verify build flags- upgrade to v2.32.1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32.1-ReleaseNotes- Build only the python3 bindings- sync spec file with Fedora
- move /etc/adjtime config from initscripts to util-linux
- fix #1560642 - uuidd.service does not start
- remove unused build option --enable-libmount-force-mountinfo (it's default now)
- disable assert code- fix #1560283 - column does not properly handle spaces at beginning of tab-separated table columns- upgrade to v2.32- add BuildRequires gcc- upgrade to v2.32-rc1
  http://www.kernel.org/pub/linux/utils/util-linux/v2.32/v2.32-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for switch to libxcrypt- Fix directory ownership in python subpackage- fix dmesg for multi-line records- upgrade to final v2.31
- move rfkill to sbin (for backward compatibility)- fix build error- upgrade to v2.31-rc2
- enable rfkill- temporary disable rfkill (fix #1494855)- upgrade to v2.31-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.31/v2.31-ReleaseNotes- upgrade to v2.30.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.2-ReleaseNotes- make ln-s usage more robust- fix post install script- fix #1390191 - systemd read-only container produces errors- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- upgrade to v2.30.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30.1-ReleaseNotes- upgrade to v2.30- upgrade to v2.30-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.30/v2.30-ReleaseNotes- upgrade to v2.29.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.2-ReleaseNotes- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- upgrade to v2.29.1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29.1-ReleaseNotes- Rebuild for Python 3.6- upgrade to v2.29- upgrade to v2.29-rc2- upgrade to v2.29-rc1
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.29/v2.29-ReleaseNotes- upgrade to stable 2.28.2
  http://ftp.kernel.org/pub/linux/utils/util-linux/v2.28/v2.28.2-ReleaseNotes- upgrade to stable 2.28.1
  http://ftp.kernel.org/pub/linux/utils/�x�������������������X���(
���������z������2Y�$"����������������2Y3Y1Y�2o_SCT_LIST.3ssl.gzi2t_ASN1_OBJECT.3ssl.gzlh_TYPE_delete.3ssl.gzlh_TYPE_doall.3ssl.gzlh_TYPE_doall_arg.3ssl.gzlh_TYPE_error.3ssl.gzlh_TYPE_free.3ssl.gzlh_TYPE_insert.3ssl.gzlh_TYPE_new.3ssl.gzlh_TYPE_retrieve.3ssl.gzo2i_SCT.3ssl.gzo2i_SCT_LIST.3ssl.gzpem_password_cb.3ssl.gzsk_TYPE_deep_copy.3ssl.gzsk_TYPE_delete.3ssl.gzsk_TYPE_delete_ptr.3ssl.gzsk_TYPE_dup.3ssl.gzsk_TYPE_find.3ssl.gzsk_TYPE_find_ex.3ssl.gzsk_TYPE_free.3ssl.gzsk_TYPE_insert.3ssl.gzsk_TYPE_is_sorted.3ssl.gzsk_TYPE_new.3ssl.gzsk_TYPE_new_null.3ssl.gzsk_TYPE_new_reserve.3ssl.gzsk_TYPE_num.3ssl.gzsk_TYPE_pop.3ssl.gzsk_TYPE_pop_free.3ssl.gzsk_TYPE_push.3ssl.gzsk_TYPE_reserve.3ssl.gzsk_TYPE_set.3ssl.gzsk_TYPE_set_cmp_func.3ssl.gzsk_TYPE_shift.3ssl.gzsk_TYPE_sort.3ssl.gzsk_TYPE_unshift.3ssl.gzsk_TYPE_value.3ssl.gzsk_TYPE_zero.3ssl.gzssl_ct_validation_cb.3ssl.gz/usr/include//usr/include/openssl//usr/lib64//usr/lib64/pkgconfig//usr/share/doc//usr/share/doc/openssl-devel//usr/share/man/man3/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������������X���(
�������������5��$%����������������5�6�4��t131211.t test random failures
- Fix t/op/hash.t test random failures
- Parse caret variables with subscripts as normal variables inside ${...}
  escaping (RT#131664)
- Do not display too many bytes when reporting malformed UTF-8 character
- Fix select called with a repeated magical variable (RT#131645)
- Fix error message for "our sub foo::bar" (RT#131679)
- Fix executing arybase::_tie_it() in Safe compartement (RT#131588)
- Fix handling attribute specification on our variables (RT#131597)
- Fix splitting non-ASCII strings if unicode_strings feature is enabled (RT#130907)
- Fix compiler warnings in code generated by ExtUtils::Constant
  (CPAN RT#63832, CPAN RT#101487)
- Fix GCC version detection for -D_FORTIFY_SOURCE override (RT#131809)- Enable separate debuginfo back- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- perl package installs all core modules, interpreter moved to
  perl-interpreter package, perl-core package is obsolete
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>
  (bug #1464903)- Make File::Glob more resistant against degenerative matching (RT#131211)
- Fix a crash when calling a subroutine from a stash (RT#131085)
- Fix an improper cast of a negative integer to an unsigned 8-bit type (RT#131190)
- Fix cloning :via handles on thread creation (RT#131221)
- Fix glob UTF-8 flag on a glob reassignment (RT#131263)
- Fix a buffer overflow in my_atof2() (RT#131526)
- Fix handling backslashes in PATH environment variable when executing
  "perl -S" (RT#129183)
- Fix a conditional jump on uninitilized memory in re_intuit_start() (RT#131575)
- Fix spurious "Assuming NOT a POSIX class" warning (RT#131522)
- Provide perl-interpreter RPM dependency symbol
  <https://fedoraproject.org/wiki/Changes/perl_Package_to_Install_Core_Modules>- Stop providing old perl(MODULE_COMPAT_5.24.*)- 5.26.0 bump (see <http://search.cpan.org/dist/perl-5.26.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages
- Update or remove patches
- Enable hardening (bug #1238804)
- Use 64 bit ints on 32 bit platforms (bug #1268828)- Introduce build-conditions for groff, systemtap, syslog tests, and tcsh- Fix a null-pointer dereference on malformed code (RT#130815)
- Fix an use-after-free in substr() that modifies a magic variable (RT#129340)
- Fix a memory leak leak in Perl_reg_named_buff_fetch() (RT#130822)
- Fix an invalid memory read when parsing a loop variable (RT#130814)
- Fix a heap-use-after-free in four-arguments substr call (RT#130624)- Adapt Compress::Raw::Zlib to zlib-1.2.11 (bug #1420326)
- Fix a heap buffer overflow when evaluating regexps with embedded code blocks
  from more than one source (RT#129881)
- Fix a memory leak in list assignment from or to magic values (RT#130766)- Adapt tests to zlib-1.2.11 (bug #1420326)
- Fix a crash when compiling a regexp with impossible quantifiers (RT#130561)
- Fix a buffer overrun with format and "use bytes" (RT#130703)
- Fix a buffer overflow when studying some regexps repeatedly
  (RT#129281, RT#129061)- Fix UTF-8 string handling in & operator (RT#129287)
- Fix recreation of *:: (RT#129869)
- Fix a memory leak in B::RHE->HASH method (RT#130504)
- Fix parsing goto statements in multicalled subroutine (RT#113938)
- Fix a heap overlow in parsing $# (RT#129274)- Fix a buffer overflow in split in scalar context (RT#130262)
- Fix a heap overflow with pack "W" (RT129149)
- Fix a use-after-free when processing scalar variables in forms (RT#129125)
- Fix a heap overflow if invalid octal or hexadecimal number is used in
  transliteration expression (RT#129342)
- Fix out-of-bound read in case of unmatched regexp backreference (RT#129377)- 5.24.1 bump (see <http://search.cpan.org/dist/perl-5.24.1/pod/perldelta.pod>
  for release notes)- Rebuild for readline 7.x- Remove bundled Math-BigInt-FastCalc (bug #1408463)
- Remove bundled Math-BigRat (bug #1408467)
- Remove bundled bignum (bug #1409585)- Fix a crash in optimized evaluation of "or ((0) x 0))" (RT#130247)
- Fix a memory leak in IO::Poll (RT#129788)�x�������������p�����X���(
�����������������$R��������������������-0.19.8.1.so()(64bit)libgettextsrc-0.19.8.1.so()(64bit)libglib-2.0.so.0()(64bit)libgomp.so.1()(64bit)libgomp.so.1(GOMP_1.0)(64bit)libgomp.so.1(GOMP_4.0)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libncurses.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libtinfo.so.6()(64bit)libunistring.so.2()(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)0.19.8.1-17.el83.0.4-14.6.0-14.0-15.2-1filesystem34.14.2]�@]�@\�-@Zz�@Zu�@ZOh�Y���Yx�@X�,�X��@X��XZn�XW�XS�@X=m�W�@W[�@WYZ@V��V��V���Vii@V�U���U���U�>�U�a@UD�@T�s@T��@T��@T�M�TO�@T?�@T>a�T.��T�@S�G�S��@S���S��@S���S�g@S�g@R��@R�Q��Q�L�Q��Q?�Q�@P��Pj�@P��P��Oĺ@O��@O�O�O(@N��@N�@MQ0@MO�MO�L��@Lrb�L!�@K�u�Kы�K�@J��Ji�@JB@J?r@J��I��@I�@H��H��H���Hv@G�s@G�s@G�-@G�}�F�@F�w�F��F�<@F�u�F5�@E�5@E��@E��@E��@E��@E��Ej�@Ee�@EA�E �@D��@D�+@D��D��@C�R@C�@C�C�g@C�q�C:��B�=�B>�@B$Y@A��@A�%@A_�A]F�AE��@��@Ū@@�@@��@��@@Dw@@,�@@;�?j�>��@>�/�>.��>&��=�?�=�=l�@=Jt@=C�=@<��<�@<���<�?@<o�@<<0�<@;�\�;��@;�A�;���;r{@;V�;T(�;x@;&�:�:�S�:��:��@:��@:n�:a��:]�@:L|�9���9��@9m�@9i��9Q��9	}@8��8��@8|l�7�9�7��7�,@7�e�71�@6��@6�6f}@6@5���5�5��5���5Ds@4\k@4[�3���Sundeep Anand <suanand@redhat.com> - 0.19.8.1-17Sundeep Anand <suanand@redhat.com> - 0.19.8.1-16Jens Petersen <petersen@redhat.com> - 0.19.8.1-15Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-14Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 0.19.8.1-13Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-12Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-11Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-10Kalev Lember <klember@redhat.com> - 0.19.8.1-9Fedora Release Engineering <releng@fedoraproject.org> - 0.19.8.1-8Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-7Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-6Miro Hrončok <mhroncok@redhat.com> - 0.19.8.1-5Petr Šabata <contyk@redhat.com> - 0.19.8.1-4Pavel Raiskup <praiskup@redhat.com> - 0.19.8.1-3Daiki Ueno <dueno@redhat.com> - 0.19.8.1-2Daiki Ueno <dueno@redhat.com> - 0.19.8.1-1Daiki Ueno <dueno@redhat.com> - 0.19.8-1Fedora Release Engineering <releng@fedoraproject.org> - 0.19.7-4Daiki Ueno <dueno@redhat.com> - 0.19.7-3Daiki Ueno <dueno@redhat.com> - 0.19.7-2Daiki Ueno <dueno@redhat.com> - 0.19.7-1Daiki Ueno <dueno@redhat.com> - 0.19.6-1Daiki Ueno <dueno@redhat.com> - 0.19.5.1-2Daiki Ueno <dueno@redhat.com> - 0.19.5.1-1Daiki Ueno <dueno@redhat.com> - 0.19.4-7Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19.4-6Kalev Lember <kalevlember@gmail.com> - 0.19.4-5Till Maas <opensource@till.name> - 0.19.4-4Daiki Ueno <dueno@redhat.com> - 0.19.4-3Daiki Ueno <dueno@redhat.com> - 0.19.4-2Daiki Ueno <dueno@redhat.com> - 0.19.4-1Peter Robinson <pbrobinson@fedoraproject.org> 0.19.3-2Daiki Ueno <dueno@redhat.com> - 0.19.3-1Daiki Ueno <dueno@redhat.com> - 0.19.2-5Daiki Ueno <dueno@redhat.com> - 0.19.2-4Dennis Gilmore <dennis@ausil.us> - 0.19.2-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19.2-2Daiki Ueno <dueno@redhat.com> - 0.19.2-1Daiki Ueno <dueno@redhat.com> - 0.19.1-2Daiki Ueno <dueno@redhat.com> - 0.19.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.19-3Daiki Ueno <dueno@redhat.com> - 0.19-2Daiki Ueno <dueno@redhat.com> - 0.19-1Daiki Ueno <dueno@redhat.com> - 0.18.3.2-1Daiki Ueno <dueno@redhat.com> - 0.18.3.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.3-2Daiki Ueno <dueno@redhat.com> - 0.18.3-1Daiki Ueno <dueno@redhat.com> - 0.18.2.1-2Daiki Ueno <dueno@redhat.com> - 0.18.2.1-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.18.2-2Daiki Ueno <dueno@redhat.com> - 0.18.2-1Jens Petersen <petersen@redhat.com> - 0.18.1.1-17Jens Petersen <petersen@redhat.com> - 0.18.1.1-1�x������������������X��(
�a�����������7��$'����������������7�8�6��alumni.drew.edu> - 4:5.10.0-82Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-81Stepan Kasal <skasal@redhat.com> - 4:5.10.0-80Chris Weyl <cweyl@alumni.drew.edu> - 4:5.10.0-79Stepan Kasal <skasal@redhat.com> - 4:5.10.0-78arcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-77Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-76Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.10.0-75Stepan Kasal <skasal@redhat.com> - 4:5.10.0-74Stepan Kasal <skasal@redhat.com> - 4:5.10.0-73Stepan Kasal <skasal@redhat.com> - 4:5.10.0-72Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-71Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-70Stepan Kasal <skasal@redhat.com> - 4:5.10.0-69Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-68Stepan Kasal <skasal@redhat.com> - 4:5.10.0-67Stepan Kasal <skasal@redhat.com> - 4:5.10.0-66Stepan Kasal <skasal@redhat.com> - 4:5.10.0-65Stepan Kasal <skasal@redhat.com> - 4:5.10.0-64Stepan Kasal <skasal@redhat.com> - 4:5.10.0-63Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-62Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-61Stepan Kasal <skasal@redhat.com> - 4:5.10.0-60Robert Scheck <robert@fedoraproject.org> - 4:5.10.0-59Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-58Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-57Dennis Gilmore <dennis@ausil.us> - 4:5.10.0-56Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-55Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-54Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-53Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-52Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-51Marcela Mašláňová <mmaslano@redhat.com> - 4:5.10.0-50Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-49Lubomir Rintel <lkundrak@v3.sk> - 4:5.10.0-48Marcela Mašláňová <mmaslano@redhat.com> 4:5.10.0-47.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-46Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-45Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-44.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-43.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-42.fc10Stepan Kasal <skasal@redhat.com> - 4:5.10.0-41.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-40.fc10Stepan Kasal <skasal@redhat.com> 4:5.10.0-39.fc10Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-38Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-36Stepan Kasal <skasal@redhat.com> 4:5.10.0-35Stepan Kasal <skasal@redhat.com> 4:5.10.0-34Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-33Stepan Kasal <skasal@redhat.com> 4:5.10.0-32Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-28Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-27Stepan Kasal <skasal@redhat.com> 4:5.10.0-26Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-25Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-24Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-23Marcela Maslanova <mmaslano@redhat.com>Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-21Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-20Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-19Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-18Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-17Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-16Marcela Maslanova <mmaslano@redhat.com> 4:5.10.0-15Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-14Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-13Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-12Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-11Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-10Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-9Tom "spot" Callaway <tcallawa@redhat.com> 4:5.10.0-8Stepan Kasal <skasal@redhat.com> - 4:5.10.0-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 4:5.10.0-6Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-5Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-4Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-3Tom "spot" Callaway <tcallawa@redhat.com> - 4:5.10.0-2Tom "spot" Callaway <tcallawa@redhat.�x�������������`o����X��(
��������������i�$y����������������ihj� separate- remove selinux code from login and use pam_selinux- turn on selinux- Add BuildRequires: texinfo (from a bug# I don't remember)
- Fix #90588 with mountman patch142.- turn off selinux- turn on selinux
- remove context selection- Add patch140 (alldevs) to fix #101772. Printing the total size of
  all devices was deemed a lower priority than having all devices
  (e.g. /dev/ida/c0d9) displayed.- turn off selinux- turn on selinux- Fix #103004, #103954- turn off selinux- build with selinux- Use urandom instead for mkcramfs- add SELINUX 2.5 support- #100433 patch- #97381 patch- rebuilt- Change patch128 to improve ipcs -l- Fix #85407- Change patch128 to util-linux-2.11f-ipcs-84243-86285.patch to get all
ipcs fixes- fix last login date display on AMD64 (#88574)- include sfdisk on ppc- add patch from msw to change mkcramfs blocksize with a command line option- Fix segfault on s390x due to wrong usage of BLKGETSIZE.- Really apply the ipcs patch. Doh.- rebuilt- ipcs-84243.patch to fix #84243- Update moremisc patch to fix swprintf()'s minimum field (bug #83361).- Fix mcookie segfault on many 64-bit architectures (bug #83345).- Fix underlined multibyte characters (bug #83376).- rebuild to have again a s390 rpm
- disable some more apps for mainframe- util-linux-2.11y-umask-82552.patch- rebuilt- Fix #81069, #75421- Update to 2.11y
- Fix #80953
- Update patch0, patch107, patch117, patch120 for 2.11y
- Remove patch60, patch61, patch207, patch211, patch212, patch119, patch121
- Remove patch122, patch200- Remove some crack/unnecessary patches while submitting stuff upstream.
- Build with -D_FILE_OFFSET_BITS=64- Update to 2.11w, resolve patch conflicts- Extended util-linux-2.11b-s390x patch to work again.- Add patch122 for hwclock on x86_64- Fixed pam config files- Port to hammer- Patch120 (hwclock) to fix #72140
- Include isosize util- Patch120 (skipraid2) to fix #70353, because the original patch was 
totally useless.- Patch119 (fdisk-add-primary) from #67898- Really add the gptsize patch, instead of what I think the patch says.
(+1)- Add the sp[n].size part of the patch from #69603- adjust mainframe patches- only require usermode if we're shipping kbdrate here- Port the large swap patch to new util-linux... the off_t changes 
  now in main aren't sufficient- Remove swapondetect (patch301) until it avoids possible false positives.- Update to 2.11r, wheeee
- Remove unused patches- Make a note here that this package was the source of the single change 
contained in util-linux-2.11f-18 (in 7.2/Alpha), and also contains the 
rawman patch from util-linux-2.11f-17.1 (in 2.1AS).
- Package has no runtime deps on slang, so remove the BuildRequires: 
slang-devel.- automated rebuild- Fix teg's swapondetect patch to not print out the usage message when 
'swapon -a -e' is run. (#66690) (edit existing patch)
- Apply hjl's utmp handling patch (#66950) (patch116)
- Fix fdisk man page notes on IDE disk partition limit (#64013) (patch117)
- Fix mount.8 man page notes on vfat shortname option (#65628) (patch117)
- Fix possible cal overflow with widechars (#67090) (patch117)- support large swap partitions
- add '-d' option to autodetect available swap partitions- automated rebuild- Remove kbdrate (again).- adjust mainframe patches to apply to current rpm
- do not include fdisk until it is fixed to work on mainframe- Don't strip binaries - rpm does it for us.- Apply patch115 from ejb@ql.org for bug #61868- Finish fixing #60675 (ipcrm man page), updated the patch.
- Fix #61203 (patch114 - dumboctal.patch).- Update ctty3 patch to ignore SIGHUP while dropping controlling terminal- Update ctty3 patch to drop controlling terminal before forking.Fix various bugs:
- Add patch110 (skipraid) to properly skip devices that are part of a RAID array.
- Add patch111 (mkfsman) to update the mkfs man page's "SEE ALSO" section.
- remove README.cfdisk
- Include partx
- Fix 54741 and related bugs for good(hah!) with patch113 (ctty3)- Put kbdrate in, add usermode dep.- Fix #60363 �x������P������x^����X'�(
���������������w��$g����������������w�v�x�� Luscon <mluscon@redhat.com> 1.0.2-3Jan Silhan <jsilhan@redhat.com> 1.0.2-2Michal Luscon <mluscon@redhat.com> 1.0.2-1Michal Luscon <mluscon@redhat.com> 1.0.1-2Michal Luscon <mluscon@redhat.com> 1.0.1-1Michal Luscon <mluscon@redhat.com> 1.0.0-1Michal Luscon <mluscon@redhat.com> 0.6.5-1Jan Silhan <jsilhan@redhat.com> - 0.6.4-1Jan Silhan <jsilhan@redhat.com> - 0.6.3-2Jan Silhan <jsilhan@redhat.com> - 0.6.3-1Jan Silhan <jsilhan@redhat.com> - 0.6.2-1Jan Silhan <jsilhan@redhat.com> - 0.6.1-1Aleš Kozumplík <ales@redhat.com> - 0.6.0-1Aleš Kozumplík <ales@redhat.com> - 0.5.5-1Aleš Kozumplík <ales@redhat.com> - 0.5.4-1Aleš Kozumplík <ales@redhat.com> - 0.5.3-1Aleš Kozumplík <ales@redhat.com> - 0.5.2-1Aleš Kozumplík <ales@redhat.com> - 0.5.1-1Aleš Kozumplík <ales@redhat.com> - 0.5.0-1Aleš Kozumplík <ales@redhat.com> - 0.4.19-1Aleš Kozumplík <ales@redhat.com> - 0.4.18-1Aleš Kozumplík <ales@redhat.com> - 0.4.17-1Aleš Kozumplík <ales@redhat.com> - 0.4.16-1- Added patch for almalinux bugtracker- automatic: catch OSError, not SMTPException on smtp errors (RHEL-71545)
- automatic: Check availability of config file (RHEL-71545)- Remove /usr/bin from sys.path to avoid accidentally importing garbage (RHEL-1245)
- Fix japanese translations (RHEL-6393)
- Fix substitution in kay-value-pair list in add_new_repo (RHEL-11786)- Document symbols in `dnf history list` output (RhBug:2172067)- Return an error when transaction fails (RhBug:2170093)- Omit src RPMs from check-update (RhBug:2151910,2203069)
- automatic: Fix online detection with proxy (RhBug:2022440,2189851)- Update translations- Ignore processing variable files with unsupported encoding (RhBug:2141215)
- Better explain traceback of rpm.error with dnf- Document changes to offline-upgrade command (RhBug:1939975,2139324)- Add support for rollback of group upgrade rollback (RhBug:2016070)
- Move system-upgrade plugin to core (RhBug:2054235)
- Fix plugins unit tests + unload plugins upon their deletion (RhBug:2134309)- Allow passing plugin parameters with dashes in names (RhBug:1980712)
- Fix upgrade from file to noarch pkg (RhBug:2006018)
- Add support for group upgrade rollback (RhBug:2016070)
- Expose plugin unload method to API (RhBug:2047251)
- Add doc related to --destdir and --downloadonly options (RhBug:2100811)
- Set default value for variable to prevent crash (RhBug:2091636)
- Don't include resolved advisories for obsoletes with sec. filters (RhBug:2101421)- [doc] Describe how gpg keys are stored for `repo_ggpcheck`
- Add only relevant pkgs to upgrade transaction (RhBug:2097757)- Backport fix for leaks of libsolv's page file descriptors in Base object
  resolves: rhbz#2087734
- Include instructions for regenerating patches.- Add documentation for query api flags
- Fix processing of download errors
- Fix history undo on a Reason Change
- Fix remove when no repos are enabled
- Improve "proxy" configuration option documentation- Rebuild with new release number- Allow destdir option with modulesync command- Bump release number because of conflicting version of 8.5 build- Add fail_fast parameter to _download_remote_payloads() method
- Throw CompsError when a group or environment is not found for the install methods
- Respect cacheonly in python dnf API (RhBug:1862970)
- [doc] Improve description of multilib_policy=all (RhBug:1996681,1995630)
- [doc] Document default colors- Improve signature checking using rpmkeys (RhBug:1967454)- Fix covscan issue: dnf/rpm/miscutils.py: fix usage of _()- Update to 4.7.0
- New optional parameter for filter_modules enables following modular obsoletes based on a config option module_obsoletes
- Fix module remove --all when no match spec (RhBug:1904490)
- Make an error message more informative (RhBug:1814831)
- Expand history to full term size when output is redirected (RhBug:1852577) (RhBug:1852577,1906970)
- Print additional information when verifying GPG key using DNS
- Enhanced detection of plugins removed in transaction (RhBug:1929163)
- Improve repo config path �x�������������PN����X�j�(
x�������|d�$l����������������|d}d{d��x������<���h=����X8�(
P��c���v�$f����������������vuw�ly linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e0854b60cad226cc3ed52f43d4f8203d9042d7af, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=97d0b5268255ba27200ddf72bccb258832c3079f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f0f4940279f64c38e521f600de54375574981886, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=df99eb05d945c091ebfc154d1ed7996830bd7b7f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8ac46885133b90b5ac96db282dbd8e23ab1f51ea, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=86850f8fe55fe6305ce17a125cb40fbcaf615715, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=009219e358382627110aa2873705f9e5a571b03b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3d099729d0d03eabf8e79d4d6afdd25194be2cf4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fc2c0fb1e115d76b511ae38f66c0caaad53e2f58, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c484531b844a0b317106361c53c3bd908dc14714, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=360912916f7247ca72648ef4304ab0c46f4b0d50, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=c4ea00b9942cb3728d1c8082cd643518eab69821, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a1288eb1fb957104ca8e6d376e9112386f2c48dc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b97c8c466d1ddc6b71e29d259d33c46ad2a24560, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=93f4b11ddf3fae0a72e8593c06493368fd264cd9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=df0453255752205f9890f0982d45006e56f14db9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b707be9885f8ced7c5780a4945a1785861d70ef, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ce36c791489c85a18ac5e216f149d3d0fe02e7ee, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=00cd2682bb03f2fd95d69809b4885cca619ab7d3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=f5cc522634a0585e3a3d2b328e7b66a21f0bb4e3, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked,�x��������������,����X��(
���w�����$g����������������wvx� interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=ad8354d972938319b884fb36888e569bdff03022, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b36a99048e84c2a955bee735169f59b039a1ea25, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7f0cde2e3b1b80255577f22b50a1497df5649d61, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=71b3bc571fe6d7405202c249e49eff69131719c8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7448517ff53d40df18051ba50ad313e51881cf77, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=56708bfcdd0b212c0d8dfbe17ba4d3ca76407d96, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=5eb883c9111918963553b0b1ffd855d7ee9782d9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=b231d4062f3875f63ddca0b7b43a8216da8da464, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=a3f861a1075c1fe1796b0646f5dcb34c69334c3a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=3445fc8dbdb11ac88ebc3f1a74eadc0d0b255628, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=fdc24e50487346c643a9b516c4e14791e54eab94, strippedAlgol 68 source, ASCII textUTF-8 Unicode textBourne-Again shell script, ASCII text executableTenex C shell script, ASCII text executabletroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, ASCII text (gzip compressed data, max compression, from Unix)	"'/=I[do�������������-9LZfx���������������	!*0ELRZgpz������������"8BLQepx������������� *;RWk�x�����ȔX����XU��(
Pa��������������$]�������������������0f?������`{
	Q�d~�����i��)z�������;�����Ҝ�V�"��c_�Y]Bp�g��D����tpk��ǐm\���7w�4�5����3�^�[c�*¸��W���/�5����n-��+�ʣh1y�'*5/d�[G>;V��{2�բ��\�&"��/D�����Z�FR��x0�e����H���O緤"�V�X�Z ��L_����%*����l(㲎��"�*l��G�P��sJj��Wn��
F-�_[HGQ9f�헥MZ;�3��]������Y�SWL�tu6�™n! ]�1!�lp��{C���	��{�e�嵜c�j���h���^�ʏ�HM�*.�Se0��:<_W�[46�`Y�����QE7�#�xx�
:�s	�LE����q-+���T��`{
	Q�d~���
���LHd(�Y<`�Tw<�"nt��W%�(El���E[���ϡ�ߌ���rCr�2D|N���/ ��c�WՈ>c�D��/6��m����Y[ɔN9���;3�2X�&%N-G���R����$E�U�Ez���b@�ugԥxF����>�JeL㣻�>��\�ɺp���K�9ԌɊ$i5$mm���D���Fp�:�i��;B�$^���q�w}!I����A��z���
�X��G��v��}��'�
P3�e��A}$�M��!���A>!�iSB�3��E(�TU`��i2����U(�:	�
�VL&t+4�Oxc��U�Ҧ׵���Q�+�ޓ�"�%Ap^B͠s4zV�1fb4a736cbeb59012264b2884f58a899584ef7a8cde82605a5e26d4e81731757a0bad7a5902e3f67f24b8959aedbceb51706b663fX�-O�DfX�1831fdfe06e465cc4ea73201Frs&8b1e4ddd5cc02e30eddf17538c8e318a618ef7t.om0&90ebb39221789e412dc6577f42fc82ba9b0bde.4.Hn&894d521ea6dc5478ade1d889927351d2ddb135il 2n&8fdbc9439215c52a3bedd3d90d7f7e67df8176 <p"h&95f4f1581b8e843f13eddd4d277d0250a3fa09@re� &8a00530d277bcf7f7f20943982e5db0d6cf329m> �P95nir�c94hat�1.91Phi�p90ch@�^ 8f.13�Br8epkn�"t8d - �d&8c87b0e6d05a4a790f11724c80cb2079621e12oje�.8c2P� &8d2193ffaaa9cf72d71e6e8d8d40aea6ea37a7ch �e&8a14b63ef0bc7ca6c417993b0eb52aad4cc687@re�.&8b88b25e0aca6d52af984ac3dd508b0773af1�5&8a0636fa948d15b33276b1d18fb1ce65e70eab7f6ps&89df6be658a01b5c9788d3b588a508bb34fa9289cn!u|�� 8aZ� &8a00530d277bcf7f7f20943982e5db0d6cf329m> Hn&894d521ea6dc5478ade1d889927351d2ddb135il ^V&8904089270e6483234c8ae5eef2324c111971f Va(Luz�D���i89hat

88W8897.bin

88W8864.bint	z8859-9_to_uni.transgz�88859-9.a0-ff.univ�^8859-9.a0-ff.16.gz]�08859-9.a0-ff.14.gz600�
8859-9.a0-ff.08.gz1028859-8_to_uni.trans�_8859-8.a0-ff.uni.�
8859-8.a0-ff.16.gz
�38859-8.a0-ff.14.gz000�8859-8.a0-ff.08.gz~z8859-7_to_uni.transn���8859-7.a0-ff.uni.�28859-7.a0-ff.16.gz202�o8859-7.a0-ff.14.gz4d5�18859-7.a0-ff.08.gze8859-6_to_uni.trans�8859-6.a0-ff.uni0�b8859-6.a0-ff.16.gzC08�
8859-6.a0-ff.14.gz
�38859-6.a0-ff.08.gzple.8859-5_to_uni.transBA�8859-5.a0-ff.uni-�s8859-5.a0-ff.16.gz
�8859-5.a0-ff.14.gz�78859-5.a0-ff.08.gz`
8859-4_to_uni.transin�g8859-4.a0-ff.uniA�8859-4.a0-ff.16.gz��8859-4.a0-ff.14.gz��8859-4.a0-ff.08.gzuga8859-3_to_uni.trans��s8859-3.a0-ff.uniB�8859-3.a0-ff.16.gz��r8859-3.a0-ff.14.gz�8859-3.a0-ff.08.gz�.8859-2_to_uni.trans60�18859-2.a0-ff.uni�S8859-2.a0-ff.16.gz�B8859-2.a0-ff.14.gz��8859-2.a0-ff.08.gz��8859-1_to_uni.trans=8859-15_to_uni.transb�a8859-15.a0-ff.uni�8859-14_to_uni.trans
�98859-14.a0-ff.uni�38859-13_to_uni.trans{�z8859-13.a0-ff.uni�x������������������XI��(
`��������������$\��������������������n), revision 0.0, 700 messages, Project-Id-Version: GNU gettext-tools 0.19.8-rc1 '                                (len jazyky zalo\305\276en\303\251 na XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (bara XML-baserade spr\303\245k)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (\320\273\320\270\321\210\320\265 \320\274\320\276\320\262\320\270, \320\267\320\260\321\201\320\275\320\276\320\262\320\260\320\275\321\226 \320\275\320\260 XML)'GNU message catalog (little endian), revision 0.0, 700 messages, Project-Id-Version: gettext-tools 0.19.8-rc1 '                                (ch\341\273\211 ng\303\264n ng\341\273\257 d\341\273\261a tr\303\252n XML)'troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)-?N]l|�������#6EFVR	R
RRRRR"R	R
RRRRR"RR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"RRRR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"RR
RRRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRRR	R
RRRRRRRRRRRRRR"RRRRRRRR
RRRRRRRRRRRRR
RR"RRR
RRRRRRRRRRRRRR"R
RRRRRRRRRRRRRR"R	R
RRRRR"RR
RRRRRRRRRRRRR"RRR	R
RRRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRRRR"RR
RRRRRRRRRRRRR"RRR
RRRRRRRRRRRRRR"Rutf-820c1fa4cbd577d1f6ec0a1c418df67159a766299b915a3ec45bef038fb5afa�x�������������������X�E�(
(����������$��������������������QRSTURRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR# conditional support for grub2, grub2 is not available on all architectures
# and tuned is noarch package, thus the following hack is needed
if [ -d /etc/grub.d ]; then
  cp -a /usr/share/tuned/grub2/00_tuned /etc/grub.d/00_tuned
  selinuxenabled &>/dev/null && \
    restorecon /etc/grub.d/00_tuned &>/dev/null || :
fi/bin/shdmidecodekernel-toolsutf-8391d4ea82e99a1785d06bdb4a1089dd8f52ff687f3957eb593c2141e2e48eb4f?���0�h�3!�^���P,��*����%�g�
	*����%����G���T��yIӑl���O�/��h�0���Q8|od��Hh1��:���M/nḠEz��|����f8}=��hR
�zG�=��$P��b>bh{��E	�[a<�E��+n�g�
.�cp�]�)��|�[�`ʲ�l��^�1Z�k$m����-�g;��~ƭ���x ��p>w��'��:)� �fdž.���P��D��0�ՔDݯ�2i����-9����B�k/�gh@*�DX�Ꮘ��x������������� �����X��(
��������x����&��$6����������������&�'�%��e.3pm.gzPOSIX.3pm.gzPerlIO.3pm.gzPerlIO::encoding.3pm.gzPerlIO::mmap.3pm.gzPerlIO::scalar.3pm.gzPerlIO::via.3pm.gzSDBM_File.3pm.gzSafe.3pm.gzSearch::Dict.3pm.gzSelectSaver.3pm.gzSymbol.3pm.gzSys::Hostname.3pm.gzTerm::Complete.3pm.gzTerm::ReadLine.3pm.gzText::Abbrev.3pm.gzThread.3pm.gzThread::Semaphore.3pm.gzTie::Array.3pm.gzTie::File.3pm.gzTie::Handle.3pm.gzTie::Hash.3pm.gzTie::Hash::NamedCapture.3pm.gzTie::Memoize.3pm.gzTie::RefHash.3pm.gzTie::Scalar.3pm.gzTie::StdHandle.3pm.gzTie::SubstrHash.3pm.gzTime::gmtime.3pm.gzTime::localtime.3pm.gzTime::tm.3pm.gzUNIVERSAL.3pm.gzUnicode::UCD.3pm.gzUser::grent.3pm.gzUser::pwent.3pm.gzarybase.3pm.gzattributes.3pm.gzautouse.3pm.gzbase.3pm.gzblib.3pm.gzbytes.3pm.gzcharnames.3pm.gzdeprecate.3pm.gzdiagnostics.3pm.gzencoding::warnings.3pm.gzfeature.3pm.gzfields.3pm.gzfiletest.3pm.gzif.3pm.gzless.3pm.gzlib.3pm.gzlocale.3pm.gzmro.3pm.gzops.3pm.gzoverload.3pm.gzoverloading.3pm.gzsigtrap.3pm.gzsort.3pm.gzsubs.3pm.gzvars.3pm.gzvmsish.3pm.gzwarnings::register.3pm.gzAnyDBM_File.pmAutoLoader.pmAutoSplit.pmBDeparse.pmOp_private.pmBenchmark.pmCORE.podClassStruct.pmConfigExtensions.pmDB.pmDBM_FilterDBM_Filter.pmcompress.pmencode.pmint32.pmnull.pmutf8.pmDirHandle.pmDumpvalue.pmEnglish.pmExtUtilsConstantConstant.pmBase.pmProxySubs.pmUtils.pmXS.pmtypemapFileBasename.pmCompare.pmCopy.pmFind.pmstat.pmFileCache.pmFileHandle.pmFindBin.pmGetoptStd.pmI18NCollate.pmLangTagsLangTags.pmDetect.pmList.pmIPCOpen2.pmOpen3.pmInternals.podNEXT.pmNethostent.pmnetent.pmprotoent.pmservent.pmPerlIO.pmPodFunctions.pmSafe.pmSearchDict.pmSelectSaver.pmSymbol.pmTermComplete.pmReadLine.pmTextAbbrev.pmThreadThread.pmSemaphore.pmTieArray.pmFile.pmHandle.pmHash.pmMemoize.pmRefHash.pmScalar.pmStdHandle.pmSubstrHash.pmTimegmtime.pmlocaltime.pmtm.pmUNIVERSAL.pmUnicodeUCD.pmUsergrent.pmpwent.pm_charnames.pmautouse.pmbase.pmblib.pmbytes.pmbytes_heavy.plcharnames.pmdeprecate.pmdiagnostics.pmdumpvar.plencodingwarnings.pmfeature.pmfields.pmfiletest.pmif.pmless.pmlocale.pmmeta_notation.pmoverloadoverload.pmnumbers.pmoverloading.pmperl5db.plpodperl.podperl5004delta.podperl5005delta.podperl5100delta.podperl5101delta.podperl5120delta.podperl5121delta.podperl5122delta.podperl5123delta.podperl5124delta.podperl5125delta.podperl5140delta.podperl5141delta.podperl5142delta.podperl5143delta.podperl5144delta.podperl5160delta.podperl5161delta.podperl5162delta.podperl5163delta.podperl5180delta.podperl5181delta.podperl5182delta.podperl5184delta.podperl5200delta.podperl5201delta.podperl5202delta.podperl5203delta.podperl5220delta.podperl5221delta.podperl5222delta.podperl5223delta.podperl5224delta.podperl5240delta.podperl5241delta.podperl5242delta.podperl5243delta.podperl5244delta.podperl5260delta.podperl5261delta.podperl5262delta.podperl5263delta.podperl5280delta.podperl561delta.podperl56delta.podperl581delta.podperl582delta.podperl583delta.podperl584delta.podperl585delta.podperl586delta.podperl587delta.podperl588delta.podperl589delta.podperl58delta.podperlaix.podperlamiga.podperlandroid.podperlapi.podperlapio.podperlartistic.podperlbook.podperlboot.podperlbot.podperlbs2000.podperlcall.podperlce.podperlcheat.podperlclib.podperlcn.podperlcommunity.podperlcygwin.podperldata.podperldbmfilter.podperldebguts.podperldebtut.podperldebug.podperldelta.podperldeprecation.podperldiag.podperldos.podperldsc.podperldtrace.podperlebcdic.podperlembed.podperlexperiment.podperlfork.podperlform.podperlfreebsd.podperlfunc.podperlgit.podperlgpl.podperlguts.podperlhack.podperlhacktips.podperlhacktut.podperlhaiku.podperlhist.podperlhpux.podperlhurd.podperlintern.podperlinterp.podperlintro.podperliol.podperlipc.podperlirix.podperljp.podperlko.podperllexwarn.podperllinux.podperllocale.podperllol.podperlmacos.podperlmacosx.podperlmod.podperlmodinstall.podperlm�x�����ؓ������8�����X���(
0�@lq!�$a����������������q!p!r!�6d05021728409993b141eade75d6d02a96226aa9cbb06d14d7ad06ba55987e26b390146c1a59a182ad05e5a0fc70dc2a8c984f2ab3e3bec15256e9c0a4807286954eeff4ced69b2e1580261317115b496598fe61973976d4d8fc0b0a6e33bd5052bf80b70c8f98f19c9af4231542d17b707537cdf3fd5a2d72ea70fc3b0d2d46d5a7350a948020bb317647b4470db34b22f1bc0b995b4c220d0e2a2044c51937dabc84bf5f9db9a7b95b94042d0bdfc6f7208c7e0e1810c95042b3bb63a5fccd7a36403e3511d4d119eba127e2be07162aa158728284b2fae066cfbbf938b5a05e81fb439aea68fcd96b4f80f0a9f9fc2e9c6cbb8be42a1d9badddf33e5ece41b9718b02c2f07ed25ad35eeab077e5a771818f031dc607f619d4efc3e300eb140c8f015ee0a59498a3c278f001b656056d141d638f907cef6aed553ea72654884be3d2e5b39e487ad91f9aa68c452dcf2815575cd042366f735824dcdd65e12a9c353aab9f7aa03c978a0df1720704fa679c9229b32248a9a9525f028bda3975237ca5e51992901c649e6b6309ba86c742cb348c3f812195b8044af1034ba7ecf4b8d211c1193fae8d5b3fb27d4475775b654eb987e7ca2042289ef5716fb6be102156f073e9e5c450e0a229be35aefd3f3979526525280ae0021646fb82d8db36a7850069593414c453cf35df0c3e9d30258e89b2e6a1f22a4d34b160ba079444fdea3fd3818d6d187c3b2b3448bddeae475d76158d94caeae9dc4eeacc0b1140d3259d7296c67cc0e980ecebde086714474cd3610707fdd00214a0f5e7860d07f637a2982ed0b10e2c3b6645a8d12be71c8c2525bb73346461bacacc17e85e9241f0bd878bed6310fbfec96c72564f66ac8e0bbdcbfa8e2eb891e5d125d1c26b110df9e7801a5d657d7a521f6c04cad41e0b127fc6cb52f06ef493c32dbacc8ba5da94026a3fa1d74ca71021daeb6cdcadf4bf468ddbee767049f325428c26a3e2dd4edcbf9e1dc07077762876044361495adfc6b8819596b79cb1f9d550eae437ab39cb7bca1a92d13ae3e657fd18d5773ae99278634c84ce301cc9d1d57076c44c539b2147c28dce700cc14df70965366a5add1e17180b1ce017a0aa449705cf01beef73d686329b3e7d009f909f4345155ececd18b9fde4baf3b927b5d254038cc327a5b5b7836f298e3732f98bc8653b9ff6928b1df37a517386d428412b71418d2c123fca9850b8cb0dd38338aae03d67e1888b507f6dbd78b9d757f3519b724e8e875234f4d4a14fb1265533f10310030667be9dfafd40d2e92950c3b03b90e1199412011188cb0395e83afa506932201fc29ef0e536d2ecfd86faecd8731a7e03d8c0ce7baed29deaffc5608bb3d527dfe075713b97691ab8f42fef7e54b38a0175ca06dfa5e437e74cc40d1f30996a4e20c8136521fb0768a32a4145909d010fd37310aac7d82ea6df74d78333f78c26c0ed52ecc4c43ebee318bf2b7a55a8ea5d90de144a9e5a1019dd7987d6cfbfc9ac2a913d6d772031eb8eb3e95013533903d4e802d849168ff4d3fa119370a6a7eee533283476606ad12ff5a03f1185ac56a31502691c057770baaf409a8426ae04fe81b917aa6b7b2da8cbdbc9c3398320f3d3966654416860478789b69f0f5020c951c7ede84f1bd89377ee0f4301e0f1959583a968c890435ed16c98d4ebc18c03132cc3b3e4c709792f60e3ea7bf1e5c0592a725135722ed6c3cfe83c11612bc70ba10dcb2c43f872da1c9169fa8ae9fcbba0fb9abc676aba46049031a2a4543910a6cbe2a7aecf4a35fb9c4b383669bf88b446ae2f4e3f32f38a15b268bd84734d262e3c9dd7306a7699794c0c40d40a870fa25d78d375996b0ee2c1a70ee4e6ff737d7aef385393deab9d176895534f9b4301de2e5bef324f73205b45748adca4fecbe3559889aeb81281cc1126f3133f60e899e0c67db920d3a1dbd0cf5d0b68c3f7f1da3bed163866b3f90a24ef7a49c11b2de30d46428acf09b37be651e02982612e11bb399aace7699b9272497421cfc13a1c61bf68cba4686ddc1e687a1ec138fcc39001cb9249a6838920874b01ffbb7b5341c0aa3f7b15277eef1c8149316343c29370ed4a262906d6d80f4af0cf7cc57730701ba545150c50172b499fea107b2790607d634d25f71c5fcb8859ed0b4b44a9fe5a2e0282cee3fedd660307f58e90728f9d5c2f5434da8de36a84d949dff19e774d24ac1c43d33c71d3f78f29ba55a2d8fd37327ec915921ea3f07c7d264c49aa649b050d966aba376747bce949e600a6667bc41bd4077d59a248fc87843c81dbb762d0069b84d79e5d3d25ba03924790be7da4598e81c65a26734579092788b02c5acb566d288c1fcf0ceb4c3372280a4e906513fccf6379a40501f7e07a033a4ee96e2fff215b3f2c7c9d373914d53e227ecb449ed80cc1c75de84c6571196b9653a9615ec71f0ed907cfe2dee25e01c0338011ab5001e46d8ef9a927c46b59756a75a5943b2e860ed90a17ec5dcf27dfe2e6e40ed8dbbf18ce1fc3892e51e09fc97ea7ed67e65c616588f8f1bc6ba257cecdecb300baad839a6f62791229f551a4fa33f3cbdca08e378dc976466354e778970528b8ffb8f9b46fa640dbc6873602641d9044bafe5621d7644b106c99d483dd1cea927bfb0cd3ddc6020ee822aac3745aa7723ccfbd4beb1d70a652224a4bde7cd087850c1bb5870c6074a6922203361207454caa020b2c0e8ee061504328../../../../usr/lib64/perl5/auto/re/re.so../../../../usr/lib64/libperl.so.5.26.3libperl.so.5.2�x�����@�������������X��(
��������8����\�$L����������������\[]�2-5Karel Zak <kzak@redhat.com> 2.22.2-4Karel Zak <kzak@redhat.com> 2.22.2-3Karel Zak <kzak@redhat.com> 2.22.2-2Karel Zak <kzak@redhat.com> 2.22.2-1Karel Zak <kzak@redhat.com> 2.22.1-5Karel Zak <kzak@redhat.com> 2.22.1-4Karel Zak <kzak@redhat.com> 2.22.1-3Karel Zak <kzak@redhat.com> 2.22.1-2Karel Zak <kzak@redhat.com> 2.22.1-1Karel Zak <kzak@redhat.com> 2.22-2Karel Zak <kzak@redhat.com> 2.22-1Karel Zak <kzak@redhat.com> 2.22-0.1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.21.2-3Karel Zak <kzak@redhat.com> 2.21.2-2Karel Zak <kzak@redhat.com> 2.21.2-1Karel Zak <kzak@redhat.com> 2.21.1-1Karel Zak <kzak@redhat.com> 2.21-1Karel Zak <kzak@redhat.com> 2.21-0.2Karel Zak <kzak@redhat.com> 2.21-0.1Harald Hoyer <harald@redhat.com> 2.20.1-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.20.1-4Karel Zak <kzak@redhat.com> 2.20.1-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.20.1-2Karel Zak <kzak@redhat.com> 2.20.1-1Karel Zak <kzak@redhat.com> 2.20-1Karel Zak <kzak@redhat.com> 2.20-0.2Karel Zak <kzak@redhat.com> 2.20-0.1Karel Zak <kzak@redhat.com> 2.19.1-2Karel Zak <kzak@redhat.com> 2.19.1-1Karel Zak <kzak@redhat.com> 2.19.1-0.1Karel Zak <kzak@redhat.com> 2.19-2Karel Zak <kzak@redhat.com> 2.19-1Karel Zak <kzak@redhat.com> 2.19-0.6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.19-0.5Karel Zak <kzak@redhat.com> 2.19-0.4Karel Zak <kzak@redhat.com> 2.19-0.3Karel Zak <kzak@redhat.com> 2.19-0.2Karel Zak <kzak@redhat.com> 2.19-0.1Karel Zak <kzak@redhat.com> 2.18-5Karel Zak <kzak@redhat.com> 2.18-4Karel Zak <kzak@redhat.com> 2.18-3Karel Zak <kzak@redhat.com> 2.18-2Karel Zak <kzak@redhat.com> 2.18-1Karel Zak <kzak@redhat.com> 2.18-0.2Karel Zak <kzak@redhat.com> 2.18-0.1Karel Zak <kzak@redhat.com> 2.17.2-1Karel Zak <kzak@redhat.com> 2.17.1-2Karel Zak <kzak@redhat.com> 2.17.1-1Karel Zak <kzak@redhat.com> 2.17.1-0.1Karel Zak <kzak@redhat.com> 2.17-4Karel Zak <kzak@redhat.com> 2.17-3Karel Zak <kzak@redhat.com> 2.17-2Karel Zak <kzak@redhat.com> 2.17-1Karel Zak <kzak@redhat.com> 2.17-0.6Karel Zak <kzak@redhat.com> 2.17-0.5Karel Zak <kzak@redhat.com> 2.17-0.4Karel Zak <kzak@redhat.com> 2.17-0.3Karel Zak <kzak@redhat.com> 2.17-0.2.git10dfc39Karel Zak <kzak@redhat.com> 2.17-0.1.git5e51568Karel Zak <kzak@redhat.com> 2.16-13Karel Zak <kzak@redhat.com> 2.16-12Karel Zak <kzak@redhat.com> 2.16-11Tomas Mraz <tmraz@redhat.com> - 2.16-10Karel Zak <kzak@redhat.com> 2.16-9Tomas Mraz <tmraz@redhat.com> - 2.16-8Karel Zak <kzak@redhat.com> 2.16-7Karel Zak <kzak@redhat.com> 2.16-5Stepan Kasal <skasal@redhat.com> 2.16-4Karel Zak <kzak@redhat.com> 2.16-3Karel Zak <kzak@redhat.com> 2.16-2Karel Zak <kzak@redhat.com> 2.16-1Karel Zak <kzak@redhat.com> 2.15.1-1Karel Zak <kzak@redhat.com> 2.15.1-0.2Karel Zak <kzak@redhat.com> 2.15.1-0.1Karel Zak <kzak@redhat.com> 2.14.2-8Karel Zak <kzak@redhat.com> 2.14.2-7Karel Zak <kzak@redhat.com> 2.14.2-6Karel Zak <kzak@redhat.com> 2.14.2-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.14.2-4Karel Zak <kzak@redhat.com> 2.14.2-3Karel Zak <kzak@redhat.com> 2.14.2-2Karel Zak <kzak@redhat.com> 2.14.2-1Karel Zak <kzak@redhat.com> 2.14.2-0.2Karel Zak <kzak@redhat.com> 2.14.2-0.1Karel Zak <kzak@redhat.com> 2.14.1-5Karel Zak <kzak@redhat.com> 2.14.1-3Karel Zak <kzak@redhat.com> 2.14.1-2Karel Zak <kzak@redhat.com> 2.14.1-1Karel Zak <kzak@redhat.com> 2.14.1-0.1Karel Zak <kzak@redhat.com> 2.14-3Karel Zak <kzak@redhat.com> 2.14-2Karel Zak <kzak@redhat.com> 2.14-1Karel Zak <kzak@redhat.com> 2.14-0.1Karel Zak <kzak@redhat.com> 2.13.1-9Karel Zak <kzak@redhat.com> 2.13.1-8Karel Zak <kzak@redhat.com> 2.13.1-7Karel Zak <kzak@redhat.com> 2.13.1-6Tom "spot" Callaway <tcallawa@redhat.com> - 2.13.1-5Fedora Release Engineering <rel-eng@fedoraproject.org> - 2.13.1-4Karel Zak <kzak@redhat.com> 2.13.1-3Karel Zak <kzak@redhat.com> 2.13.1-2Dan Walsh <dwalsh@redhat.com> 2.13.1-1Karel Zak <kzak@redhat.com> 2.13.1-0.2Karel Zak <kzak@redhat.com> 2.13.�x�������������������X���(
x������������W�$i�����������������W�W�W�Popelka <jpopelka@redhat.com> - 2.0-0.5.20130109gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.4.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.3.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.2.20121106gitJiri Popelka <jpopelka@redhat.com> - 2.0-0.1.20121004gitJiri Popelka <jpopelka@redhat.com> - 1.60-145.20120917gitJiri Popelka <jpopelka@redhat.com> - 1.60-144.20120917gitJiri Popelka <jpopelka@redhat.com> - 1.60-143.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-142.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-141.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-140.20120702gitFedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-139.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-138.20120702gitJiri Popelka <jpopelka@redhat.com> - 1.60-137.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-136.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-135.20120509gitJiri Popelka <jpopelka@redhat.com> - 1.60-134.20120127gitJiri Popelka <jpopelka@redhat.com> - 1.60-133.20120119gitJiri Popelka <jpopelka@redhat.com> - 1.60-132.20120111gitJiri Popelka <jpopelka@redhat.com> - 1.60-131.20120105gitJiri Popelka <jpopelka@redhat.com> - 1.60-130.20111207gitJiri Popelka <jpopelka@redhat.com> - 1.60-129.20111206gitJiri Popelka <jpopelka@redhat.com> - 1.60-128Jiri Popelka <jpopelka@redhat.com> - 1.60-127Jiri Popelka <jpopelka@redhat.com> - 1.60-126Jiri Popelka <jpopelka@redhat.com> - 1.60-125Jiri Popelka <jpopelka@redhat.com> - 1.60-124Jiri Popelka <jpopelka@redhat.com> - 1.60-123Jiri Popelka <jpopelka@redhat.com> - 1.60-122Jiri Popelka <jpopelka@redhat.com> - 1.60-121Jiri Popelka <jpopelka@redhat.com> - 1.60-120Jiri Popelka <jpopelka@redhat.com> - 1.60-119Jiri Popelka <jpopelka@redhat.com> - 1.60-118Jiri Popelka <jpopelka@redhat.com> - 1.60-117Jiri Popelka <jpopelka@redhat.com> - 1.60-116Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-115Jiri Popelka <jpopelka@redhat.com> - 1.60-114Jiri Popelka <jpopelka@redhat.com> - 1.60-113Jiri Popelka <jpopelka@redhat.com> - 1.60-112Jiri Popelka <jpopelka@redhat.com> - 1.60-111Jiri Popelka <jpopelka@redhat.com> - 1.60-110Jiri Popelka <jpopelka@redhat.com> - 1.60-109Jiri Popelka <jpopelka@redhat.com> - 1.60-108jkeating - 1.60-107Jiri Popelka <jpopelka@redhat.com> - 1.60-106Jiri Popelka <jpopelka@redhat.com> - 1.60-105Jiri Popelka <jpopelka@redhat.com> - 1.60-104Jiri Popelka <jpopelka@redhat.com> - 1.60-103Jiri Popelka <jpopelka@redhat.com> - 1.60-102Jiri Popelka <jpopelka@redhat.com> - 1.60-101Jiri Popelka <jpopelka@redhat.com> - 1.60-100Jiri Popelka <jpopelka@redhat.com> - 1.60-99Jiri Popelka <jpopelka@redhat.com> - 1.60-98Jiri Popelka <jpopelka@redhat.com> - 1.60-97Jiri Popelka <jpopelka@redhat.com> - 1.60-96Jiri Popelka <jpopelka@redhat.com> - 1.60-95Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-94Jiri Popelka <jpopelka@redhat.com> - 1.60-93Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.60-92Zdenek Prikryl <zprikryl@redhat.com> - 1.60-91Zdenek Prikryl <zprikryl@redhat.com> - 1.60-90Zdenek Prikryl <zprikryl@redhat.com> - 1.60-89Radek Vokál <rvokal@redhat.com> - 1.60-88Radek Vokál <rvokal@redhat.com> - 1.60-87Radek Vokal <rvokal@redhat.com> - 1.60-86Fedora Release Engineering <rel-eng@fedoraproject.org> - 1.60-85Radek Vokál <rvokal@redhat.com> - 1.60-84Radek Vokál <rvokal@redhat.com> - 1.60-83Radek Vokál <rvokal@redhat.com> - 1.60-82Radek Vokál <rvokal@redhat.com> - 1.60-81Radek Vokál <rvokal@redhat.com> - 1.60-80Radek Vokál <rvokal@redhat.com> - 1.60-79Radek Vokál <rvokal@redhat.com> - 1.60-78Radek Vokál <rvokal@redhat.com> - 1.60-77Radek Vokál <rvokal@redhat.com> - 1.60-76Radek Vokal <rvokal@redhat.com> - 1.60-75Radek Vokal <rvokal@redhat.com> - 1.60-74Radek Vokal <rvokal@redhat.com> - 1.60-73Jesse Keating <jkeating@redhat.com> - 1.60-72.1Radek Vokal <rvokal@redhat.com> - 1.60-72Radek Vokal <rvokal@redhat.com> - 1.60-71Radek Vokál <rvokal@redhat.com> - 1.60-70Radek VokÈx������������������X�
�(
��������ذ���V�$����������������VVZ��Lh�K�do) [1651752]
- [block] virtio-blk: Consider virtio_max_dma_size() for maximum segment size (Philipp Rudo) [1651752]
- [virtio] virtio: Introduce virtio_max_dma_size() (Philipp Rudo) [1651752]
- [kernel] dma: Introduce dma_max_mapping_size() (Philipp Rudo) [1651752]
- [kernel] swiotlb: Add is_swiotlb_active() function (Philipp Rudo) [1651752]
- [kernel] swiotlb: Introduce swiotlb_max_mapping_size() (Philipp Rudo) [1651752]
- [mm] x86/mm: Create a workarea in the kernel for SME early encryption (Lianbo Jiang) [1564427]
- [x86] x86/mm: Identify the end of the kernel area to be reserved (Lianbo Jiang) [1564427]
- [x86] x86/kdump: Export the SME mask to vmcoreinfo (Lianbo Jiang) [1564427]
- [fs] proc/vmcore: Fix i386 build error of missing copy_oldmem_page_encrypted() (Lianbo Jiang) [1564427]
- [fs] kdump, proc/vmcore: Enable kdumping encrypted memory with SME enabled (Lianbo Jiang) [1564427]
- [iommu] iommu/amd: Remap the IOMMU device table with the memory encryption mask for kdump (Lianbo Jiang) [1564427]
- [kernel] kexec: Allocate decrypted control pages for kdump if SME is enabled (Lianbo Jiang) [1564427]
- [mm] x86/ioremap: Add an ioremap_encrypted() helper (Lianbo Jiang) [1564427]
- [documentation] Documentation: Add ARM64 to kernel-parameters.rst (Jeremy Linton) [1640855]
- [arm64] arm64/speculation: Support 'mitigations=' cmdline option (Jeremy Linton) [1640855]
- [arm64] arm64: ssbs: Don't treat CPUs with SSBS as unaffected by SSB (Jeremy Linton) [1640855]
- [arm64] arm64: enable generic CPU vulnerabilites support (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for speculative store bypass (Jeremy Linton) [1640855]
- [arm64] arm64: Always enable ssb vulnerability detection (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for spectre-v2 (Jeremy Linton) [1640855]
- [arm64] arm64: Always enable spectre-v2 vulnerability detection (Jeremy Linton) [1640855]
- [arm64] arm64: Use firmware to detect CPUs that are not affected by Spectre-v2 (Jeremy Linton) [1640855]
- [arm64] arm64: Advertise mitigation of Spectre-v2, or lack thereof (Jeremy Linton) [1640855]
- [arm64] arm64: add sysfs vulnerability show for meltdown (Jeremy Linton) [1640855]
- [arm64] arm64: Add sysfs vulnerability show for spectre-v1 (Jeremy Linton) [1640855]
- [arm64] arm64: Provide a command line to disable spectre_v2 mitigation (Jeremy Linton) [1640855]
- [documentation] powerpc/fsl: Add FSL_PPC_BOOK3E as supported arch for nospectre_v2 boot arg (Jeremy Linton) [1640855]
- [documentation] Documentation: Document arm64 kpti control (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Whitelist HiSilicon Taishan v110 CPUs (Jeremy Linton) [1640855]
- [arm64] arm64: Add MIDR encoding for HiSilicon Taishan CPUs (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Whitelist Cortex-A CPUs that don't implement the CSV3 field (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Update arm64_kernel_use_ng_mappings() when forced on (Jeremy Linton) [1640855]
- [arm64] arm64: kpti: Avoid rewriting early page tables when KASLR is enabled (Jeremy Linton) [1640855]
- [arm64] arm64: capabilities: Merge duplicate Cavium erratum entries (Jeremy Linton) [1640855]
- [arm64] arm64: capabilities: Merge entries for ARM64_WORKAROUND_CLEAN_CACHE (Jeremy Linton) [1640855]
- [arm64] arm64: Use a raw spinlock in __install_bp_hardening_cb() (Jeremy Linton) [1640855]
- [arm64] arm64: KVM: Guests can skip __install_bp_hardening_cb()s H�x�������������x�����X��(
������������V�$����������������VVV�
		

	
	RRRRRRRRRRRYRRRRRRRRRRRYPPR'RIPRR!R'RCRIRPPRR R"RIP	RR R#RIP
RR%RIPRIRORPPR%P!R'R>RIP%R>RIRPP'RR>RIRPP,R#R'R:R>RIRPP.RR#R'RIRPRQP/RR'RIRPP4RR#R'R>RIRPP7R:R>RIRPPDRR#PER:R>RIRPPFRR#R'R>RIRJPGPHPIPJR'R+R:R>RIRPPLR>RIPMR>RIRPPNR>POR>PQR'R:R>RIRPPVR#R'RIPgR>RIPyR>PzR>RIRRRRRRRYR�x�������������������XLl�(
�s�P������zd�����$j����������������zd{dyd�opensslaes.hasn1.hasn1_mac.hasn1err.hasn1t.hasync.hasyncerr.hbio.hbioerr.hblowfish.hbn.hbnerr.hbuffer.hbuffererr.hcamellia.hcast.hcmac.hcms.hcmserr.hcomp.hcomperr.hconf.hconf_api.hconferr.hcrypto.hcryptoerr.hct.hcterr.hdes.hdh.hdherr.hdsa.hdsaerr.hdtls1.he_os2.hebcdic.hec.hecdh.hecdsa.hecerr.hengine.hengineerr.herr.hevp.hevperr.hfips.hfips_rand.hhmac.hidea.hkdf.hkdferr.hlhash.hmd2.hmd4.hmd5.hmdc2.hmodes.hobj_mac.hobjects.hobjectserr.hocsp.hocsperr.hopensslconf-x86_64.hopensslconf.hopensslv.hossl_typ.hpem.hpem2.hpemerr.hpkcs12.hpkcs12err.hpkcs7.hpkcs7err.hrand.hrand_drbg.hranderr.hrc2.hrc4.hrc5.hripemd.hrsa.hrsaerr.hsafestack.hseed.hsha.hsrp.hsrtp.hssl.hssl2.hssl3.hsslerr.hstack.hstore.hstoreerr.hsymhacks.htls1.hts.htserr.htxt_db.hui.huierr.hwhrlpool.hx509.hx509_vfy.hx509err.hx509v3.hx509v3err.hlibcrypto.solibssl.solibcrypto.pclibssl.pcopenssl.pcopenssl-develCHANGESdir-locals.example.elopenssl-c-indent.elACCESS_DESCRIPTION_free.3ssl.gzACCESS_DESCRIPTION_new.3ssl.gzADMISSIONS.3ssl.gzADMISSIONS_free.3ssl.gzADMISSIONS_get0_admissionAuthority.3ssl.gzADMISSIONS_get0_namingAuthority.3ssl.gzADMISSIONS_get0_professionInfos.3ssl.gzADMISSIONS_new.3ssl.gzADMISSIONS_set0_admissionAuthority.3ssl.gzADMISSIONS_set0_namingAuthority.3ssl.gzADMISSIONS_set0_professionInfos.3ssl.gzADMISSION_SYNTAX.3ssl.gzADMISSION_SYNTAX_free.3ssl.gzADMISSION_SYNTAX_get0_admissionAuthority.3ssl.gzADMISSION_SYNTAX_get0_contentsOfAdmissions.3ssl.gzADMISSION_SYNTAX_new.3ssl.gzADMISSION_SYNTAX_set0_admissionAuthority.3ssl.gzADMISSION_SYNTAX_set0_contentsOfAdmissions.3ssl.gzASIdOrRange_free.3ssl.gzASIdOrRange_new.3ssl.gzASIdentifierChoice_free.3ssl.gzASIdentifierChoice_new.3ssl.gzASIdentifiers_free.3ssl.gzASIdentifiers_new.3ssl.gzASN1_ENUMERATED_get.3ssl.gzASN1_ENUMERATED_get_int64.3ssl.gzASN1_ENUMERATED_set.3ssl.gzASN1_ENUMERATED_set_int64.3ssl.gzASN1_ENUMERATED_to_BN.3ssl.gzASN1_GENERALIZEDTIME_adj.3ssl.gzASN1_GENERALIZEDTIME_check.3ssl.gzASN1_GENERALIZEDTIME_print.3ssl.gzASN1_GENERALIZEDTIME_set.3ssl.gzASN1_GENERALIZEDTIME_set_string.3ssl.gzASN1_INTEGER_get.3ssl.gzASN1_INTEGER_get_int64.3ssl.gzASN1_INTEGER_get_uint64.3ssl.gzASN1_INTEGER_set.3ssl.gzASN1_INTEGER_set_int64.3ssl.gzASN1_INTEGER_set_uint64.3ssl.gzASN1_INTEGER_to_BN.3ssl.gzASN1_ITEM.3ssl.gzASN1_ITEM_get.3ssl.gzASN1_ITEM_lookup.3ssl.gzASN1_OBJECT_free.3ssl.gzASN1_OBJECT_new.3ssl.gzASN1_STRING_TABLE.3ssl.gzASN1_STRING_TABLE_add.3ssl.gzASN1_STRING_TABLE_cleanup.3ssl.gzASN1_STRING_TABLE_get.3ssl.gzASN1_STRING_cmp.3ssl.gzASN1_STRING_data.3ssl.gzASN1_STRING_dup.3ssl.gzASN1_STRING_free.3ssl.gzASN1_STRING_get0_data.3ssl.gzASN1_STRING_length.3ssl.gzASN1_STRING_new.3ssl.gzASN1_STRING_print.3ssl.gzASN1_STRING_print_ex.3ssl.gzASN1_STRING_print_ex_fp.3ssl.gzASN1_STRING_set.3ssl.gzASN1_STRING_to_UTF8.3ssl.gzASN1_STRING_type.3ssl.gzASN1_STRING_type_new.3ssl.gzASN1_TIME_adj.3ssl.gzASN1_TIME_check.3ssl.gzASN1_TIME_cmp_time_t.3ssl.gzASN1_TIME_compare.3ssl.gzASN1_TIME_diff.3ssl.gzASN1_TIME_normalize.3ssl.gzASN1_TIME_print.3ssl.gzASN1_TIME_set.3ssl.gzASN1_TIME_set_string.3ssl.gzASN1_TIME_set_string_X509.3ssl.gzASN1_TIME_to_generalizedtime.3ssl.gzASN1_�x������������w����X�Ĝ(
�����������~!�$n����������������~!}!!� names of changed patches- 5.20.2 bump (see <http://search.cpan.org/dist/perl-5.20.2/pod/perldelta.pod>
  for release notes)
- Regenerate a2p.c (BZ#1177672)- Improve h2ph fix for GCC 5.0- Fix regressions with GCC 5.0- Sub-package inc-latest module- Delete dual-living programs clashing on debuginfo files (bug #878863)- Report inaccesible file on failed require (bug #1166504)
- Use stronger algorithm needed for FIPS in t/op/taint.t (bug #1128032)- Consider Filter::Util::Call dependency as mandatory (bug #1165183)
- Sub-package encoding module
- Own upper directories by each package that installs a file there and
  remove empty directories (bug #1165013)- Freeze epoch at perl-Pod-Checker and perl-Pod-Usage (bug #1163490)
- Remove bundled perl-ExtUtils-Command (bug #1158536)
- Remove bundled perl-Filter-Simple (bug #1158542)- Do not double-own perl-Pod-Usage' and perl-Pod-Checker' files by
  perl-Pod-Parser on bootstrap
- Sub-package ExtUtils-Command (bug #1158536)
- Sub-package Filter-Simple (bug #1158542)
- Build-require groff-base instead of big groff- Remove bundled perl-Devel-PPPort (bug #1143999)
- Remove bundled perl-B-Debug (bug #1142952)
- Remove bundled perl-ExtUtils-CBuilder (bug #1144033)
- Remove bundled perl-ExtUtils-Install (bug #1144068)- Move all Module-CoreList files into perl-Module-CoreList
- Sub-package corelist(1) into perl-Module-CoreList-tools (bug #1142757)
- Remove bundled perl-Module-CoreList, and perl-Module-CoreList-tools
  (bug #1142757)
- Sub-package Devel-PPPort (bug #1143999)
- Sub-package B-Debug (bug #1142952)
- Use native version for perl-ExtUtils-CBuilder
- Specify all dependencies for perl-ExtUtils-Install (bug #1144068)
- Require perl-ExtUtils-ParseXS by perl-ExtUtils-MakeMaker because of xsubpp- Provide 5.20.0 MODULE_COMPAT- 5.20.1 bump (see <http://search.cpan.org/dist/perl-5.20.1/pod/perldelta.pod>
  for release notes)
- Sub-package perl-ExtUtils-Miniperl (bug #1141222)- Specify all dependencies for perl-CPAN (bug #1090112)
- Disable non-core modules at perl-CPAN when bootstrapping
- Remove bundled perl-CPAN (bug #1090112)- Stop providing old perl(MODULE_COMPAT_5.18.*)- Update to Perl 5.20.0
- Clean patches, not needed with new version
- Update patches to work with new version
- Update version of sub-packages, remove the deleted sub-packages
- Sub-package perl-IO-Socket-IP, perl-experimental
- Disable BR perl(local::lib) for cpan tool when bootstraping- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Declare dependencies for cpan tool (bug #1122498)
- Use stronger algorithm needed for FIPS in t/op/crypt.t (bug #1128032)
- Make *DBM_File desctructors thread-safe (bug #1107543)- Sub-package perl-Term-ANSIColor and remove it (bug #1121924)- Remove bundled perl-App-a2p, perl-App-find2perl, perl-App-s2p, and
  perl-Package-Constants
- Correct perl-App-s2p license to ((GPL+ or Artistic) and App-s2p)- Sub-package perl-App-find2perl (bug #1111196)
- Sub-package perl-App-a2p (bug #1111232)
- Sub-package perl-App-s2p (bug #1111242)- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- Pass -fwrapv to stricter GCC 4.9 (bug #1082957)- Fix t/comp/parser.t not to load system modules (bug #1084399)- Move macro files into %{_rpmconfigdir}/macros.d- Provide perl(CPAN::Meta::Requirements) with six decimal places- Drop perl-Test-Simple-tests package is it is not delivered by dual-lived
  version
- Hide dual-lived perl-Object-Accessor- Use a macro to cover all 64-bit PowerPC architectures (bug #1052709)- Use upstream patch to fix a test failure in perl5db.t when TERM=vt100- 5.18.2 bump (see <http://search.cpan.org/dist/perl-5.18.2/pod/perldelta.pod>
  for release notes)- Document Math::BigInt::CalcEmu requires Math::BigInt (bug #959096)- perl_default_filter macro does not need to filter private libraries from
  provides (bug #1020809)
- perl_default_filter anchors the filter regular expressions
- perl_default_filter appends the filters instead of redefining them- Fix rules for parsing numeric escapes in regexe�x��������������f����X��(
@/�������r������p�$`����������������poq�-3COPYING.GPLv2COPYING.ISCCOPYING.LGPLv2.1COPYING.UCButil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.moutil-linux.mocal.1.gzchrt.1.gzcol.1.gzcolcrt.1.gzcolrm.1.gzcolumn.1.gzdmesg.1.gzeject.1.gzfallocate.1.gzfincore.1.gzflock.1.gzgetopt.1.gzhexdump.1.gzionice.1.gzipcmk.1.gzipcrm.1.gzipcs.1.gzkill.1.gzlast.1.gzlastb.1.gzlogger.1.gzlogin.1.gzlook.1.gzlscpu.1.gzlsipc.1.gzlslogins.1.gzlsmem.1.gzmcookie.1.gzmesg.1.gzmore.1.gzmountpoint.1.gznamei.1.gznsenter.1.gzprlimit.1.gzrename.1.gzrenice.1.gzrev.1.gzrunuser.1.gzscript.1.gzscriptreplay.1.gzsetpriv.1.gzsetsid.1.gzsetterm.1.gzsu.1.gztaskset.1.gzul.1.gzunshare.1.gzutmpdump.1.gzuuidgen.1.gzuuidparse.1.gzwall.1.gzwhereis.1.gzwrite.1.gzfstab.5.gzterminal-colors.d.5.gzaddpart.8.gzagetty.8.gzblkdiscard.8.gzblkid.8.gzblkzone.8.gzblockdev.8.gzcfdisk.8.gzchcpu.8.gzchmem.8.gzclock.8.gzctrlaltdel.8.gzdelpart.8.gzfdformat.8.gzfdisk.8.gzfindfs.8.gzfindmnt.8.gzfsck.8.gzfsck.cramfs.8.gzfsck.minix.8.gzfsfreeze.8.gzfstrim.8.gzhwclock.8.gzi386.8.gzisosize.8.gzldattach.8.gzlinux32.8.gzlinux64.8.gzlosetup.8.gzlsblk.8.gzlslocks.8.gzlsns.8.gzmkfs.8.gzmkfs.cramfs.8.gzmkfs.minix.8.gzmkswap.8.gzmount.8.gznologin.8.gzpartx.8.gzpivot_root.8.gzraw.8.gzrawdevices.8.gzreadprofile.8.gzresizepart.8.gzrfkill.8.gzrtcwake.8.gzsetarch.8.gzsfdisk.8.gzsulogin.8.gzswaplabel.8.gzswapoff.8.gzswapon.8.gzswitch_root.8.gzumount.8.gzuname26.8.gzwdctl.8.gzwipefs.8.gzx86_64.8.gzzramctl.8.gz/etc//etc/pam.d//usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/00//usr/lib/.build-id/01//usr/lib/.build-id/06//usr/lib/.build-id/1b//usr/lib/.build-id/1d//usr/lib/.build-id/23//usr/lib/.build-id/26//usr/lib/.build-id/29//usr/lib/.build-id/2b//usr/lib/.build-id/2d//usr/lib/.build-id/2f//usr/lib/.build-id/34//usr/lib/.build-id/35//usr/lib/.build-id/36//usr/lib/.build-id/37//usr/lib/.build-id/39//usr/lib/.build-id/3d//usr/lib/.build-id/3e//usr/lib/.build-id/43//usr/lib/.build-id/4b//usr/lib/.build-id/4f//usr/lib/.build-id/53//usr/lib/.build-id/56//usr/lib/.build-id/57//usr/lib/.build-id/5a//usr/lib/.build-id/5c//usr/lib/.build-id/5e//usr/lib/.build-id/5f//usr/lib/.build-id/6a//usr/lib/.build-id/6d//usr/lib/.build-id/6f//usr/lib/.build-id/71//usr/lib/.build-id/74//usr/lib/.build-id/78//usr/lib/.build-id/7a//usr/lib/.build-id/7f//usr/lib/.build-id/81//usr/lib/.build-id/86//usr/lib/.build-id/8a//usr/lib/.build-id/93//usr/lib/.build-id/97//usr/lib/.build-id/99//usr/lib/.build-id/9d//usr/lib/.build-id/9f//usr/lib/.build-id/a1//usr/lib/.build-id/a3//usr/lib/.build-id/a7//usr/lib/.build-id/ab//usr/lib/.build-id/ad//usr/lib/.build-id/af//usr/lib/.build-id/b2//usr/lib/.build-id/b3//usr/lib/.build-id/b4//usr/lib/.build-id/b5//usr/lib/.build-id/b7//usr/lib/.build-id/b9//usr/lib/.build-id/bb//usr/lib/.build-id/be//usr/lib/.build-id/c2//usr/lib/.build-id/c4//usr/lib/.build-id/c5//usr/lib/.build-id/c6//usr/lib/.build-id/c9//usr/lib/.build-id/cb//usr/lib/.build-id/ce//usr/lib/.build-id/cf//usr/lib/.build-id/d2//usr/lib/.build-id/d5//usr/lib/.build-id/da//usr/lib/.build-id/dd//usr/lib/.build-id/de//usr/lib/.build-id/df//usr/lib/.build-id/e0//usr/lib/.build-id/e1//usr/lib/.build-id/e9//usr/lib/.build-id/f0//usr/lib/.build-id/f5//usr/lib/.build-id/fa//usr/lib/.build-id/fc//usr/lib/.build-id/fd//usr/lib/.build-id/ff//usr/lib/systemd/system//usr/lib/udev/rules.d//usr/sbin//usr/share/bash-completion/completions//usr/share/doc//usr/share/doc/util-linux//usr/share/licenses//usr/share/licenses/util-linux//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/da/LC_MESSAGES//usr/share/locale/de/L�x�����(�������U����XB��(
�����d���3��$#����������������3�4�2��Pod-Html- Disable hardening due to some run-time failures (bug #1238804)- Sub-package bignum
- Sub-package Math-BigRat
- Sub-package Math-BigInt-FastCalc
- Sub-package Math-Complex
- Remove bundled perl-Config-Perl-V (bug #1238203)
- Remove bundled perl-MIME-Base64 (bug #1238222)
- Remove bundled perl-PerlIO-via-QuotedPrint (bug #1238229)
- Remove bundled perl-Pod-Escapes (bug #1238237)
- Remove bundled perl-Term-Cap (bug #1238248)
- Remove bundled perl-Text-Balanced (bug #1238269)
- Remove bundled perl-libnet (bug #1238689)
- Remove bundled perl-perlfaq (bug #1238703)
- Remove bundled perl-Unicode-Normalize (bug #1238730)
- Remove bundled perl-Unicode-Collate (bug #1238760)- Store distribution's linker and compiler flags to more Config's options
  in order to apply them when linking executable programs (bug #1238804)
- Sub-package Config-Perl-V (bug #1238203)
- Sub-package MIME-Base64 (bug #1238222)
- Sub-package PerlIO-via-QuotedPrint (bug #1238229)
- Update Pod-Escapes metadata (bug #1238237)
- Sub-package Term-Cap (bug #1238248)
- Sub-package Text-Balanced (bug #1238269)
- Sub-package libnet (bug #1238689)
- Sub-package perlfaq (bug #1238703)
- Sub-package Unicode-Normalize (bug #1238730)
- Sub-package Unicode-Collate (bug #1238760)
- Sub-package Math-BigInt
- Do not provide Net/libnet.cfg (bug #1238689)
- Revert downstream change in Net::Config default configuration
- Move libnetcfg tool from perl-devel into perl-libnetcfg sub-package- Subpackage "open" module in order to keep deprecated "encoding" module
  optional (bug #1228378)
- Control building dual-lived sub-packages by perl_bootstrap macro
- Make PadlistNAMES() lvalue again (bug #1231165)
- Make magic vtable writable as a work-around for Coro (bug #1231165)
- Explain file break-down into RPM packages in perl package description- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.20.*)- Move ok and Test::Use::ok to perl-Test-Simple- Move bin/encguess to perl-Encode- 5.22.0 bump (see <http://search.cpan.org/dist/perl-5.22.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages and erase the removed modules from the core
- Clean patches, not needed with new version
- Update patches to work with new version- Sub-package perl-CGI-Fast and perl-Module-Build-Deprecated
- Add missing dual-life modules to perl-core- Bump to make koji happy- Correct license tags of the main package, CGI, Compress-Raw-Zlib,
  Digest-MD5, Test-Simple and Time-Piece
- Package a Pod-Html license clarification email- Sub-package Text-Tabs+Wrap (bug #910798)- Add systemtap probes for new dtrace markers- Move perl(:MODULE_COMPAT_*) symbol and include directories to perl-libs
  package (bug #1174951)- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Provide 5.20.2 MODULE_COMPAT
- Clean list of provided files
- Update names of changed patches- 5.20.2 bump (see <http://search.cpan.org/dist/perl-5.20.2/pod/perldelta.pod>
  for release notes)
- Regenerate a2p.c (BZ#1177672)- Improve h2ph fix for GCC 5.0- Fix regressions with GCC 5.0- Sub-package inc-latest module- Delete dual-living programs clashing on debuginfo files (bug #878863)- Report inaccesible file on failed require (bug #1166504)
- Use stronger algorithm needed for FIPS in t/op/taint.t (bug #1128032)- Consider Filter::Util::Call dependency as mandatory (bug #1165183)
- Sub-package encoding module
- Own upper directories by each package that installs a file there and
  remove empty directories (bug #1165013)- Freeze epoch at perl-Pod-Checker and perl-Pod-Usage (bug #1163490)
- Remove bundled perl-ExtUtils-Command (bug #1158536)
- Remove bundled perl-Filter-Simple (bug #1158542)- Do not double-own perl-Pod-Usage' and perl-Pod-Checker' files by
  perl-Pod-Parser on bootstrap
- Sub-package ExtUtils-Command (bug #1158536)
- Sub-package Filter-Simple (bug #1158542)
- Build-require groff-base instead of big groff- Remove bundled perl-Devel-PPPort (bug #11439�x��������������E����X��(
���������9�������d�$\�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������H5����X���(
�P������(��������$n������������������Bfa09927c6637149932fc?�����H��!�<���Q�d~���e-
	Q�d~�����H�Ա�W{1��&�Q;�H�l��z^����)��=ޕ��6?%��fB�Y}�i@<�&󰀘��lJ�J��~"��k'<��c�S��1~�)��$s+��_qԖt���MY�sn���oYщ�u̙\�����������o��c��#�5�ϊ��[�r��B��N*3���=��Ɛ_�_^�ԼL���^F��Rɨ�cl���|P�g�ju�$7�54B�����T2j�6���1!»���/i�;G�ISy���.�}z�6�%�E|
��LY�(�;*�.�B��xA�A��÷������`�a�Hfi�-�)
�pn��`�u���ޗ��L� |�?����P(i�ާ�lX�'%��e�we�s~���~߼�p���)�@��g>���!�<��ΰ��Q�d~���e-
	Q�d~�����N%6���h1c(�����5�)ӟ�1���{/��$����`xk�Wk�ҵz�[�؅����k�����(>��1H)<��]w|r�����z"I�o��w��p(�@z���m�A�ji����i������8�#󗟢ԃUv(�Oo�
�;�qA
"��}r���&SN�=�A9"���M��"#uO?��5Q��$ !x�vޑ�m�[�`��U�\x0Y�#K}(X�

$m�*�|&����*�c5_�W���c֘]�,�H'@
V0��r��Vm89��)��o4(9��/1���X��8�������q#�-S�Ɩ�Y�lr2��:�x���:���'�y�/�+	h�&|��KE.�(	�)�]��N�ڈ�싪���Ia53c58830532c330d37e6e8d024a4cd39368aa6a40a340cac62e4cf04ae7b2aed41c3660b279d1134d437b515c53cdd8a9103e85fX�, �fX� function (#1734787)
- shared/cpu-set-util: make transfer of cpu_set_t over bus endian safe (#1734787)
- test-cpu-set-util: add test for dbus conversions (#1734787)
- shared/cpu-set-util: introduce cpu_set_to_range() (#1734787)
- systemctl: present CPUAffinity mask as a list of CPU index ranges (#1734787)
- shared/cpu-set-util: only force range printing one time (#1734787)
- execute: dump CPUAffinity as a range string instead of a list of CPUs (#1734787)
- cpu-set-util: use %d-%d format in  cpu_set_to_range_string() only for actual ranges (#1734787)
- core: introduce NUMAPolicy and NUMAMask options (#1734787)
- core: disable CPUAccounting by default (#1734787)
- set kptr_restrict=1 (#1689346)
- cryptsetup: reduce the chance that we will be OOM killed (#1696602)
- core, job: fix breakage of ordering dependencies by systemctl reload command (#1766417)
- debug-generator: enable custom systemd.debug_shell tty (#1723722)- core: never propagate reload failure to service result (#1735787)
- man: document systemd-analyze security (#1750343)
- man: reorder and add examples to systemd-analyze(1) (#1750343)
- travis: move to CentOS 8 docker images (#1761519)
- travis: drop SCL remains (#1761519)
- syslog: fix segfault in syslog_parse_priority() (#1761519)
- sd-bus: make strict asan shut up (#1761519)
- travis: don't run slow tests under ASan/UBSan (#1761519)
- kernel-install: do not require non-empty kernel cmdline (#1701454)
- ask-password: prevent buffer overrow when reading from keyring (#1752050)
- core: try to reopen /dev/kmsg again right after mounting /dev (#1749212)
- buildsys: don't garbage collect sections while linking (#1748258)
- udev: introduce CONST key name (#1762679)
- Call getgroups() to know size of supplementary groups array to allocate (#1743230256 KB
- Consider smb3 as remote filesystem (#1757257)
- process-util: introduce pid_is_my_child() helper (#1744972)
- core: reduce the number of stalled PIDs from the watched processes list when possible (#1744972)
- core: only watch processes when it's really necessary (#1744972)
- core: implement per unit journal rate limiting (#1719577)
- path: stop watching path specs once we triggered the target unit (#1763161)
- journald: fixed assertion failure when system journal rotation fails (#9893) (#1763619)
- test: use PBKDF2 instead of Argon2 in cryptsetup... (#1761519)
- test: mask several unnecessary services (#1761519)
- test: bump the second partition's size to 50M (#1761519)
- shared/sleep-config: exclude zram devices from hibernation candidates (#1763617)
- selinux: don't log SELINUX_INFO and SELINUX_WARNING messages to audit (#1763612)
- sd-device: introduce log_device_*() macros (#1753369)
- udev: Add id program and rule for FIDO security tokens (#1753369)
- shared/but-util: drop trusted annotation from bus_open_system_watch_bind_with_description() (#1746857)
- sd-bus: adjust indentation of comments (#1746857)
- resolved: do not run loop twice (#1746857)
- resolved: al�x����������`$����X.�(
��������pX������z��$j����������������z�y�{��when no terminal (RhBug:1577889)
- Allow to ship alternative dnf.conf (RhBug:1752249)
- Don't check if repo is expired if it doesn't have loaded metadata (RhBug:1745170)
- Remove duplicate entries from "dnf search" output (RhBug:1742926)
- Set default value of repo name attribute to repo id (RhBug:1669711)
- Allow searching in disabled modules using "dnf module provides" (RhBug:1629667)
- Group install takes obsoletes into account (RhBug:1761137)
- Improve handling of vars
- Do not load metadata for repolist commands (RhBug:1697472,1713055,1728894)
- Fix messages for starting and failing scriptlets (RhBug:1724779)
- Don't show older install-only pkgs updates in updateinfo (RhBug:1649383,1728004)
- Add --ids option to the group command (RhBug:1706382)
- Add --with_cve and --with_bz options to the updateinfo command (RhBug:1750528)- Update to 4.2.11
- Improve modularity documentation (RhBug:1730162,1730162,1730807,1734081)
- Fix detection whether system is running on battery (used by metadata caching timer) (RhBug:1498680)
- New repoquery queryformat: %{reason}
- Print rpm errors during test transaction (RhBug:1730348) 
- Fix incorrectly marked profile and stream after failed rpm transaction check (RhBug:1719679)
- Show transaction errors inside dnf shell (RhBug:1743644)
- dnf-automatic now respects versionlock excludes (RhBug:1746562)
- [doc] Add user_agent and countme options
- [history] Don't store failed transactions as succeeded
- [history] Do not require root for informative commands
- [dnssec] Fix UnicodeWarning when using new rpm (RhBug:1699650)
- Apply excludes before modular excludes (RhBug:1709453)
- Improve help for command line arguments (RhBug:1659328)
- Add new modular API method ModuleBase.get_modules
- Mark features used by ansible, anaconda and subscription-manager as an API- Prevent reinstalling modified packages with same NEVRA (RhBug:1728252,1644241,1760825)- Remove patch to not fail when installing modular RPMs without modular metadata- Fix: --setopt and repo with dots (RhBug:1746349)- Prevent printing empty Error Summary (RhBug:1690414)- Update localizations from zanata (RhBug:1689982)
- Accept multiple specs in repoquery options (RhBug:1667898,1656801)
- Prevent switching modules in all cases (RhBug:1706215)
- Change synchronization of rpm transaction to swdb (RhBug:1737328)
- Print rpm error messages during transaction (RhBug:1677199)
- Report missing default profile as an error (RhBug:1669527,1724564)
- Describe a behavior when plugin is removed (RhBug:1700741)- Add patch to not fail when installing modular RPMs without modular metadata- Update to 4.2.7
- Fix package reinstalls during yum module remove (RhBug:1700529)
- Fail when "-c" option is given nonexistent file (RhBug:1512457)
- Reuse empty lock file instead of stopping dnf (RhBug:1581824)
- Propagate comps 'default' value correctly (RhBug:1674562)
- Better search of provides in /(s)bin/ (RhBug:1657993)
- Add detection for armv7hcnl (RhBug:1691430)
- Fix group install/upgrade when group is not available (RhBug:1707624)
- Report not matching plugins when using --enableplugin/--disableplugin
  (RhBug:1673289) (RhBug:1467304)
- Add support of modular FailSafe (RhBug:1623128)
- Replace logrotate with build-in log rotation for dnf.log and dnf.rpm.log
  (RhBug:1702690)- Update to 4.2.6
- Use improved config parser that preserves order of data
- Follow RPM security policy for package verification
- Update modules regardless of installed profiles
- [conf] Use environment variables prefixed with DNF_VAR_
- Allow adjustment of repo from --repofrompath (RhBug:1689591)
- Allow globs in setopt in repoid part
- Add command abbreviations (RhBug:1634232)
- Installroot now requires absolute path
- librepo: Turn on debug logging only if debuglevel is greater than 2 (RhBug:1355764,1580022)
- Document cachedir option (RhBug:1691365)
- Enhance documentation - API examples
- Enhance documentation of --whatdepends option (RhBug:1687070)
- Update documentation: implemented plugins; options; deprecated commands (RhBug:1670835,16732�x�������������8����X��(
�>���`�������z�$j����������������zy�� �v�9̵��RK)��O����y���u;����s�	���{AL��ƹ�(��KT�z���S����A�Q�>g	�Ssl��شu�M>�Kn�B�g)5�Th�Á��������~ɔAq�6�K��]�%*פ�����ͥ7���ݝN�l�&��_fSז=#�+�#[ނI����]�ʲ��S~�,���KН��H�q}�"P�)�������O�����$%ـ·��T�]���"�[�Ͷ[�8*ZLC�ϭ�XB0��==����o�G�o��w��`ee��~Ȧ�5S/�|�,���x(씿�-�j�<�8H��H'�=L�'�~������-��pi�tƾ�i�v�9|UBl�a%��"
�|���A=��B�|+��
��wIu����Jo��X�����;h�A��w�!�V���!�|��ւ����$u~OYL�V�U���!w_`ªɂ끁Y�Ƌ"r��f��<��\\A�B66a2d28cdaa1ee01096f142b2104246cfcc15cb93ed1273b4b05c23611bff31d2d1ddcc3ceb815c2914fe657302790d1a164d6fefX�-��$fX�0@@�@@;�@�@@�@@�@@@@��@��@��@��?٭�?�\@?ĕ�?���?�C@?��?��?�q@?��@?��?��?�Y@?r�?q�@?q�@?hL�?Xz�?%@?%@?%@?�@?'@?�?	`�?�?�?&@>�v�>��@>G�@>.��=��=�K@=��=�=�=���=���=0@=Jt@=E.@=�@=r@=
�@<��<�@<�@<��<��<�@<�@<��@<m@<m@<t�@<c��<bl@<Y1�<N��;��;��@;�"@;�;֭@;�
@;��;��@;���;�O@;���;��@;�f@;��;�q�;� @;� @;�@;�e@;��;��@;�*�;���;w�@;s�;r{@;I��;DV�;A��;<m�;7'�;��:��@:�S�:�@:ͯ�:�^@:��:�:�:�F@:�@:��@:�t@:�"�:��@:���:�E@:���:�
�:�@:�!�:��@:�8�:~��:v��:mr@:l �:j�@:h,@:e�@:^�:\N�:Z�@:=�@:6@:&A@:$�:#�@:c�:@:�@9��@9�9�?@9�V@9ݾ�9��9�x�9��9�w�9�1�9�k@9�k@9��9��@9��@9�j@9}�@9|/�9y��9x;@9l]�9l]�9k@9`�@9N@9Gs�9;�@9;�@98�@96P@9�9�@8��8��8�m�8�y@8��@8p�@8@7�g�7�s@7�!�7�{�7{X@7w�7&@7�7�@7�@71�7=@7�@7H�6�k@6�v�6�%@6�<@6��6�@6��6�r�6zC�Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-33Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-32Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-31Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-30Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-27Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-26Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-25Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-24Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-22Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-21Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-20Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-19Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-18Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-17Iker Pedrosa <ipedrosa@redhat.com> - 1.3.1-16Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-15Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-14Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-13Peter Robinson <pbrobinson@redhat.com> - 1.3.1-12Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-11Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-10Iker Pedrosa <ipedrosa@redhat.com> 1.3.1-9Tomáš Mráz <tmraz@redhat.com> 1.3.1-8Tomáš Mráz <tmraz@redhat.com> 1.3.1-6Tomáš Mráz <tmraz@redhat.com> 1.3.1-5Tomáš Mráz <tmraz@redhat.com> 1.3.1-4Tomáš Mráz <tmraz@redhat.com> 1.3.1-3Tomáš Mráz <tmraz@redhat.com> 1.3.1-1Tomáš Mráz <tmraz@redhat.com> 1.3.1-1Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-10Tomáš Mráz <tmraz@redhat.com> 1.3.0-9Björn Esser <besser82@fedoraproject.org> - 1.3.0-8Tomáš Mráz <tmraz@redhat.com> 1.3.0-7Tomáš Mráz <tmraz@redhat.com> 1.3.0-6Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-5Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-4Tomáš Mráz <tmraz@redhat.com> 1.3.0-3Fedora Release Engineering <releng@fedoraproject.org> - 1.3.0-2Tomáš Mráz <tmraz@redhat.com> 1.3.0-1Tomáš Mráz <tmraz@redhat.com> 1.2.1-8Tomáš Mráz <tmraz@redhat.com> 1.2.1-7Tomáš Mráz <tmraz@redhat.com> 1.2.1-6Tomáš Mráz <tmraz@redhat.com> 1.2.1-5Fedora Release Engineering <releng@fedoraproject.org> - 1.2.1-4Tomáš Mráz <tmraz@redhat.com> 1.2.1-3Tomáš�x������������������X���(
p�������H���^�$N����������������^]_� <dwalsh@RedHat.com> 2.12-19Elliot Lee <sopwith@redhat.com> 2.12-18Elliot Lee <sopwith@redhat.com> 2.12-17Elliot Lee <sopwith@redhat.com> 2.12-16Jeremy Katz <katzj@redhat.com> 2.12-15<SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com> 2.12-13<SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com><SteveD@RedHat.com>Dan Walsh <dwalsh@RedHat.com>Steve Dickson <SteveD@RedHat.com>Steve Dickson <SteveD@RedHat.com> Dan Walsh <dwalsh@redhat.com> 2.12-5Elliot Lee <sopwith@redhat.com> 2.12-4Dan Walsh <dwalsh@redhat.com> 2.12-3Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.12-1Steve Dickson <SteveD@RedHat.com> 2.12pre-4Elliot Lee <sopwith@redhat.com> 2.12pre-3Dan Walsh <dwalsh@redhat.com> 2.12pre-2Elliot Lee <sopwith@redhat.com> 2.12pre-1Dan Walsh <dwalsh@redhat.com> 2.11y-35.selDan Walsh <dwalsh@redhat.com> 2.11y-34.selElliot Lee <sopwith@redhat.com> 2.11y-34Dan Walsh <dwalsh@redhat.com> 2.11y-33Dan Walsh <dwalsh@redhat.com> 2.11y-32.selElliot Lee <sopwith@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-31Dan Walsh <dwalsh@redhat.com> 2.11y-30.selElliot Lee <sopwith@redhat.com> 2.11y-28Dan Walsh <dwalsh@redhat.com> 2.11y-27Dan Walsh <dwalsh@redhat.com> 2.11y-26.selElliot Lee <sopwith@redhat.com> 2.11y-25Dan Walsh <dwalsh@redhat.com> 2.11y-24Elliot Lee <sopwith@redhat.com> 2.11y-22Elliot Lee <sopwith@redhat.com> 2.11y-20Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-17Elliot Lee <sopwith@redhat.com> 2.11y-16Elliot Lee <sopwith@redhat.com> 2.11y-15Matt Wilson <msw@redhat.com> 2.11y-14Jeremy Katz <katzj@redhat.com> 2.11y-13Jeremy Katz <katzj@redhat.com> 2.11y-12Phil Knirsch <pknirsch@redhat.com> 2.11y-11Elliot Lee <sopwith@redhat.com> 2.11y-10Elliot Lee <sopwith@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-8Yukihiro Nakai <ynakai@redhat.com> 2.11y-7Elliot Lee <sopwith@redhat.com> 2.11y-6Tim Waugh <twaugh@redhat.com> 2.11y-5Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11y-4Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11y-2Elliot Lee <sopwith@redhat.com> 2.11y-1Elliot Lee <sopwith@redhat.com> 2.11w-2Elliot Lee <sopwith@redhat.com> 2.11w-1Phil Knirsch <pknirsch@redhat.com> 2.11r-10hammer.3Elliot Lee <sopwith@redhat.com> 2.11r-10hammer.2Than Ngo <than@redhat.com> 2.11r-10hammer.1Bernhard Rosenkraenzer <bero@redhat.com> 2.11r-10hammerElliot Lee <sopwith@redhat.com> 2.11r-10Elliot Lee <sopwith@redhat.com> 2.11r-9Elliot Lee <sopwith@redhat.com> 2.11r-8Elliot Lee <sopwith@redhat.com> 2.11r-7Elliot Lee <sopwith@redhat.com> 2.11r-6Florian La Roche <Florian.LaRoche@redhat.de>Bill Nottingham <notting@redhat.com> 2.11r-4Trond Eivind Glomsrod <teg@redhat.com> 2.11r-3Elliot Lee <sopwith@redhat.com> 2.11r-2Elliot Lee <sopwith@redhat.com> 2.11r-1Elliot Lee <sopwith@redhat.com> 2.11n-19Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-17Trond Eivind Glomsrod <teg@redhat.com> 2.11n-16Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11n-14Florian La Roche <Florian.LaRoche@redhat.de>Elliot Lee <sopwith@redhat.com> 2.11n-12Elliot Lee <sopwith@redhat.com> 2.11n-11Elliot Lee <sopwith@redhat.com> 2.11n-10Elliot Lee <sopwith@redhat.com> 2.11n-9Elliot Lee <sopwith@redhat.com> 2.11n-8Elliot Lee <sopwith@redhat.com> 2.11n-7Elliot Lee <sopwith@redhat.com> 2.11n-6Elliot Lee <sopwith@redhat.com> 2.11n-5Bill Nottingham <notting@redhat.com> 2.11n-4Elliot Lee <sopwith@redhat.com> 2.11n-3Elliot Lee <sopwith@redhat.com> 2.11n-1Elliot Lee <sopwith@redhat.com> 2.11f-17Elliot Lee <sopwith@redhat.com> 2.11f-16Florian La Roche <Florian.LaRoche@redhat.de>Bernhard Rosenkraenzer <bero@redhat.com> 2.11f-14Elliot Lee <sopwith@redhat.com> 2.11f-13Bill Nottingham <notting@redhat.com>Erik Troan <ewt@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-10Elliot Lee <sopwith@redhat.com> 2.11f-9Tim Powers <timp@redhat.com>Elliot Lee <sopwith@redhat.com> 2.11f-7Bill Nottingham <notting@redhat.com>Florian La Roche <Florian.LaRoche@redhat�x�������������(������X���(
���������J'X�$7����������������'X(X&X��x��������������������X���(
���������������$T��������������������teg@redhat.com> 0.10.38-7Trond Eivind Glomsrød <teg@redhat.com> 0.10.38-6Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Florian La Roche <Florian.LaRoche@redhat.de>Nalin Dahyabhai <nalin@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Yukihiro Nakai <ynakai@redhat.com>Matt Wilson <msw@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Bill Nottingham <notting@redhat.com>Bill Nottingham <notting@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Prospector <bugzilla@redhat.com>Trond Eivind Glomsrød <teg@redhat.com>Preston Brown <pbrown@redhat.com>Bill Nottingham <notting@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com> Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Jeff Johnson <jbj@redhat.com>Cristian Gafton <gafton@redhat.com>Bill Nottingham <notting@redhat.com>Jeff Johnson <jbj@redhat.com>Jeff Johnson <jbj@redhat.com>Prospector System <bugs@redhat.com>Cristian Gafton <gafton@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Ported CI gating tests to Python 3.6- add CI gating tests- fix CVE-2018-18751: double-free in xgettext (rhbz#1647049)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- xgettext --its segfault fix (rhbz#1531476)- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Depend on the exact version of the library sub package- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- really remove Requires: git from gettext-devel (rhbz#1161284)
- make the BuildRequires unconditional (rhbz#1416691)- disable test-lock for 'gettext-tool' subdir too (rhbz#1406031)- Rebuild for Python 3.6- Subpackage msghack so that gettext doesn't depend on python
- name the new sub-package 'msghack'- devel subpackage to Require 'xz' (rhbz#1399270)- utilize %autosetup
- apply patch to fix po-send-mail when used with Emacs 25 (#1356642)- update to 0.19.8.1 release- update to 0.19.8 release- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- own .../gettext/its for third-party *.its files
- add a work around for test-isinf failure on ppc64le (#1297387)- apply patch to recognize .glade extension for GtkBuilder files (#1296653)- update to 0.19.7 release- update to 0.19.6 release- work around version conflict between gettextize and autopoint- update to 0.19.5.1 release- drop -el subpackage (#1234583)- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Rebuilt for GCC 5 C++11 ABI change- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- port msghack.py to Python 3 (#1192086)- remove git dependency from -devel subpackage (#1161284)- update to 0.19.4 release- Disable the test_lock test as it often hangs on a number of arches- update to 0.19.3 release
- remove patches included in 0.19.3
- remove autoconf/automake/libtool/bison from BR, as we don't do bootstrap- apply patch to fix infloop in autopoint (Closes: #1151238)
- apply patch to support newer ncurses in F-22- apply patch to fix C octal character escape handling (Closes: #1147535)- rebuild for libunistring soname bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- update to 0.19.2 release- apply patch to msghack.py, for Python 3 compatibility (Closes: #1113425,
  thanks to Bohuslav "Slavek" Kabrda)- update to 0.19.1 release
- switch to xz-compressed archive- Rebuilt for h�x�������������������X�s�(
��������������sd�$c����������������sdtdrd�3ssl.gzENGINE_set_default_ciphers.3ssl.gzENGINE_set_default_digests.3ssl.gzENGINE_set_default_string.3ssl.gzENGINE_set_destroy_function.3ssl.gzENGINE_set_digests.3ssl.gzENGINE_set_ex_data.3ssl.gzENGINE_set_finish_function.3ssl.gzENGINE_set_flags.3ssl.gzENGINE_set_id.3ssl.gzENGINE_set_init_function.3ssl.gzENGINE_set_load_privkey_function.3ssl.gzENGINE_set_load_pubkey_function.3ssl.gzENGINE_set_name.3ssl.gzENGINE_set_table_flags.3ssl.gzENGINE_unregister_DH.3ssl.gzENGINE_unregister_DSA.3ssl.gzENGINE_unregister_RAND.3ssl.gzENGINE_unregister_RSA.3ssl.gzENGINE_unregister_ciphers.3ssl.gzENGINE_unregister_digests.3ssl.gzENGINE_up_ref.3ssl.gzERR_FATAL_ERROR.3ssl.gzERR_GET_FUNC.3ssl.gzERR_GET_LIB.3ssl.gzERR_GET_REASON.3ssl.gzERR_PACK.3ssl.gzERR_add_error_data.3ssl.gzERR_add_error_vdata.3ssl.gzERR_clear_error.3ssl.gzERR_error_string.3ssl.gzERR_error_string_n.3ssl.gzERR_free_strings.3ssl.gzERR_func_error_string.3ssl.gzERR_get_error.3ssl.gzERR_get_error_line.3ssl.gzERR_get_error_line_data.3ssl.gzERR_get_next_error_library.3ssl.gzERR_lib_error_string.3ssl.gzERR_load_crypto_strings.3ssl.gzERR_load_strings.3ssl.gzERR_peek_error.3ssl.gzERR_peek_error_line.3ssl.gzERR_peek_error_line_data.3ssl.gzERR_peek_last_error.3ssl.gzERR_peek_last_error_line.3ssl.gzERR_peek_last_error_line_data.3ssl.gzERR_pop_to_mark.3ssl.gzERR_print_errors.3ssl.gzERR_print_errors_cb.3ssl.gzERR_print_errors_fp.3ssl.gzERR_put_error.3ssl.gzERR_reason_error_string.3ssl.gzERR_remove_state.3ssl.gzERR_remove_thread_state.3ssl.gzERR_set_mark.3ssl.gzESS_CERT_ID_dup.3ssl.gzESS_CERT_ID_free.3ssl.gzESS_CERT_ID_new.3ssl.gzESS_ISSUER_SERIAL_dup.3ssl.gzESS_ISSUER_SERIAL_free.3ssl.gzESS_ISSUER_SERIAL_new.3ssl.gzESS_SIGNING_CERT_dup.3ssl.gzESS_SIGNING_CERT_free.3ssl.gzESS_SIGNING_CERT_new.3ssl.gzEVP_BytesToKey.3ssl.gzEVP_CIPHER_CTX_block_size.3ssl.gzEVP_CIPHER_CTX_cipher.3ssl.gzEVP_CIPHER_CTX_ctrl.3ssl.gzEVP_CIPHER_CTX_flags.3ssl.gzEVP_CIPHER_CTX_free.3ssl.gzEVP_CIPHER_CTX_get_app_data.3ssl.gzEVP_CIPHER_CTX_get_cipher_data.3ssl.gzEVP_CIPHER_CTX_iv_length.3ssl.gzEVP_CIPHER_CTX_key_length.3ssl.gzEVP_CIPHER_CTX_mode.3ssl.gzEVP_CIPHER_CTX_new.3ssl.gzEVP_CIPHER_CTX_nid.3ssl.gzEVP_CIPHER_CTX_reset.3ssl.gzEVP_CIPHER_CTX_set_app_data.3ssl.gzEVP_CIPHER_CTX_set_cipher_data.3ssl.gzEVP_CIPHER_CTX_set_key_length.3ssl.gzEVP_CIPHER_CTX_set_padding.3ssl.gzEVP_CIPHER_CTX_type.3ssl.gzEVP_CIPHER_asn1_to_param.3ssl.gzEVP_CIPHER_block_size.3ssl.gzEVP_CIPHER_flags.3ssl.gzEVP_CIPHER_iv_length.3ssl.gzEVP_CIPHER_key_length.3ssl.gzEVP_CIPHER_meth_dup.3ssl.gzEVP_CIPHER_meth_free.3ssl.gzEVP_CIPHER_meth_get_cleanup.3ssl.gzEVP_CIPHER_meth_get_ctrl.3ssl.gzEVP_CIPHER_meth_get_do_cipher.3ssl.gzEVP_CIPHER_meth_get_get_asn1_params.3ssl.gzEVP_CIPHER_meth_get_init.3ssl.gzEVP_CIPHER_meth_get_set_asn1_params.3ssl.gzEVP_CIPHER_meth_new.3ssl.gzEVP_CIPHER_meth_set_cleanup.3ssl.gzEVP_CIPHER_meth_set_ctrl.3ssl.gzEVP_CIPHER_meth_set_do_cipher.3ssl.gzEVP_CIPHER_meth_set_flags.3ssl.gzEVP_CIPHER_meth_set_get_asn1_params.3ssl.gzEVP_CIPHER_meth_set_impl_ctx_size.3ssl.gzEVP_CIPHER_meth_set_init.3ssl.gzEVP_CIPHER_meth_set_iv_length.3ssl.gzEVP_CIPHER_meth_set_set_asn1_params.3ssl.gzEVP_CIPHER_mode.3ssl.gzEVP_CIPHER_nid.3ssl.gzEVP_CIPHER_param_to_asn1.3ssl.gzEVP_CIPHER_type.3ssl.gzEVP_CipherFinal.3ssl.gzEVP_CipherFinal_ex.3ssl.gzEVP_CipherInit.3ssl.gzEVP_CipherInit_ex.3ssl.gzEVP_CipherUpdate.3ssl.gzEVP_DecodeBlock.3ssl.gzEVP_DecodeFinal.3ssl.gzEVP_DecodeInit.3ssl.gzEVP_DecodeUpdate.3ssl.gzEVP_DecryptFinal.3ssl.gzEVP_DecryptFinal_ex.3ssl.gzEVP_DecryptInit.3ssl.gzEVP_DecryptInit_ex.3ssl.gzEVP_DecryptUpdate.3ssl.gzEVP_Digest.3ssl.gzEVP_DigestFinal.3ssl.gzEVP_DigestFinalXOF.3ssl.gzEVP_DigestFinal_ex.3ssl.gzEVP_DigestInit.3ssl.gzEVP_DigestInit_ex.3ssl.gzEVP_DigestSign.3ssl.gzEVP_DigestSignFinal.3ssl.gzEVP_DigestSignInit.3ssl.gzEVP_DigestSignUpdate.3ssl.gzEVP_DigestUpdate.3ssl.gzEVP_DigestVerify.3ssl.gzEVP_DigestVerifyFinal.3ssl.gzEVP_DigestVerifyInit.3ssl.gzEVP_DigestVerifyUpdate�x��������������������X��(
��������P�����V�$�����������������VVV�	

 !"##$%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&%&%&&&%!&&%%'%!&%%%%($�x��������������������X���(
��������Ⱦ����1��$!����������������1�2�0��ion- Do not distribute File::Spec::VMS (bug #973713)
- Remove bundled CPANPLUS-Dist-Build (bug #973041)- Update SystemTap scripts to recognize new phase__change marker and new probe
  arguments (bug #971094)
- Update h2ph(1) documentation (bug #948538)
- Update pod2html(1) documentation (bug #948538)
- Do not double-own archlib directory (bug #894195)- Move CPANPLUS-Dist-Build files from perl-CPANPLUS
- Move CPAN-Meta-Requirements files from CPAN-Meta
- Add perl-Scalar-List-Utils to perl-core dependencies- Require $Config{libs} providers (bug #905482)- Correct typo in perl-Storable file list (bug #966865)
- Remove bundled Storable (bug #966865)- Sub-package Storable (bug #966865)- Use lib64 directories on aarch64 architecture (bug #961900)- Make regular expression engine safe in a signal handler (bug #849703)
- Remove bundled ExtUtils-ParseXS, and Time-HiRes- Sub-package Time-HiRes (bug #957048)
- Remove bundled Getopt-Long, Locale-Maketext, and Sys-Syslog- Fix leaking tied hashes (bug #859910)
- Fix dead lock in PerlIO after fork from thread (bug #947444)
- Add proper conflicts to perl-Getopt-Long, perl-Locale-Maketext, and
  perl-Sys-Syslog- Sub-package Sys-Syslog (bug #950057)- Sub-package Getopt-Long (bug #948855)
- Sub-package Locale-Maketext (bug #948974)- Remove bundled constant, DB_File, Digest-MD5, Env, Exporter, File-Path,
  File-Temp, Module-Load, Log-Message-Simple, Pod-Simple, Test-Harness,
  Text-ParseWords- Filter provides from *.pl files (bug #924938)- Conflict perl-autodie with older perl (bug #911226)
- Sub-package Env (bug #924619)
- Sub-package Exporter (bug #924645)
- Sub-package File-Path (bug #924782)
- Sub-package File-Temp (bug #924822)- Sub-package constant (bug #924169)
- Sub-package DB_File (bug #924351)- Correct perl-Digest-MD5 dependencies
- Remove bundled Archive-Extract, File-Fetch, HTTP-Tiny,
  Module-Load-Conditional, Time-Local- Correct dependencies of perl-HTTP-Tiny
- Sub-package Time-Local (bug #922054)- 5.16.3 bump (see <http://search.cpan.org/dist/perl-5.16.3/pod/perldelta.pod>
  for release notes)
- Remove bundled autodie, B-Lint, CPANPLUS, Encode, File-CheckTree, IPC-Cmd,
  Params-Check, Text-Soundex, Thread-Queue- Fix CVE-2013-1667 (DoS in rehashing code) (bug #918008)- Sub-package autodie (bug #911226)
- Add NAME headings to CPAN modules (bug #908113)- Fix perl-Encode-devel dependency declaration- Sub-package Thread-Queue (bug #911062)- Sub-package File-CheckTree (bug #909144)
- Sub-package Text-ParseWords
- Sub-package Encode (bug #859149)- Remove bundled Log-Message
- Remove bundled Term-UI- Correct perl-podlators dependencies
- Obsolete perl-ExtUtils-Typemaps by perl-ExtUtils-ParseXS (bug #891952)- Sub-package Pod-Checker and Pod-Usage (bugs #907546, #907550)- Remove bundled PathTools- Sub-package B-Lint (bug #906015)- Sub-package Text-Soundex (bug #905889)
- Fix conflict declaration at perl-Pod-LaTeX (bug #904085)
- Remove bundled Module-Pluggable (bug #903624)- Run-require POD convertors by Module-Build and ExtUtils-MakeMaker to
  generate documentation when building other packages- Sub-package Pod-LaTeX (bug #904085)- Remove bundled Pod-Parser- Fix CVE-2012-6329 (misparsing of maketext strings) (bug #884354)- Do not package App::Cpan(3pm) to perl-Test-Harness (bug #893768)- Remove bundled Archive-Tar
- Remove bundled CPAN-Meta-YAML
- Remove bundled Module-Metadata- Remove bundled Filter modules- 5.16.2 bump (see
  http://search.cpan.org/dist/perl-5.16.1/pod/perldelta.pod for release
  notes)- Remove bundled podlators (bug #856516)- Do not crash when vivifying $| (bug #865296)- Conflict perl-podlators with perl before sub-packaging (bug #856516)- Do not leak with attribute on my variable (bug #858966)
- Allow operator after numeric keyword argument (bug #859328)
- Extend stack in File::Glob::glob (bug #859332)- Put perl-podlators into perl-core list (bug #856516)- Remove bundled perl-ExtUtils-Manifest
- perl-PathTools uses Carp- Override the Pod::Simple::parse_file to set output to STDOUT by default
  (b�x�������������p������X��(
��������p�����;��$+����������������;�<�:��M=i�M�M�L�L�7�L��@L��@L��@L�d�L�@L��@L��@L�{�L�A@L�)@L�)@L�)@L�)@Lk�@LMx�L>�@L9�@L7@L5��L(��L�K��K�.�Kы�KŮ@KŮ@K�"@K�r�K�!@K��@K��@K��@K��Kl@K0��K/c@K+n�K+n�K�@K�@K�@K�@KV�K@K��K�Ję�Ję�J��@J�u@J���J��@Jr�Jn�@Jm��Jj�JW-@JS8�JS8�J,�@J'�@J&e�I�4�I�@@I�@@I̿�I��@I�y�I���I���I�V@I��@I�U@I�U@I�w�I�1�Itk@IO�@IBR@I/�@I*�@Ig@H��H�O@H�f@H�f@H��@Hϟ�H�@H��H�@�H���H�z@Hu��Ht�@Hl�@Hj@Hd�@H`�HO�@HNl�HI&�H:�@H5`@H1k�H.�G߮�G߮�G߮�G߮�G߮�G��G��G��G�.@G�.@G�.@G�.@G�.@G��@G��G�f�G�f�G��G��@G�e�GN��Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-423Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-422Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-421Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-420Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-419Petr Pisar <ppisar@redhat.com> - 4:5.26.3-418Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-417Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.3-416Petr Pisar <ppisar@redhat.com> - 4:5.26.2-415Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-414Petr Pisar <ppisar@redhat.com> - 4:5.26.2-413Petr Pisar <ppisar@redhat.com> - 4:5.26.2-412Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.2-411Petr Pisar <ppisar@redhat.com> - 4:5.26.2-410Florian Weimer <fweimer@redhat.com> - 4:5.26.1-409Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.1-408Petr Pisar <ppisar@redhat.com> - 4:5.26.1-407Petr Pisar <ppisar@redhat.com> - 4:5.26.1-406Petr Pisar <ppisar@redhat.com> - 4:5.26.1-405Björn Esser <besser82@fedoraproject.org> - 4:5.26.1-404Petr Pisar <ppisar@redhat.com> - 4:5.26.1-403Petr Pisar <ppisar@redhat.com> - 4:5.26.1-402Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-401Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.1-400Petr Pisar <ppisar@redhat.com> - 4:5.26.0-399Petr Pisar <ppisar@redhat.com> - 4:5.26.0-398Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 4:5.26.0-397Fedora Release Engineering <releng@fedoraproject.org> - 4:5.26.0-396Petr Pisar <ppisar@redhat.com> - 4:5.26.0-395Petr Pisar <ppisar@redhat.com> - 4:5.26.0-394Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-393Jitka Plesnikova <jplesnik@redhat.com> - 4:5.26.0-392Petr Pisar <ppisar@redhat.com> - 4:5.24.1-391Petr Pisar <ppisar@redhat.com> - 4:5.24.1-390Petr Pisar <ppisar@redhat.com> - 4:5.24.1-389Petr Pisar <ppisar@redhat.com> - 4:5.24.1-388Petr Pisar <ppisar@redhat.com> - 4:5.24.1-387Petr Pisar <ppisar@redhat.com> - 4:5.24.1-386Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.1-385Igor Gnatenko <ignatenko@redhat.com> - 4:5.24.0-384Petr Pisar <ppisar@redhat.com> - 4:5.24.0-383Petr Pisar <ppisar@redhat.com> - 4:5.24.0-382Petr Pisar <ppisar@redhat.com> - 4:5.24.0-381Petr Pisar <ppisar@redhat.com> - 4:5.24.0-380Petr Pisar <ppisar@redhat.com> - 4:5.24.0-379Petr Pisar <ppisar@redhat.com> - 4:5.24.0-378Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-377Petr Pisar <ppisar@redhat.com> - 4:5.24.0-376Petr Pisar <ppisar@redhat.com> - 4:5.24.0-375Petr Pisar <ppisar@redhat.com> - 4:5.24.0-374Petr Pisar <ppisar@redhat.com> - 4:5.24.0-373Petr Pisar <ppisar@redhat.com> - 4:5.24.0-372Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-371Petr Pisar <ppisar@redhat.com> - 4:5.24.0-370Petr Pisar <ppisar@redhat.com> - 4:5.24.0-369Petr Pisar <ppisar@redhat.com> - 4:5.24.0-368Petr Pisar <ppisar@redhat.com> - 4:5.24.0-367Petr Pisar <ppisar@redhat.com> - 4:5.24.0-366Petr Pisar <ppisar@redhat.com> - 4:5.24.0-365Petr Pisar <ppisar@redhat.com> - 4:5.24.0-364Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-363Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-362Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.6-361Petr Pisar <ppisar@redhat.com> - 4:5.22.1-360Petr Pisar <ppisar@redhat.com> - 4:5.22.1-359Petr Pisar <ppisar@redhat.com> - 4:5.22.1-358Petr Pisar <ppisar@redhat.com> - 4:5.22.1-357Fedora Release Engineering <releng@fedoraproject.org> - 4:5.22.1-356Petr Pisar <ppisar@redhat.com> - 4:5.22.1-355Jitka Plesnikova <jplesnik@redhat.com> - 5.22.1-354Petr Pisar <ppisar@redhat.com> - 4:5.22.0-353Petr Pisar <pp�x�������������������X��(
`�������������>��$.����������������>�?�=��rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-5.26.3-423.el8_10.src.rpm���������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������`�����X�0�(
���������������$a��������������������645b3e3c1c9b58787bbd2ff0b6bab9cf837d120c39c0ef461950449605b81dfe645b3e3c1c9b58787bbd2ffed6c3c8aeea7a1e8436494564e7e4881c7a66b708bc6d4855fb809c2e036c1a0ed6c3c8aeea7a1e8436494564e7e4881c7a66b708bc6d4855fb809c2e036c1a09ba0f9fe060ee12e4f24f23373f9c8efa2d3b302fbf49d7601b69d8d0936d5ac9ba0f9fe060ee12e4f24f23373f9c8efa2d3b302fbf49d7601b69d8d0936d5ac6daf34fdecdab7b8b84a3504e888ca1853fa90b2b3d364d66acfe50c40643a326daf34fdecdab7b8b84a3504e888ca1853fa90b2b3d364d66acfe50c40643a3216d23f3f4c6f903cb7e50cac757c0b5a089f094205d26ffdf1414e6739ade7219a44a80444d55503b74aacf78675b72e63c93d847dd7b29163db734c5dcf1b01bad824e15e937614048a08378899be22bec4a125211f109ad09849bfd48cb77fbad824e15e937614048a08378899be22bec4a125211f109ad09849bfd48cb77f4908021553c4cae8faee46203176b18d56408010555486d9f4a2ce806e9b8e424908021553c4cae8faee46203176b18d56408010555486d9f4a2ce806e9b8e424b56ceba8cc52357fdf80fa1ba7397d7ddd80059741b8a8ccd075ee8768b971a4b56ceba8cc52357fdf80fa1ba7397d7ddd80059741b8a8ccd075ee8768b971a540db21aa3a3d04d9691c1a300c0d1c58b635a5448258aead58df56de61f1adf540db21aa3a3d04d9691c1a300c0d1c58b635a5448258aead58df56de61f1adff2ccdfcb9086de3e20d481b91868b68af900c98b54350df6fa093098d2b16d8af2ccdfcb9086de3e20d481b91868b68af900c98b54350df6fa093098d2b16d8ae70d792ca99367431c46e2fcb692de77622fa7e7019aa6cf6abaf9016f0c58b2e70d792ca99367431c46e2fcb692de77622fa7e7019aa6cf6abaf9016f0c58b2c4bf2012dedcc6be0a5c471bae9662e6e4ff878dba7463f13a84496d54720d25c4bf2012dedcc6be0a5c471bae9662e6e4ff878dba7463f13a84496d54720d252248e7b7d772541ca5bdbcb9ca7ee6732084a240ffc185ec2dff2f3f88a3be3e2248e7b7d772541ca5bdbcb9ca7ee6732084a240ffc185ec2dff2f3f88a3be3e487f4d3d406516ec236c1e050dc858da8141bcfc562578f47046f7a7daef444758c3ccffb405769a54318b47f40e3ca364c8bff5b5bc090c514d081c977ef363659c68c65487abeeb89ce7a54af352f5c09e7479d9e8cccbc334cc0c20306629659c68c65487abeeb89ce7a54af352f5c09e7479d9e8cccbc334cc0c203066294073256ac8650b90cce35bcf150f8732dceaeae95b279b2ec6773c8fcd5803a54073256ac8650b90cce35bcf150f8732dceaeae95b279b2ec6773c8fcd5803a59f288e3b08be9599801049616da1d8bc0b8905122593caeb74e8612dceb996b69f288e3b08be9599801049616da1d8bc0b8905122593caeb74e8612dceb996b6b3c2c208f3be44cfffccf1caabfa436e8f30a3ca1675cca2320e56677e677f48b3c2c208f3be44cfffccf1caabfa436e8f30a3ca1675cca2320e56677e677f483845409d62c0439be0f71bf953ef57f99721976d8b39628eaa71c7eab482b4373845409d62c0439be0f71bf953ef57f99721976d8b39628eaa71c7eab482b437fe4aab441bb4924eb430ad1b500ce4257841581715295ed71fccb195bdf44d38fe4aab441bb4924eb430ad1b500ce4257841581715295ed71fccb195bdf44d38dfafe4a3af10cafa80b12cc23e96bb52958baa9aad9e0ac0ef126809f10e32bedfafe4a3af10cafa80b12cc23e96bb52958baa9aad9e0ac0ef126809f10e32be76b3b62779cba677e72c927ed5183e1eda0269337e55eefb155a3515c29b4cc376b3b62779cba677e72c927ed5183e1eda0269337e55eefb155a3515c29b4cc358e1539b007f35f35842b37f09e480063af819fcc644753edf3a72b3bf5bca8058e1539b007f35f35842b37f09e480063af819fcc644753edf3a72b3bf5bca8035c7e6e80cfe84b2707cb65dcb1168451efb96171813916a045e3e82da988d5635c7e6e80cfe84b2707cb65dcb1168451efb96171813916a045e3e82da988d56cbdfb6e2273101bd054786a0494798427933b3a31976c59c8b9de432bcf249282f3c70c4402636db710242956317a29fcbddc1222086513ac57d3caacd09f20dcedc3dadf0d346d4fde8d2d1a2ab4d82c230dc1ad6f8773caa34a68093ade5ee0845595cc91bd470112cba824875fb4d5618e420b0dd8bfac44d9955e83712012dc7f8fa9b93ed5bb1f6822f89bfb09bcebb20a2b876cfa32ffdf7d7c1cf932825bfd2785eb89ba7adaff5f0b0251ec40af977b335f54ffdeb53a4c264919c53625ca5cafc376bc725d15a07fd56dee1a87c48f83a3e3d4fa3df65b9e1dd9ac5639ddcd320889ac68253359ac476289b14534344519ab9e3cd7254477076ccaf639ddcd320889ac68253359ac476289b14534344519ab9e3cd7254477076ccafa6e8237ec34811c02f8609aeed18035438c8cbf000e1f01434c922d18ce33e66a6e8237ec34811c02f8609aeed18035438c8cbf000e1f01434c922d18ce33e66eb2a341033112ce03446a6427454204b7a7f0bd04bada63b1280e46729a09b72eb2a341033112ce03446a6427454204b7a7f0bd04bada63b1280e46729a09b729f7034181504367d03db71464f570c5452a14651042a849a7e3e27526bf8875743b55ecc3393fe7236882aee6737a5807cf5cdac5d6bb4971b2258f8bb2ff1f7c318b061a25e12�x��������������n�����X�z�(
�H�������������ld�$|����������������ldmdkd�RSAPublicKey.3ssl.gzPEM_read_bio_RSA_PUBKEY.3ssl.gzPEM_read_bio_SSL_SESSION.3ssl.gzPEM_read_bio_X509.3ssl.gzPEM_read_bio_X509_AUX.3ssl.gzPEM_read_bio_X509_CRL.3ssl.gzPEM_read_bio_X509_REQ.3ssl.gzPEM_read_bio_ex.3ssl.gzPEM_write.3ssl.gzPEM_write_CMS.3ssl.gzPEM_write_DHparams.3ssl.gzPEM_write_DHxparams.3ssl.gzPEM_write_DSAPrivateKey.3ssl.gzPEM_write_DSA_PUBKEY.3ssl.gzPEM_write_DSAparams.3ssl.gzPEM_write_ECPKParameters.3ssl.gzPEM_write_ECPrivateKey.3ssl.gzPEM_write_EC_PUBKEY.3ssl.gzPEM_write_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_write_PKCS7.3ssl.gzPEM_write_PKCS8.3ssl.gzPEM_write_PKCS8PrivateKey.3ssl.gzPEM_write_PKCS8PrivateKey_nid.3ssl.gzPEM_write_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_write_PUBKEY.3ssl.gzPEM_write_PrivateKey.3ssl.gzPEM_write_RSAPrivateKey.3ssl.gzPEM_write_RSAPublicKey.3ssl.gzPEM_write_RSA_PUBKEY.3ssl.gzPEM_write_SSL_SESSION.3ssl.gzPEM_write_X509.3ssl.gzPEM_write_X509_AUX.3ssl.gzPEM_write_X509_CRL.3ssl.gzPEM_write_X509_REQ.3ssl.gzPEM_write_X509_REQ_NEW.3ssl.gzPEM_write_bio.3ssl.gzPEM_write_bio_CMS.3ssl.gzPEM_write_bio_CMS_stream.3ssl.gzPEM_write_bio_DHparams.3ssl.gzPEM_write_bio_DHxparams.3ssl.gzPEM_write_bio_DSAPrivateKey.3ssl.gzPEM_write_bio_DSA_PUBKEY.3ssl.gzPEM_write_bio_DSAparams.3ssl.gzPEM_write_bio_ECPKParameters.3ssl.gzPEM_write_bio_ECPrivateKey.3ssl.gzPEM_write_bio_EC_PUBKEY.3ssl.gzPEM_write_bio_NETSCAPE_CERT_SEQUENCE.3ssl.gzPEM_write_bio_PKCS7.3ssl.gzPEM_write_bio_PKCS7_stream.3ssl.gzPEM_write_bio_PKCS8.3ssl.gzPEM_write_bio_PKCS8PrivateKey.3ssl.gzPEM_write_bio_PKCS8PrivateKey_nid.3ssl.gzPEM_write_bio_PKCS8_PRIV_KEY_INFO.3ssl.gzPEM_write_bio_PUBKEY.3ssl.gzPEM_write_bio_Parameters.3ssl.gzPEM_write_bio_PrivateKey.3ssl.gzPEM_write_bio_PrivateKey_traditional.3ssl.gzPEM_write_bio_RSAPrivateKey.3ssl.gzPEM_write_bio_RSAPublicKey.3ssl.gzPEM_write_bio_RSA_PUBKEY.3ssl.gzPEM_write_bio_SSL_SESSION.3ssl.gzPEM_write_bio_X509.3ssl.gzPEM_write_bio_X509_AUX.3ssl.gzPEM_write_bio_X509_CRL.3ssl.gzPEM_write_bio_X509_REQ.3ssl.gzPEM_write_bio_X509_REQ_NEW.3ssl.gzPKCS12_BAGS_free.3ssl.gzPKCS12_BAGS_new.3ssl.gzPKCS12_MAC_DATA_free.3ssl.gzPKCS12_MAC_DATA_new.3ssl.gzPKCS12_SAFEBAG_free.3ssl.gzPKCS12_SAFEBAG_new.3ssl.gzPKCS12_create.3ssl.gzPKCS12_free.3ssl.gzPKCS12_new.3ssl.gzPKCS12_newpass.3ssl.gzPKCS12_parse.3ssl.gzPKCS5_PBKDF2_HMAC.3ssl.gzPKCS5_PBKDF2_HMAC_SHA1.3ssl.gzPKCS7_DIGEST_free.3ssl.gzPKCS7_DIGEST_new.3ssl.gzPKCS7_ENCRYPT_free.3ssl.gzPKCS7_ENCRYPT_new.3ssl.gzPKCS7_ENC_CONTENT_free.3ssl.gzPKCS7_ENC_CONTENT_new.3ssl.gzPKCS7_ENVELOPE_free.3ssl.gzPKCS7_ENVELOPE_new.3ssl.gzPKCS7_ISSUER_AND_SERIAL_digest.3ssl.gzPKCS7_ISSUER_AND_SERIAL_free.3ssl.gzPKCS7_ISSUER_AND_SERIAL_new.3ssl.gzPKCS7_RECIP_INFO_free.3ssl.gzPKCS7_RECIP_INFO_new.3ssl.gzPKCS7_SIGNED_free.3ssl.gzPKCS7_SIGNED_new.3ssl.gzPKCS7_SIGNER_INFO_free.3ssl.gzPKCS7_SIGNER_INFO_new.3ssl.gzPKCS7_SIGN_ENVELOPE_free.3ssl.gzPKCS7_SIGN_ENVELOPE_new.3ssl.gzPKCS7_decrypt.3ssl.gzPKCS7_dup.3ssl.gzPKCS7_encrypt.3ssl.gzPKCS7_free.3ssl.gzPKCS7_get0_signers.3ssl.gzPKCS7_new.3ssl.gzPKCS7_print_ctx.3ssl.gzPKCS7_sign.3ssl.gzPKCS7_sign_add_signer.3ssl.gzPKCS7_verify.3ssl.gzPKCS8_PRIV_KEY_INFO_free.3ssl.gzPKCS8_PRIV_KEY_INFO_new.3ssl.gzPKEY_USAGE_PERIOD_free.3ssl.gzPKEY_USAGE_PERIOD_new.3ssl.gzPOLICYINFO_free.3ssl.gzPOLICYINFO_new.3ssl.gzPOLICYQUALINFO_free.3ssl.gzPOLICYQUALINFO_new.3ssl.gzPOLICY_CONSTRAINTS_free.3ssl.gzPOLICY_CONSTRAINTS_new.3ssl.gzPOLICY_MAPPING_free.3ssl.gzPOLICY_MAPPING_new.3ssl.gzPROFESSION_INFO.3ssl.gzPROFESSION_INFOS.3ssl.gzPROFESSION_INFOS_free.3ssl.gzPROFESSION_INFOS_new.3ssl.gzPROFESSION_INFO_free.3ssl.gzPROFESSION_INFO_get0_addProfessionInfo.3ssl.gzPROFESSION_INFO_get0_namingAuthority.3ssl.gzPROFESSION_INFO_get0_professionItems.3ssl.gzPROFESSION_INFO_get0_professionOIDs.3ssl.gzPROFESSION_INFO_get0_registrationNumber.3ssl.gzPROFESSION_INFO_new.3ssl.gzPROFESSION_INFO_set0_addProfessionInfo.3ssl.gzPROFESSION_INFO_set0_namingAuthority.3ssl.gzPROFESSION_INFO_set0_professionItems.3ssl.gzPROFESSION_INFO_set0_professio�x������'������^�����XJ"�(
p��������i�����$����������������f	ject.org/wiki/Fedora_23_Mass_Rebuild- Initial packaginglibgudev1	
�232-4.el8232-4.el8232-4.el8230.build-id52c849e12c494a8dac70606a8736615605e9811bGUdev-1.0.typeliblibgudev-1.0.so.0libgudev-1.0.so.0.2.0libgudevNEWSlibgudevCOPYING/usr/lib//usr/lib/.build-id//usr/lib/.build-id/52//usr/lib64/girepository-1.0//usr/lib64//usr/share/doc//usr/share/doc/libgudev//usr/share/licenses//usr/share/licenses/libgudev/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=52c849e12c494a8dac70606a8736615605e9811b, strippedASCII textPRRRRRRRRRRutf-8624e0113211666fbc69bfeb241c6cad7938b5328fc38c6be0a885a0958dbb750?���o��`�
	Q�d~���A��G��H �

�����5-��'��3ۭZ@p@��+���O�J��b70����2�Y$��j���i�!'̄��oʲ�:������n� r1
SB"�+�Cr���H�b[�oۧ��}��i�Z�W)�MF�G�S�������EQ�1�;4�Υ;��YJw�5�<{�<R��N�,��i�P��h����|y�S3�CH>��h���#l��W@������Ѷ�e���gu
FKĽT�"oY`*h�4�2"��[��+e��0��=x�g��ZIyBʄx�\g:n�b��o��cI(��Y��={��,��&�x9�6Nh� ��
i�Z%q�i��jwbY��X���~9F��U0�2Gt�T��H]F=�ZC�� �1���i���&J2�$�ˉ�`�
	Q�d~���w�_���������Mͽ;��Kv�Ț,�Rt��d[�]a;}��ɵ�V��V�������u���5��z�yQ�)�v�Q�u&�c�+y���ED���1��'N��|���3T�.	��I� |�qd�D�(x1�U.r;�%�I`���D��0)��S�皜j�C�㺔���"�ޝ� !��ו��`��y����Q*�Ӣ����
�qtHݷ�\��>��k�8�^ f�6Wf�*M�$[i|�<F�WE�d<�e1��?}3���v�W�w\5����::�C�2Ȟղ{����;��*lԧ¡.�^G�ܙC��dm��sh�� �%���MiCI�灎mVP
�S0����Y��D,��|���3b5802e28fd144f2a5c96e2ddcf5c45d42b17f3af6d7052d2e98ce4afc158800a2648725790b8bc117b6adaced3c013e6d9e75b7fX�0C�fX�bhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Matt Wilson <msw@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Prospector <bugzilla@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Preston Brown <pbrown@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Bill Nottingham <notting@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Elliot Lee <sopwith@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Nalin Dahyabhai <nalin@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Cristian Gafton <gafton@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <johnsonm@redhat.com>Michael K. Johnson <jo�x��������������M�����X���(
�`���������������W�$l�����������������W�W�W�eam
- mark localized man pages with %lang- 3 patches merged upstream
- removed 2digit.patch (#718610)
- removed fgets.patch (probably not needed anymore)- next 11 patches merged upstream
- removed bcast.patch (seems to be fixed upstream)
- removed netstat-p-basename.patch (upstream is not happy with it)
- netstat-leak.patch merged into duplicate-tcp.patch- removed virtualname.patch
- added back isofix.patch
- improved mii-registers.patch- upstream git snapshot
- reduced number of patches from 95 to 32
- netstat -T/--notrim option is now -W/--wide- Removed HFI support.
- Improved num-ports.patch- Merge all upstream fixes into net-tools-1.60-upstream.patch- Upstream is migrating to Sourceforge.- Fixed ether-wake(8) and mii-diag(8) man pages (#742629)- Improved arp-ethers.service unit file (#735617)- Improved netstat_stop_trim.patch to not truncate IPV6 UDP sockets (#732984)- Update for 2 digit Linux version numbers (#718610)- Added arp-ethers.service systemd unit file to run 'arp -f /etc/ethers'
  on startup of system. Don't ship default /etc/ethers (#713759)- Do not mention /proc/net/socket in ifconfig(8) (#661905)
- Merge all 'man page only fix' patches into net-tools-1.60-man.patch- Fix possible problems found by static analysis of code.- patch netstat to separate basename of -p only if it is absolute
  path (in order to make argv[0]="sshd pty/0" display as sshd, and not as /0).- plipconfig man page and usage output fixes. (#694766)- Fix mii-tool/mii-diag/ether-wake to not default to eth0 because
  since Fedora 15 network devices can have arbitrary names (#682367)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Improve scanf-format.patch (#668047)- Improve route(8) man page saying that 'route mss' actually sets MTU (#671321)- Fix the handling of some of the HAVE_* flags ifdef vs if. (BerliOS #17812)- fixed mii-diag(8) man page (#663689)
- fixed route(8) man page (#664171)- fixed ifconfig(8) man page (#663469)- improved netstat(8) man page (#614931)- added netstat(8) support for RcvbufErrors, SndbufErrors (BerliOS #17645)- Rebuilt for gcc bug 634757- HFI support- fixed memory leak in netstat when run with -c option- improved statistics-doubleword.patch (Bug #579854)- updated mii-tool to support gigabit links (#539575)- fixed statistics.c to use unsigned long long (instead of int) to handle 64 bit integers (Bug #579854, Debian #561161)
- fixed typo in statistics.c (Bug #579855)- fixed overflow patch (#551625)
- ifconfig interface:0 del <IP> will remove the Aliased IP on IA64 (#473211)
- interface slip: cast keepalive/outfill to unsigned long to fix warnings on 64bit hosts -- no functional changes since these only have an 8bit range anyways
- interface: fix IPv6 parsing of interfaces with large indexes (> 255) (Debian #433543)- Move hostname to separate package- return defining of BuildRoot even it's no longer necessary
  (https://fedoraproject.org/wiki/Packaging:Guidelines#BuildRoot_tag)
  to silent rpmlint false warning- in mii-tool.c use <linux/mii.h> instead of "mii.h" and fix Bug #491358- Make "hostname -s" display host name cut at the first dot (no
  matter if the host name resolves or not) (bug #531702)- netplug moved to separate package
- #319981 and #322901 - minor man pages changes
- applied changes from berlios cvs, which fix: Berlios #16232, Gentoo #283759 and polish Makefile and slattach- netstat - avoid name resolution for listening or established sockets (-l) by return fast. 
- netstat - --continuous should flush stdout
- added missing man pages (iptunnel, ipmaddr, netplug, netplug.d, netplugd.conf)
- added note about obsolete commands to existing man pages 
- let the user know that ifconfig can correctly show only first 8 bytes of Infiniband hw address- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- scanf format length fix (non exploitable?) from Fabian Hugelshofer <hugelshofer2006@gmx.ch>
- URL tag changed to http://net-tools.berlios.de/- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebui�x�������������@=�����X�ߚ(
��������Hcv��$f����������������v�u�w��Sella <nsella@redhat.com> - 4.4.2-8Nicola Sella <nsella@redhat.com> - 4.4.2-7Nicola Sella <nsella@redhat.com> - 4.4.2-6Nicola Sella <nsella@redhat.com> - 4.4.2-5Nicola Sella <nsella@redhat.com> - 4.4.2-4Nicola Sella <nsella@redhat.com> - 4.4.2-3Nicola Sella <nsella@redhat.com> - 4.4.2-2Nicola Sella <nsella@redhat.com> - 4.4.2-1Marek Blaha <mblaha@redhat.com> - 4.2.23-4Nicola Sella <nsella@redhat.com> - 4.2.23-3Ales Matej <amatej@redhat.com> - 4.2.23-2Nicola Sella <nsella@redhat.com> - 4.2.23-1Ales Matej <amatej@redhat.com> - 4.2.21-1Ales Matej <amatej@redhat.com> - 4.2.17-6Marek Blaha <mblaha@redhat.com> - 4.2.17-5Ales Matej <amatej@redhat.com> - 4.2.17-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.17-3Ales Matej <amatej@redhat.com> - 4.2.17-2Ales Matej <amatej@redhat.com> - 4.2.16-1Ales Matej <amatej@redhat.com> - 4.2.11-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-7Jaroslav Mracek <jmracek@redhat.com> - 4.2.7-6Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-5Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-3Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-2Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.7-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.2.6-1Pavla Kratochvilova <pkratoch@redhat.com> - 4.0.9.2-6Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-5Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-4Pavla Kratochvilova <pkratoch@redhat.com> - 4.0.9.2-3Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-2Jaroslav Mracek <jmracek@redhat.com> - 4.0.9.2-1Daniel Mach <dmach@redhat.com> - 4.0.9.1-1Jaroslav Mracek <jmracek@redhat.com> - 4.0.9-1Jaroslav Mracek <jmracek@redhat.com> - 4.0.4-2Jaroslav Mracek <jmracek@redhat.com> - 4.0.4-1Jaroslav Mracek <jmracek@redhat.com> - 3.6.1-1Jaroslav Mracek <jmracek@redhat.com> - 3.5.1-1Jaroslav Mracek <jmracek@redhat.com> - 3.5.0-1Daniel Mach <dmach@redhat.com> - 3.4.0-1Daniel Mach <dmach@redhat.com> - 3.3.0-1Daniel Mach <dmach@redhat.com> - 3.2.0-1Daniel Mach <dmach@redhat.com> - 3.1.0-1Daniel Mach <dmach@redhat.com> - 3.0.4-1Martin Hatina <mhatina@redhat.com> - 3.0.3-1Jaroslav Mracek <jmracek@redhat.com> - 3.0.2-1Jaroslav Mracek <jmracek@redhat.com> - 3.0.1-1Igor Gnatenko <ignatenko@redhat.com> - 2.7.5-1Jaroslav Mracek <jmracek@redhat.com> - 2.7.4-1Igor Gnatenko <ignatenko@redhat.com> - 2.7.3-1Jaroslav Mracek <jmracek@redhat.com> - 2.7.2-1Jaroslav Mracek <jmracek@redhat.com> 2.6.3-1Jaroslav Mracek <jmracek@redhat.com> 2.6.2-1Jaroslav Mracek <jmracek@redhat.com> 2.5.1-1Jaroslav Mracek <jmracek@redhat.com> 2.5.0-1Jaroslav Mracek <jmracek@redhat.com> 2.4.1-1Jaroslav Mracek <jmracek@redhat.com> 2.4.0-1Jaroslav Mracek <jmracek@redhat.com> 2.3.0-1Jaroslav Mracek <jmracek@redhat.com> 2.2.0-1Jaroslav Mracek <jmracek@redhat.com> 2.1.1-1Jaroslav Mracek <jmracek@redhat.com> 2.1.0-1Jaroslav Mracek <jmracek@redhat.com> 2.0.1-1Michal Luscon <mluscon@redhat.com> 2.0.0-1Martin Hatina <mhatina@redhat.com> 2.0.0-0.rc2.1Michal Luscon <mluscon@redhat.com> 2.0.0-0.rc1.1Igor Gnatenko <ignatenko@redhat.com> - 1.1.10-2Igor Gnatenko <ignatenko@redhat.com> - 1.1.10-1Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-6Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-5Igor Gnatenko <ignatenko@redhat.com> - 1.1.9-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 1.1.9-3Michal Luscon <mluscon@redhat.com> 1.1.9-2Igor Gnatenko <ignatenko@redhat.com> 1.1.9-1Michal Luscon <mluscon@redhat.com> 1.1.8-1Michal Luscon <mluscon@redhat.com> 1.1.7-1Michal Luscon <mluscon@redhat.com> 1.1.6-1Michal Luscon <mluscon@redhat.com> 1.1.5-1Michal Luscon <mluscon@redhat.com> 1.1.4-1Michal Luscon <mluscon@redhat.com> 1.1.3-1Michal Luscon <mluscon@redhat.com> 1.1.2-4Michal Luscon <mluscon@redhat.com> 1.1.2-3Michal Luscon <mluscon@redhat.com> 1.1.2-2Michal Luscon <mluscon@redhat.com> 1.1.2-1Michal Luscon <mluscon@redhat.com> 1.1.1-2Michal Luscon <mluscon@redhat.com> 1.1.1-1Michal Luscon <mluscon@redhat.com> 1.1.0-2Michal Luscon <mluscon@redhat.com> 1.1.0-1Michal�x��������������,�����X��(
�G����J��$Z����������������J�K�I��3daac36c131dfe1039e38f5e6b782e0dda408473646d485cc9bfda4a8a359ad6437ffc64d21a02b18a8cbfee8f4dc280d6fac3184f669c8b37503ac57abd480ed1f3f92cc731739a60ca1adecd33d40d80c31a8b11a5ad2df01f711d0a23103f690922659bf0a25d4b247f1edb61617dd60690988435839d835d99881bd160620d6a6d06705cbbc42a513d5f9ceea3e6314cd2684a247a8e19526490bd7e47ef00902a425e78e156a08391e4a668daf5d169bba86f2ba7d830248daf003b03a384307a71e240635d14bfe4d0aad1be4482fd168f4116b621698ec7c170bcbe25992bdc488c2b3ebb31e220ce6f3600751af0229d14afbdc12d2acaee4919b62bdcdcbd65361ee06015ac0e9aa1ca49c6276a80c246e9cbc072d9c95a3704f590746a22d97280b296259747356efeae437a1cb985e0bc8b128593480e3e36954d66d7941d76a90954b90428051aba3be631ba5a6e516acd06f2314847f59179aa5f4219b730c9bf269f5c6e615d9acf1ea4e5b1ab2c5c1d82ea8751691eb8a8d7abd2e727635a9db44d37cdf24eec593609a49ed64d643eee6b538844c724bda063ad1b70874d6edf8d44fd95c935f648101c47e4e989a7c09c473df0abe2929842c7490a670482308deec88ceed8b31cd47bd406ac0a6b1fb45476e6b2bb9cbe695eee63d9b2f6d480811c71a96e7f696d6b20a13181018a6cf3fefed34498746ad7b2a9ff787106abb53437944c2c7cfb17b71d38bc3dacaae2b6dbfea230733eec153fcf0aed18d8f5c0ca2f876cba53bf11aa7e1656dcc701ad0b9f38b49cbf6c6faa49067ac891bf3df9faea8110eeda14035b186f47ffa95ba4cec8a60f9f8cb40cd7a7c7f9d67ddbe09f67fd36cf00c3a1ee9ab190bef54f83adb2e5e4452eabd4d449e038154160e9df40d312439b80d657201033cd872fe5c2347d51467fb4db94bdd79d936039d7644335e47e82b0685f10e614f7aa0fc1892062d8239c0357ee52613823527519cab7da4fb18cd651240040db949813c3a8e861afc376adc9b569de953c2bd72008feb5243b2b3fb94f05446b7fd4a30be8d4fc6c24a4a9872c92f78e93896389e547c74ca697f35986583e17e905fdbee6d31aa8f09f4644a9748a51a5ae6baa438a97cf8e1bbc32b7dab1b2c69b6162d0998095087499e9619b39e18f00a206ca57d321c785326a8d360260472517e5d7fc27ad6dd2d03a0d4388e41a4d704fb9f506a387dc05a51c07f51d8106970b9706831e3475fa9f7957f6e78bdd211153fc6546f3c0a10b20ff1c6270692c55ba3f00834bc56ac634c1a4b0a75240ccc1eb087a12d13ba96000f02614783aa16e9ce0f11342ce39309bc3c35a0c16281f865d3c6c2013f050c1a8b570937fdd3e07a75413dd39963c0d0134355df072a678ee4f018af54522aa4ad9250dc6363d99237f93a4c604b99acbb1be4c571309b2da5fbbc713215068590146b04df6f8a5e97e5ea8e87ce3ca78e5d345ad0e334a29ab2f12d9b909d1f8128ef67931fa22520c5cb8b1f0bfbe1b861e6ff29dad471b1fe41327d40299ffa842a73f1a5aea2572933e1e8ddb1966d2fcb264a4b483862a1a7387bba583fb94288d5a81e5a7db2bfdb01331935f46bbb58168ed29e1d77202c84646bb4f202e02df81b173cbbc28cc24e3e7c6cb027ed0c542c831390086256f8caf96d30800fc810e7b032763351cde00d6ea1e36f5d62d6a460dd9149465cb0c2b77fdfd1ebd97a340d3a2a6c40baa79a89be6dc6ec421b2c66d3d3c948c2f1df1e30b1dbd7df466eb53bef87983fa6b86ffb289517b893326285853fe5ce20cd5f6ff877b20b3cb30c830c263edf1798a79c9d89c3c63d2d5b6fa41d60f7eb25022e04cc4410c624ef3aab853ab0389ff81031ddce8639a42c353589909e9c390c5efcb67789ca805e23d059a4efe3f36425a49473d550326c4c8d3f0a4c2174ff658d5ce80d1cc0651fdfcd33c77c49e4412178adb97555ee92e51a7bc9947b4fb554707b09ebc47c0ed16f925027768e6e97bd920e0c1157196498835677f4d02e1f380cfedc3d3054af632cbee993eb761ff53cf718abc4af40a2ad9d723e639b923071a6beecec41d45c0b0b89a613f950f5fbdc4cf22eca4ac042f625abee90e1cf6b7ae973c3cf1f7d49615cbbe99f6dc65ec867ac56a2efadb1e656a6e9d786282b5db8e4eadc00bf200f9e090eb0cc7395853c67d55a7612f2cf659b65b7a600553c057d26835b046da5cb8253f872e31bbca98724bc4f270027f53fbb187f594edf3fe72ca0872883b1980e8d30714785f76836897790c212c0f7aa2803cff9621cd8d6b51da12efeaf42f08b303d5723dcec53f1f028aa7a9585d802192a2cc4c515188d60848e7ce492d8aab34cbd63e322bfc621bfb833195191a8f83dab571535aedbc4b75d6ccd3a2eb7da496c04e2f059f12f5b341c53b7cd7d2b262dbaae19381c079f6aba30e40e17c43cae15f2cfea8eb4be067b13638bdd6e08807e12cb8e46711d9130f1dc82df1546166ff55787d50b3a7322f9ac0cca91195dda8d258b8fc9e90900861e7a403309b300a319510b3b23a84a0e12e239aa6b325c15b1a82977d123c9430f7700b1d9ff7a8e69ad48070cd22b73a597ef6f639888a480408f162b33189834a425370d4a06a76fac3c290638789270bbca6a18957843c6858577d9e0a724b07553f9e289e4c5e4cfbc42bed4336ebcdea259f3baf69c8fd4bd3e88850c32257d695b9d4b1b546994ee63c1147471fac3364f2703cd5dc89a8f03695c92806354135e33b467319f4cb30612af314cf9ff�x�������������0�����X��(
���������#����V�$����������������VVV�RRRRRYRRRRRYRRRRRRRRRYRRRRR	RRRYRRRRRRYRRRRRRYRRRRRRYRRRRR	R
RRRYRRRRRR	R
RRRYRRRRRRYRRRR
RRRRRRYRRRRRRRYRRRRRRRYRRRRRRRRYRRRRRRRYRRRRRRRRYRRRRRRYRRRRRRYRRRRRRRYRRRRRRYRRRRRRYP�R%RIP�R>RIRPP�PRRIRPPRRIPR%R'R,R-R/RIPRR#RCRHRIRORPPPR#R'RIPRP
R#R'RIRQPR%R'RIROPRIPPeR#RIRPPR#RIRPPR#RIRPPRIRPPRIRPPR#RIRPPRR#R6PRRIPR'PR#R'R)R*RIROPR#R)R8RBRIROPR#R)R*RIROPR#RBRIROP R#R(R)RIROP"RR'RIRPP#RR'RIRPP$RR%R'R.RIRPP&RR&R'R,R.RIRPRQP(RR#R$R'R+RBRFRIRORPRQP)RR#R'RGRIROP*RR1RIP+RR#R&R'R,R.P-RR'P0R'R4RFRIRQP1RR'RIROP2RR0RIROP3RRIROP5RR'R2RIP6R#R'R6RBRIP8PP9P:P;P<P=P>P?R#RFRIRPP@RR$R'RIROPARR$R'RIROPBRR$R'RIROPCRR$R'RIROPKPPR'RIPRRR3RR#RIRNPSRR'RIPTRR#R6PUR'PWRR'RIPXPYPZP[RIP\RR'P]R%R'RIRKRLRPP^R5RIRLRPP_RPlR#RIROPaRPbPcR#R+R4RIPdRR#R;RQPfP`PnR#RQPhR:RIPiRPjR#R%R:RIROPkPoR#RQPmR9RIROPpR#REPqRR'R<RIROPrRR'R<RIROPsR$RIPtPuR#R'R.R=RARCRDRERIRPPvRR$R'RIROPwRR#R$R%R'RIRORPPxR@RHRIRMRPP{RP|RRIROP}R&R.ROP~P�R?R@RHRIRMRPP�RIRPP�RR#R%R7RIP�RRIRPP�P�RRRIROP�P�P�RIRPP�R%RIRPP�RQP�P�RRPP�R#P�RIP�RP�RRIRQP�P�RPutf-84ef457d7661dd1104d92a6384e6a6474ac9e96e116d5c0e615a9bcbdf2e2077a?���d���3!�^���P,��*����%�h�>x
	*����%����ϋ1��?�s�2k��|�K����V�NkuL�/U.�
�j�:�q[�jN�~be(������{���3�!���iЮ�k��6EX~K��*Dn�ll�h��P��m�Q��1��^2��g�Z@�����[�N�7|�͢��;i��_����&���*�λR�����V*��k2i��3�M
�r8�b������t�R2H�0��㖿`�䯎�������O��Y桺(=ɘ�)���ͣ]6���4
+���x!�/����o�8]w���k�J+T|;�Ҥ|
d��+\�ҋ��n�>Y�h7+TAkN����n!~Ē��
q�ܓ:5y�(&3��5�#�<���:��)4嶪��HN+��U�q�� �=���W�=�t���X���x�HB"og�����76$dbؾ7��M���K0��0��>��o���� �n�ұ���_t�{9�:��Q�/�zg׬g	#�ܻ�:��ۥ5T_t�Qբ2A��4�M�Z_
�E����a犾�3!�^���P,��*����%�h�>w
	*����%�u��Mb2T��y'��F0!�#�O�
�+Ԋʎ?��c3H��Q>#	Ȥ�}�����U'ŌӍ�;\��x�����҄υ/�e�&>nk�]�n�����B�ٞЊ�D�Ϧ�+>�#D�l��C�|��?t����^i�y����p���W����MNľ���r7<�	�3G�$-��c�S-�W!�k�֩�p��Κ��� ���6��i�K�t��c�#8����k�L�,9r�/���۵P�G�<<fy�ޑ@�k��ؚL�V>�K]�i�g?��jMPda�3):k5� *_���@{χl�4Aw(Cf�H�#�Ӛ�ݓ]�V~`ciV�2�G��Q
�W���#����1��4�An��@�1C@S#�s�뙔 �1vs%X'��Mrn+-p�U#h�iM���^D6��[��$,K�3�ExX&�<A������[��K�Ә�A<��r:(�|�Ȩ�>Ru=ݽ�O�%Y��7i����U2d7ae74c2fd0e572b8ab1ec6c7b2a02970aff62568b094f471f02b4b3f947222c6633964cb29535e2e7456517875195764c6a49bh�K��x�������������������X��(
���������#����A��$Q����������������A�B�@��/../../usr/lib64/perl5/auto/POSIX/POSIX.so../../../../usr/lib64/perl5/auto/PerlIO/scalar/scalar.so../../../../usr/lib64/perl5/auto/Encode/Byte/Byte.so../../../../usr/lib64/perl5/auto/IO/IO.so../../../../usr/lib64/perl5/auto/Filter/Util/Call/Call.so../../../../usr/lib64/perl5/auto/List/Util/Util.so../../../../usr/lib64/libperl.so.5.26.3../../../../usr/lib64/perl5/auto/PerlIO/via/via.so../../../../usr/lib64/perl5/auto/arybase/arybase.so../../../../usr/lib64/perl5/auto/PerlIO/encoding/encoding.so�x������������� ������X�ל(
�G������`����s�$c����������������sr�ed, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0dbc815834d8966763d592edfdca1306117b0277, strippedtroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)
R
RRRRRR	R
RRRRRutf-8b29dfaabd9cc5ee7be868c70b6aa865e441ad05391cc81be003858b8cdb056d5?����Ld�3!�^���P,��*����%�f��
	*����%�0��-a�N�G��x��J�Gu�vpǨK�X����4?��v.���ʖR&Sӡ��Qs���#�x#����aY��'�E��X����>�C�;H�yu�òN�`3I�\\��
�/��]$%�C��y��4y�ܯ	�[��׊��Ld�����Yy%���s��o�!�L��zo̔���u�e���{�r��M�\��o�Ug�i��8X�v�/m��s�L{�u_�7*���A�F��z{�kN��8q
���:1
�#G:,�2o	c��I�Qf�>�4�w�:�<Q��>��"���e��_�5��%(������Eeg,�8�������.��AimNG�"�D;�\\�ҔzG-�"5��u���Wq�	�^M�`�ƿ�8V�Y\�y�6h�b�"1��tB;昨Y�aUv��%p���Unv0����� pK�Q�W<Л�
1(k��{yp��b�?�J?V��ꥠ���nn�ҡa[�vC���+�4a$�1�A�H���X��T� $w�3!�^���P,��*����%�f��
	*����%�	u�N
?���G��s�~Z�ISzü�'��B%��`���z�Ho���B:�s�Y82��n���4�3���NG��P.$G�����(V�;��l�'� �B�>H�|ɧ^�j�2��v�U��E)-5v=~�
t�B�'�\��]�Wr	 �reZ5�u8
���2�!�ʹ�3�?���1}S������1���'L@���҉1c�*����4���e��>Q��Z[��g�����}�����)?�
~���Εw�ҝ��+q�~���vV-z%X����u`g�4�a�C&�'��Q�4�3 ��9ra������Ů�Qc*��SX=�y���j����H�Dߚ���cjй�W*'���g*�A��uRV��l�+�*&�7h�&@$�)@˨(4*{�����Ǭ��nh���4���En9#I�T�V԰t���G���CB���s[��H^���a��B�N�_�M��cwN���m:�j�"�éì�Oq�46066d4e978ea2acfd3611db3ed865e3cd4eb956fa465703f1ebba4dd6db998b6f4582dcce737aefc8120c82fb283143b8793061fX�/ҔfX�CL_1.1)(64bit)��"libattr.so.1(ATTR_1.1)(64bit)��
libblkid.so.1(BLKID_1.0)(64bit)1��� libblkid.so.1(BLKID_2.21)(64bit)<0������ libblkid.so.1(BLKID_2.17)(64bit)B0������
 libblkid.so.1(BLKID_2.15)(64bit)H0����	��	libblkid.so.1()(64bit)M���libblkidP�libarchive.so.13()(64bit)�
keyutils-libs�dlibbrotlidec.so.1()(64bit)h�libanonymous.so.3()(64bit)�u/libbasicobjects.so.0(BASICOBJECTS_0.1.1)(64bit)- �a/libbasicobjects.so.0(BASICOBJECTS_0.1.0)(64bit)69�]libbasicobjects.so.0()(64bit)�nlibbasicobjectsas�elibbrotlicommon.so.1()(64bit)libc.so.6()(64bit)H*J�����	��libbz2.so.1()(64bit);libauparse.so.0()(64bit)H;J�����
��libaudit.so.1()(64bit) Do��libattr.so.1()(64bit)@Eop�����libacl.so.1(ACL_1.0)(64bit)PEop�������libacl.so.1()(64bit)olibacllibKSC.so()(64bit)libJISX0213.so()(64bit)libJIS.so()(64bit)libISOIR165.so()(64bit)libGB.so()(64bit)libCNS.so()(64bit)�&'*+:=BFILXeg~���������	����&ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)(ld-linux-x86-64.so.2(GLIBC_2.2.5)(64bit)�&'*+:=BFILXeg~�������������ld-linux-x86-64.so.2()(64bit)u*iptables-libs(x86-64)�x��������������������X�c�(
���������������d�$�����������������d�d�d�	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~��������������������������������������������������������������������������������������������������������������������������������	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw�x�������������������X�5�(
�������R���$f�����������������������rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroot�x��������������������X��(
������������K��$[����������������K�L�J��0a643b1768617839bb5c3be226f02f13835468e87f34b5d702f460ddf8ded6970ed08a91f15348d5a116bff0ee712ee54ee9ee6b7f277cd67458793e94116c43c88bdf308e504d13829b680130a26b8b459b0884b30caf8693608683c7c2678d0c6afa8a362699dcc905408cf088108922d9ad9a2cbc98b66eba4fcdb7de2f013e612739e8fd5b0536fb1abbbf8e1cb0b56339bdee6e10017722d9e7290c092a5a0a3d02bb75541f237e4239de9b2aa9d37d70e1d869b2377f695dccffe680abc7a92d0722006b2792c0bbd0861ee796d5ff4c55259a79b37e380fd0b458c1a19428ac11dcda83570cb6dd817a731b650756aed5ab8c079482a75f564e171bb208b81313e51f55fed7cf1c789c5d6592d067b1409cbea4ac93857d9a41827e2c2aa5005608ee4f1a80de1cdd72805a675358187c44b41d05b69a7f9051decc0451d8f64d4c44fc874867ad8d4b7a6501f867bc69ba1911f3e55baf8aa7dc90b3e3f5c024e5814bce2fe09bd002c915ceec2a88194137a45162579ae0e7aa3b8b7c24d47bd8ecec457345865c7947a31df2749fa2d499ccd0fbd10f8d1254db8868dcfc487a1b3ec702ce961335fa477aa1175095f0d430c1f3d893996431781ef732696a34f82dbb9902b12e80ad9e52dd133d36fda30901c6b0ce931f02dad66d3c2e5365874d09d3f7c1af30cdf7170c7c41c470dde545ea7b1a304897dd60c099f4a7024c98356f662015c1b9bbbffbc9e5c2b28680075400a0a6ec3b3b84df2d4a5bb271bba3bbb5381cdfc8ba9dbcf26204ca125515d7d4ab9a59ceaab478e9251bbc75e48a2f117dfc5bcafc5fef91d9b61ae90da57af3e6d92a8e2a14bdaa27fe8dfbf6e011a36a1eb125c38fda4c1cd0c3c2ff09c74d8e0907a18f6180cbe79f732ad0245155760353b223b3376617c96781709e1df36fb868088121e6450b377d9eee54f36282858396c8e48af4ed7fd2f93f9bf8e337e05872811c6a08a6c891d25de8c2ed5493f032cbe75ef5ff0f995ea27b2d4295dc43ad9cacd3f53e07616a5708b23609aef6ef96a4c70d4e611a8b4a1164393acf847d1341f9e2b73d6a7d908ea2da124f369352ed3c5333af28c436be377f25a52068259111f03572fe3b5a7388498de1b1630d7abf0f5bb547c545583d29f385ec765f156254d19fe851a6864869979ed32b8bdf46899344dd5e24221db21451c8fa9458993000f50455ace1acd6ae4152b1f0ec17ad39e91621bbd6bd6f8b3b55b8fdb041a068531ace5f575757d6d5e85685f61658c634800da1df66b27172ded62584b6c102ece2fa14fc73ddf934d9fa2990160448b0de000adc79abfb6139afe8932ad9fef74bf585555d0826f011cd853bed7f39791cd2629bf40489762ecc29522803db85b25bf5b993eca6f7cf4c2312fd373ab8a5d52f075f30dc47014c9f28a9385b739eed9f5a8966a25922a52844a3f5b21e8e019187b4e6b40e518207bb96d6062a289133e0737540ef606f761f6a7e36ac5267292d800e74fcfeaaf01b671aa11d6b34df4bd892950a458f8ab9d71ed1f15ada0366279285186a92dc8110764a9c176a3b3cd7233af0477e810d7c40dbfd5c3d1d3fc59eda78be59df309819b7a14dd995ec42a4fad5b404660f6fe5cd400ffe48e1f005061451a88355a836c43bd7b1b4aa2f23edf189995fdda564b9f249f90774670e02592ff29ad93a4f41f8f9c8bee1a986a8977ab110a6f9fd7f29668af299a2582ea71f6924486a44fa840a664c0a4e46b2b526ab94e622af637df3a59720290f647f60600081fa0c87981bc4f2b1bf51001497e6f32353a26d5c0cdd0760e1fcaa8b27b2c9aced41fe5e43273a8bc7436784fb6babcdd4c85cc5d9df65553510067c50b6045d4278a7a7ad77ef5bb03bd64ec0693cbf19cd1d94b269f2bec56f746b049191b85c9a75d72a9f07ff45ecf5e0ad7d7aee29743b8f34baee34a884d77a20af98dc78981b614f4dad2b6272f09fcaed7bdce2a830c20954a25a814820aab72355e18a2b9f19c216a5399317aa6608c9b41a46c99d569e90a3a2879c422f2c925fac3f45be7c699cf521434f4f6bf5ddfbabff984cc3ff074db1ad6ee258da9fcc8adbb6cf5ad85aa1e003625afeac105796e080cb0589c0691b1b174a6d960a8964ac762c48bb5997e390b8c4e73f182d07502ee5101038e7032018184974b70f4b1ec9c3a6651f7a9a24e71668c95f0fb2d9155e1a6b192c8b711451ad2338e58a395209682e80b6df66cc871060808ef260113f6d0021426b9c078bd0f768609bb588e292e4086a6466228ab79e3a5f72ea4cb8a70fe22b3ea97584a6718f830d8b24a4bd1f3338be7d1fd22c4fcb186e310da0f278e31b6187b9a24e46c3fcd65fc5ee9b745165d9c81dc8a69239083b3315e887fb7f9456b747e991f55ee3f69e895704f3ffd0e2f1147d43c283d072e15811a9e7df891fe07d72dc1501845476119b4219215496ffab8b35cfcddaf169a9074c3f42d294794f4c151422e0ff70c1bde51e1066eb49b61e094c4f521b8410a6a48edbef28f09ecfa1a2c578bc21793f90682ce0ac34d6cb77a81ffbd1d1b42870490b5fc531b3b19c3d43e1331e64474e751b589a8e38e1c5fecc7d283ee333c6db43c68b9d0b5aec9d3507dedf360e800031d95785f38608e23d0cad519a3ba2b01008c331dc869b3db3013eef5e79a2f489bb9ff4aba101a7bacddca31ca913d39b55869e57e24e5014ea928d5a24b9cbd35cce3d5634a29c995867b58dd0ffdf1cff3cdb2a480f21fff9f0eb8370435b162065ed281fa2e2e78394a9d9486f�x�������������������X�
�(
�T����@�����V�$����������������VVV�ry long lines!&+/359=BIPU\adipz}���������������������� '-36:;?BIQRV]bdimqtw{����������������������
"#&-157;@CJOU]bgjrvz}��������������������������������x�������������x������X��(
`������������'��$7����������������'�(�&��delta.1.gzperl5101delta.1.gzperl5120delta.1.gzperl5121delta.1.gzperl5122delta.1.gzperl5123delta.1.gzperl5124delta.1.gzperl5125delta.1.gzperl5140delta.1.gzperl5141delta.1.gzperl5142delta.1.gzperl5143delta.1.gzperl5144delta.1.gzperl5160delta.1.gzperl5161delta.1.gzperl5162delta.1.gzperl5163delta.1.gzperl5180delta.1.gzperl5181delta.1.gzperl5182delta.1.gzperl5184delta.1.gzperl5200delta.1.gzperl5201delta.1.gzperl5202delta.1.gzperl5203delta.1.gzperl5220delta.1.gzperl5221delta.1.gzperl5222delta.1.gzperl5223delta.1.gzperl5224delta.1.gzperl5240delta.1.gzperl5241delta.1.gzperl5242delta.1.gzperl5243delta.1.gzperl5244delta.1.gzperl5260delta.1.gzperl5261delta.1.gzperl5262delta.1.gzperl5263delta.1.gzperl5280delta.1.gzperl561delta.1.gzperl56delta.1.gzperl581delta.1.gzperl582delta.1.gzperl583delta.1.gzperl584delta.1.gzperl585delta.1.gzperl586delta.1.gzperl587delta.1.gzperl588delta.1.gzperl589delta.1.gzperl58delta.1.gzperlaix.1.gzperlamiga.1.gzperlandroid.1.gzperlapi.1.gzperlapio.1.gzperlartistic.1.gzperlbook.1.gzperlboot.1.gzperlbot.1.gzperlbs2000.1.gzperlcall.1.gzperlce.1.gzperlcheat.1.gzperlclib.1.gzperlcn.1.gzperlcommunity.1.gzperlcygwin.1.gzperldata.1.gzperldbmfilter.1.gzperldebguts.1.gzperldebtut.1.gzperldebug.1.gzperldelta.1.gzperldeprecation.1.gzperldiag.1.gzperldos.1.gzperldsc.1.gzperldtrace.1.gzperlebcdic.1.gzperlembed.1.gzperlexperiment.1.gzperlfork.1.gzperlform.1.gzperlfreebsd.1.gzperlfunc.1.gzperlgit.1.gzperlgpl.1.gzperlguts.1.gzperlhack.1.gzperlhacktips.1.gzperlhacktut.1.gzperlhaiku.1.gzperlhist.1.gzperlhpux.1.gzperlhurd.1.gzperlintern.1.gzperlinterp.1.gzperlintro.1.gzperliol.1.gzperlipc.1.gzperlirix.1.gzperljp.1.gzperlko.1.gzperllexwarn.1.gzperllinux.1.gzperllocale.1.gzperllol.1.gzperlmacos.1.gzperlmacosx.1.gzperlmod.1.gzperlmodinstall.1.gzperlmodlib.1.gzperlmodstyle.1.gzperlmroapi.1.gzperlnetware.1.gzperlnewmod.1.gzperlnumber.1.gzperlobj.1.gzperlootut.1.gzperlop.1.gzperlopenbsd.1.gzperlopentut.1.gzperlos2.1.gzperlos390.1.gzperlos400.1.gzperlpacktut.1.gzperlperf.1.gzperlplan9.1.gzperlpod.1.gzperlpodspec.1.gzperlpolicy.1.gzperlport.1.gzperlpragma.1.gzperlqnx.1.gzperlre.1.gzperlreapi.1.gzperlrebackslash.1.gzperlrecharclass.1.gzperlref.1.gzperlreftut.1.gzperlreguts.1.gzperlrepository.1.gzperlrequick.1.gzperlreref.1.gzperlretut.1.gzperlriscos.1.gzperlrun.1.gzperlsec.1.gzperlsolaris.1.gzperlsource.1.gzperlstyle.1.gzperlsub.1.gzperlsymbian.1.gzperlsyn.1.gzperlsynology.1.gzperlthrtut.1.gzperltie.1.gzperltoc.1.gzperltodo.1.gzperltooc.1.gzperltoot.1.gzperltrap.1.gzperltru64.1.gzperltw.1.gzperlunicode.1.gzperlunicook.1.gzperlunifaq.1.gzperluniintro.1.gzperluniprops.1.gzperlunitut.1.gzperlvar.1.gzperlvms.1.gzperlvos.1.gzperlwin32.1.gzAnyDBM_File.3pm.gzAutoLoader.3pm.gzAutoSplit.3pm.gzB.3pm.gzB::Concise.3pm.gzB::Deparse.3pm.gzB::Op_private.3pm.gzB::Showlex.3pm.gzB::Terse.3pm.gzB::Xref.3pm.gzBenchmark.3pm.gzCORE.3pm.gzClass::Struct.3pm.gzConfig.3pm.gzConfig::Extensions.3pm.gzDB.3pm.gzDBM_Filter.3pm.gzDBM_Filter::compress.3pm.gzDBM_Filter::encode.3pm.gzDBM_Filter::int32.3pm.gzDBM_Filter::null.3pm.gzDBM_Filter::utf8.3pm.gzDirHandle.3pm.gzDumpvalue.3pm.gzDynaLoader.3pm.gzEnglish.3pm.gzExtUtils::Constant.3pm.gzExtUtils::Constant::Base.3pm.gzExtUtils::Constant::Utils.3pm.gzExtUtils::Constant::XS.3pm.gzExtUtils::XSSymSet.3pm.gzFcntl.3pm.gzFile::Basename.3pm.gzFile::Compare.3pm.gzFile::Copy.3pm.gzFile::DosGlob.3pm.gzFile::Find.3pm.gzFile::Glob.3pm.gzFile::stat.3pm.gzFileCache.3pm.gzFileHandle.3pm.gzFindBin.3pm.gzGDBM_File.3pm.gzGetopt::Std.3pm.gzHash::Util.3pm.gzHash::Util::FieldHash.3pm.gzI18N::Collate.3pm.gzI18N::LangTags.3pm.gzI18N::LangTags::Detect.3pm.gzI18N::LangTags::List.3pm.gzI18N::Langinfo.3pm.gzIPC::Open2.3pm.gzIPC::Open3.3pm.gzInternals.3pm.gzNDBM_File.3pm.gzNEXT.3pm.gzNet::hostent.3pm.gzNet::netent.3pm.gzNet::protoent.3pm.gzNet::servent.3pm.gzO.3pm.gzODBM_File.3pm.gzOpcod�x�������������������X���(
����������/X�$?����������������/X0X.X��x�������������h������X���(
X��������I�������W�$f�����������������W�W�I�L?�$d����	%�	<���������%�	Y�q�����0L`L	�L
�L�L�L
,L\L�LT�L��[(�8��9T�:K��>� G�(LH�XLI��LX�Y�\�@L]�pL^��b��d��e�f�l�	t�$Lu�TLv��w�PLx��Ly��I����������� �4�8������
���������L�@g�Dh�HCnet-tools2.00.52.20160912git.el8Basic networking toolsThe net-tools package contains basic networking tools,
including ifconfig, netstat, route, and others.
Most of them are obsolete. For replacement check iproute package._K�;build.cloudlinux.com�nCloudLinuxCloudLinuxGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>System Environment/Basehttp://sourceforge.net/projects/net-tools/linuxx86_64
if [ $1 -eq 1 ] ; then 
        # Initial installation 
        systemctl --no-reload preset arp-ethers.service &>/dev/null || : 
fiz��'�CpTde�T C�2���F���T����m�
6�t>����
��$	��
`�-��y�y
���	��
���A�A�A�A�A�A�A�A�A�A�A�A�A���������������A큤������������������������������������������������������������������������_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;^q�8_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;_K�;W���_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:_K�:58b684d5f7e86bc1b44a9834c405ae0cf33769bbc3973f130c8dd5d4a9c193fcb0540261fd06e9e2d8e3387c492eafe24cfb67e8897a1b12813ee27ca31df2becdac16c5241da49ae336c2a69bd5ae1032541714d883c7e4643c9c55f88017d437a4c43289d88c9f2fb2b729c239208329d6437847558739f12def64b9a464775ad0a5d085cc95e30810b010afa6698fe0e50d21b9d1ba9adee95f112848a8055481cfe73dfbc33ab67bc8bc757cce2314f84239abb0ae5c16b7ed44051f6a22c878b26dabefa2c5f10725d5404e447ed32fdd611515635bced4d1ddf32ed831ba380c50b1d85c584f8160ff3faab648058c2117ef0055274044aee5d9fbfd23750eded3cfa5590ca91c6cbc1bfa77853a17217954f4ba6cd63add6099200d86609deade7535388b64fd7f92f441925a9611fd0e70ce0a316fd42d740d3d70e96bf665d5d6bb694d4f6073ff9a9c40901b28f4e3d15c290b47af57eba54c47887680e84f7d0e1909f4f254de3a6834c944d9c679db9c98426d8269ee2cc8bfe4098e528b149de597b42e250f5bc5e4e8529f3013566a63e2339a6c42b5a430668177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643e19d5a958ceca429baffe6f4aa1386f4e3ec0c966a0df40c525f09c888826ac3414c7c1a501018a74711508210dc4f7a6ea202044307a713d73a5a6ff770cdb14759180e81476b93a88efa7010ade06a9dbe76d659de82e7ecfb1eb4a8278361c75c9ba77a424a5d8352470f80f94887421f7e937ee90e1df40a8fec5ef6db9e86511ff647c5630977e4cab90e40b1b11e34f168334b7326809cdce476648b402f6a7d2abbf371e94d542c877644e3dad4880883f5970233311a7f345cbce17a79858ddd873a07c1b38a9ea7430433ec7195ad5e11c322d010507608f9b76b453bf7e68e91890c1d1f11c6337a798f9�x��������������v�����X���(
x�����X�����t!�$d����������������t!s!u!�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-5.26.3-423.el8_10.src.rpm��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������libperl.so.5.26()(64bit)perl(:MODULE_COMPAT_5.26.0)perl(:MODULE_COMPAT_5.26.1)perl(:MODULE_COMPAT_5.26.2)perl(:MODULE_COMPAT_5.26.3)perl(:VERSION)perl(:WITH_64BIT)perl(:WITH_ITHREADS)perl(:WITH_LARGEFILES)perl(:WITH_PERLIO)perl(:WITH_THREADS)perl(XSLoader)perl(integer)perl(re)perl(strict)perl(unicore::Name)perl(utf8)perl(utf8_heavy.pl)perl(warnings)perl-libsperl-libs(x86-64)@@@@@@@@@@@@@@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(XCRYPT_2.0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libperl.so.5.26()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libutil.so.1()(64bit)perl(Carp)perl(Encode)perl(Exporter)perl(XSLoader)perl(integer)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsX�x�������������Xf�����X���(
������@9�������W�$g�����������������W�W�W�fecd62394f8d5b7eb7621233f2c5f1d4193396afa56440684ab9e68152632c0b2cad69b1cc86e13b73bdfa58f1bb7b38e03d1f8cd79086c87a5bfd7487f78cd84db10660f8b630f288cc273687cbf8e1d5a609881779b153cce850fbc6ab11f96606a1125cbec0185e718427aab60744d58fd7b46d3fa321944958399e1f59e73c844afdf33f7f3b509b8b46fbe7343932efa176da925fa7dbd0f467b0e3dac63157d627905bb4241903957e57db159d3bbd99db81ba9162696892ed7b8a5468f7d1ecc7c3b4469c9d01b6c9bce89666af42aaaff975c11b70e6116cb3d07e73792a4a3addb09f362ac02dd748fa5ab30047dba5da16af29f20073e141f92aa4e954e2fe6df6f1917bd49a45fab9ac0efbc25fe2da3ae10c09b4b74752b2e40bd8bae09a76a98d5d2a107c796086284a6dacdcd4245b382d6f6e6240da312f3b926cdfe84a86a2c1edde58ccd6dceb1041a63d6b3c96e86d565eb076c5792b23dba63750365a97692da57b65c105aba6154b59844d86fc0ca550155957cee865d3869d56374172417474a82ad28b4efb1c2c34cff6b224c0f2086c9525d37aabd5618d5d8897ad058658b1e3860632fbb9cf7ef85ca24516b57dcdb8fd730a66a66cdda7c775006d16d3848cb1be885c88f615caac80f5311f98f8bfd561d1aa384d9f249eb9db6fbc3af7057f346a91e48028bebdc2d2fd9b775ba6fbf6c781426e9b83b2decb9cfc6d653acdd99329e1f8d0a3872d73668585be68f1052158438aae064cb4951067fd0bab0fc345ec727bc79b1ad616c2d72fc6e4c454cfa554fa027481538b7b6badd9f7c7b6fe18965d3e463b4fd4166d195293e6503133d91d9e2a9a6e87eb4857e3b439d87bdb620a5e9cdf4279aa40c5025b944c3545be4734519e109f38632c9f3314e0b2d248b460c5a6ac240d13e71df355d7d96eb813d54ee388d9901edb02842c06fad913a86d1d51ffc736f3bf9201a932e0c6bfc4afce356d4cbb2cf417e7450676df4b290860fc39a59baab0c2b7660c5cee61b208d9ca3bf6ff9b79c1f1f98f3a750c1c66ec172eecfce8d5cf4de65dcd4f8308d28700d5d62287747ceb4243900434872978bbf474caf6ac36f1bb30627571c73fce6e0c03504ac21c11ad4da3dda13074de8070e53de08d17f6123248cfbebd61b2e81860208b3ca6545a4b66d799ff094e60c9a3efdff3facfb1d2add1992efaefc33a0fb7ce86ff0f4fdda261b55e2a63fcbc48e4d44f4dc77977c851622845eff5b9ba62994418310e024f325../../../../usr/sbin/nameif../../../../usr/sbin/arp../../../../usr/sbin/mii-diag../../../../usr/sbin/ifconfig../../../../usr/sbin/ipmaddr../../../../usr/sbin/plipconfig../../../../usr/sbin/iptunnel../../../../usr/sbin/ether-wake../../../../usr/sbin/slattach../../../../usr/sbin/route../../../../usr/bin/netstat../../../../usr/sbin/mii-tool�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnet-tools-2.0-0.52.20160912git.el8.src.rpm����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������net-toolsnet-tools(x86-64)@@@@@@@



@/bin/shlibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libselinux.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)�x��������������U�����X�~�(
���������r��������$u��������������������n.firstboot to KDUMP_COMMANDLINE_REMOVE- kdumpctl: fix missed dollar sign- kdumpctl: sync the $TARGET_INITRD after rebuild
- Avoid false-positive mem_section validation with vmlinux
- Rebase kexec-tools to 2.0.24
- Rebase makedumpfile to 1.7.1- s390: add support for --reuse-cmdline
- use slurp_proc_file() in get_command_line()
- add slurp_proc_file()
- s390: use KEXEC_ALL_OPTIONS
- s390: add variable command line size
- util_lib/elf_info: harden parsing of printk buffer
- print error when reading with unsupported compression
- use cycle detection when parsing the prink log_buf
- use pointer arithmetics for dump_dmesg
- add generic cycle detection- Revert "Remove trace_buf_size and trace_event from the kernel bootparameters of the kdump kernel"- Remove trace_buf_size and trace_event from the kernel bootparameters of the kdump kernel- kdump/ppc64: suppress the error message "Could not find a registered notification tool" from servicelog_notify
- Enable zstd compression for makedumpfile in kexec-tools.spec- mkdumprd: drop mountaddr/mountproto nfs mount options- add keytuils as a weak dependency for POWER- Document/kexec-kdump-howto.txt: fix escape- Document/kexec-kdump-howto.txt: improve notes for kdump_pre  and kdump_post scripts- rebase makedumpfile to 1.7.0- fadump-init: clean up mount points properly
- fadump: kdumpctl should check the modules used by the fadump initramfs
- fadump: isolate fadump initramfs image within the default one
- mkdumprd: Use xz for squash image compression- makedumpfile: printk: use committed/finalized state values
- makedumpfile: printk: add support for lockless ringbuffer
- kexec-tools: printk: Use %zu to format size_t
- kexec-tools: printk: Use ULL suffix for 64-bit constants
- kexec-tools: printk: add support for lockless ringbuffer- kdumpctl: fix fragile loops over find output- kdumpctl: enable secure boot on ppc64le LPARs- kdumpctl: fix a typo- kdump/ppc64: migration action registration clean up- kdump/ppc64: rebuild initramfs image after migration
- Check the existence of /sys/bus/ccwgroup/devices/*/online beforehand
- kdump.sysconfig.s390: Remove "prot_virt" from kdump kernel cmdline- check for invalid physical address of /proc/kcore when making ELF dumpfile
- check for invalid physical address of /proc/kcore when finding max_paddr
- fix format issue in find_online_znet_device
- check the existence of /sys/bus/ccwgroup/devices before trying to find online network device
- kdump-lib.sh: fix a warning in prepare_kdump_bootinfo()- Write to `/var/lib/kdump` if $KDUMP_BOOTDIR not writable
- Iterate /sys/bus/ccwgroup/devices to tell if we should set up rd.znet
- mkdumprd: display the absolute path of dump location in the check_user_configured_target()- Stop reloading kdump service on CPU hotplug event for FADump
- fadump: improve fadump-howto.txt about remote dump target setup- rd.route should use the name from kdump_setup_ifname
- get kdump ifname once in kdump_install_netdev- kdump-lib.sh: fix the case if no enough total RAM for kdump  in get_recommend_size()- kdumpctl: Add kdumpctl estimate
- mkdumprd: make use of the new get_luks_crypt_dev helper
- kdump-lib.sh: introduce a helper to get all crypt dev used by kdump
- kdump-lib.sh: introduce a helper to get underlying crypt device
- RHEL-only: keep total memory size coherent to RHEL-only kernel patch
- Show write byte size in report messages
- Add shorthand --show-stats option to show report stats
- Add --dry-run option to prevent writing the dumpfile
- kdump-lib.sh: introduce functions to return recommened mem size- Implement IP netmask calculation to replace "ipcalc -m"
- kdumpctl: fix check_config error when kdump.conf is empty
- Fix incorrect vmcore permissions when dumped through ssh
- Fix incorrect permissions on kdump dmesg file- origin/rhel-8.4.0) Revert "Revert "Append both nofail and x-systemd.before to kdump mount target""
- kdump.conf: add ipv6 example for nfs and ssh dump
- fix kdump failure of saving vmcore with the scp + ipv6 method- module-setup.sh: don't polute the names�x�������������HE�����X�3�(
����pz��������$d���������������������17bf768c3635594fd8bdf4748f5bfa1bf5a5dbd480522b2b8d9b862bf38175b7549a48f453449e204f5104954d7e1da643e60d89adee838e133808c57a7f36221b373b70f09f10d95f56925d317af483b643f25be3baf2f8a9ff7fa7c3f51a56fde8edea38611bdb84b501c297b89e3cf2ad962de5fab4adc5ffa8f9f384da7e9dd7cc3c20275fd1228468f792966c91b4e523d8ecfb2ec16c362186277ec0dee7fc286523f952788525308d1c0c3d17646372ff6e991f1adc1acc63bafe2b0f19f8e9d2510ece0f21486ede23159bf542373f8fca30728b51695cb5808ec5b2efb7d83685fe83224f54b695929b492c06575ef710a415313a8d5315e53673a0c5771a2d4b7cbe6c36a609b2a851316ee4332d454e1e51e1f9b9870400e00969e4e303e1aef12ea145becb656e390dd9e48765283b95fee118951bbf3391a9382b571ca2a3987e79224550e99d931539ad143e0bdb95fee118951bbf3391a9382b571ca2a3987e79224550e99d931539ad143e0bdc5f69f6389850a4aa20f2d1825cba55a6e93847f6cfbe85c4a7ab0d9989ab5acc5f69f6389850a4aa20f2d1825cba55a6e93847f6cfbe85c4a7ab0d9989ab5ac2749f8f86926f66b280c1426af04ed6eee81ddbdbba20461e0ec6c11164da2ca2749f8f86926f66b280c1426af04ed6eee81ddbdbba20461e0ec6c11164da2ca45590b5a824a7924f5e198f0914c46ec2c8e463dfd0e015e8d8dcc4749a6549d45590b5a824a7924f5e198f0914c46ec2c8e463dfd0e015e8d8dcc4749a6549d0cc187836b8b6894ee9b19d075da4a9cc2254251fbb43b166543da67bb1919330cc187836b8b6894ee9b19d075da4a9cc2254251fbb43b166543da67bb191933b41c095660f5e9db65feee38514be0fa4904b3f79e7de777ea3e87be67c51d2ee5b788ce486126a0e1c483d54d6c079230d89f90008297f115a06c59e3f6815fa039c24818212edac1065b2837639091451bc1a5f9cb13e59ab649632e45e63b7f6fe1c5f52940cd0b266392d5415d89b1a0b97132957842bfa7f8984a60fe042d7ba11778d54ab944362ee302dca6d47d8525bd243226a7ccbe75f32d8736d5b6566aee9cf45b005a7ea2eef233539b4789cf502a268e87fd019c6627aa8d6eb6566aee9cf45b005a7ea2eef233539b4789cf502a268e87fd019c6627aa8d6ed0fbd342fc8085721a389740bb3ce0dfda07f574222ea106c774ca9e74d9c656d0fbd342fc8085721a389740bb3ce0dfda07f574222ea106c774ca9e74d9c656a233a33ba52bc7c1e4b84f35fb3b16749a1b6cb02e35b30e6402dcb596a20c01e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8554c13b804e4c17c2aadc81d57a2552ef85c8865ef65fef054ec5ea26a001b992f4c13b804e4c17c2aadc81d57a2552ef85c8865ef65fef054ec5ea26a001b992f077d99a201edfe88109496a7c63647a85026a4ea94dcbef52145f67ec81bb094077d99a201edfe88109496a7c63647a85026a4ea94dcbef52145f67ec81bb09451ca1f6311d409195e27c2b4c4703dd749995e8c892cf0873864ce3784b9a64f51ca1f6311d409195e27c2b4c4703dd749995e8c892cf0873864ce3784b9a64f17b7de15e5a76aa6ac78d732fa31f1068f0d6d5f2a38481582de5ea64e77ad9d17b7de15e5a76aa6ac78d732fa31f1068f0d6d5f2a38481582de5ea64e77ad9d112937b1b23ee7bf9c35333e87ae6b3c2ea58a7246a5696e2b90d4f2b1660a8b112937b1b23ee7bf9c35333e87ae6b3c2ea58a7246a5696e2b90d4f2b1660a8b0bae7ec0d511377f00aa7dc8546841f6e0a6b7d11aa060c2dcc2267fcddc4605221af2744a9c01b21b85c571e43c7f7eba08e1ac9703452af1d38e6354c706e385f19eea47f8cfa1e30bb2b75be3be04f54d00b5165db43e9a1d857f9a09c48885f19eea47f8cfa1e30bb2b75be3be04f54d00b5165db43e9a1d857f9a09c4887ae4881d9c366487ae5dd8060a2d82dea8d059fa6047b0c687f533eafc91f40a7ae4881d9c366487ae5dd8060a2d82dea8d059fa6047b0c687f533eafc91f40ad978187b698eaab7a8168186bcb448b4f75ac6d3da7948c54e872e08a0851dc8309d94100baaca5100b8920c1c917ee4ae46ca49e243867ca3a4fc8ff07e5e0d553d510e10f72c1f0fc38dfe8f2b45aef2d943ba39bc7111888911ff0f6a70b88bda41ffc52f26e5488e69df0224f3233058d7f98e0a9314664abb908ad9ca93c84fb0853b8b607aa9a101a140eecd0d053d730946a707159333bb25923935c2c2e9c744cc2f588a9c2a0715e72931c058aa2ad93114f7259a7cd9e1d33017801ea1ba2183b86dbe4bba6fdf7fd9692082fd4fdf7e767480306f8628fe63a22dcc307bd9e092d318e694d40ca1cd999a520d1ca1e24947c1fee5f763739935fbe03d066dbe484350c6b0552696d3c23c1a87a00b23df57b237717a44eb549a36c0afb41571fbade468795eb34d3a81dc97681edaa85f7c3bb9c4224c9c8b24c1b8c7a12a16928f241456c6cc1a65cba9aab446c79ca3027ccce52ffa86125df318d26e445f9950487f8309376adc6e830da161d6e656e12bc91ceac9c7a62a76000631a1532c8bd6480da113fdde7351b88130c38eaa92c7adaac1a267ffb52df1072e6bfcae00bfb3c01a732a9739433a9b075f2aab4c768dd3b87b9c3ef0046e77825b376e61fe556b1cc884133665c0f54a36686d061e10d35eb514015fc5c0d022d147dd2c114b1e234455a975c3bffeffe0c11c74e309a�x��������������4�����X�͜(
������0��������!�$�����������������!�!�!�Na.plW.plExtY.plGCBCN.plEB.plEX.plLV.plLVT.plPP.plSM.plXX.plGcC.plCf.plCn.plL.plLC.plLl.plLm.plLo.plLu.plM.plMc.plMe.plMn.plN.plNd.plNl.plNo.plP.plPc.plPd.plPe.plPf.plPi.plPo.plPs.plS.plSc.plSk.plSm.plSo.plZ.plZs.plGrBaseY.plHexY.plHstNA.plHyphenT.plIDCY.plIDSY.plIdeoY.plIn2_0.pl2_1.pl3_0.pl3_1.pl3_2.pl4_0.pl4_1.pl5_0.pl5_1.pl5_2.pl6_0.pl6_1.pl6_2.pl6_3.pl7_0.pl8_0.pl9_0.plInPCBottom.plLeft.plLeftAndR.plNA.plOverstru.plRight.plTop.plTopAndBo.plTopAndL2.plTopAndLe.plTopAndRi.plVisualOr.plInSCAvagraha.plBindu.plCantilla.plConsona2.plConsona3.plConsona4.plConsona5.plConsona6.plConsonan.plInvisibl.plNukta.plNumber.plOther.plPureKill.plSyllable.plToneMark.plVirama.plVisarga.plVowel.plVowelDep.plVowelInd.plJgAin.plAlef.plBeh.plDal.plFarsiYeh.plFeh.plGaf.plHah.plKaf.plLam.plNoJoinin.plQaf.plReh.plSad.plSeen.plWaw.plYeh.plJtC.plD.plR.plT.plU.plLbAI.plAL.plBA.plBB.plCJ.plCL.plCM.plEB.plEX.plGL.plID.plIN.plIS.plNS.plOP.plPO.plPR.plQU.plSA.plXX.plLowerY.plMathY.plNFCQCM.plY.plNFDQCN.plY.plNFKCQCN.plY.plNFKDQCN.plY.plNtDi.plNone.plNu.plNv0.pl1.pl10.pl100.pl1000.pl10000.pl11.pl12.pl13.pl14.pl15.pl16.pl17.pl18.pl19.pl1_16.pl1_2.pl1_3.pl1_4.pl1_8.pl2.pl20.pl200.pl2_3.pl3.pl30.pl300.pl3_16.pl3_4.pl4.pl40.pl400.pl5.pl50.pl500.pl5000.pl50000.pl6.pl60.pl600.pl7.pl70.pl700.pl8.pl80.pl800.pl9.pl90.pl900.plPCMY.plPatSynY.plPerlAlnum.plAssigned.plBlank.plGraph.plPerlWord.plPosixPun.plPrint.plSpacePer.plTitle.plWord.plXPosixPu.pl_PerlAny.pl_PerlCh2.pl_PerlCha.pl_PerlFol.pl_PerlIDC.pl_PerlIDS.pl_PerlNch.pl_PerlPat.pl_PerlPr2.pl_PerlPro.pl_PerlQuo.plQMarkY.plSBAT.plCL.plEX.plFO.plLE.plLO.plNU.plSC.plST.plSp.plUP.plXX.plSDY.plSTermY.plScArab.plArmn.plBeng.plBhks.plCham.plCprt.plCyrl.plDeva.plDupl.plEthi.plGeor.plGlag.plGran.plGrek.plGujr.plGuru.plHan.plHang.plHebr.plHira.plHmng.plKana.plKhar.plKhmr.plKnda.plLana.plLao.plLatn.plLimb.plLinb.plMlym.plMong.plMult.plOrya.plSinh.plTalu.plTaml.plTelu.plTibt.plXsux.plZinh.plZyyy.plZzzz.plScxAdlm.plArab.plArmn.plBeng.plBopo.plCakm.plCopt.plCprt.plCyrl.plDeva.plDupl.plGeor.plGlag.plGran.plGrek.plGujr.plGuru.plHan.plHang.plHira.plKana.plKnda.plLatn.plLimb.plLina.plLinb.plMlym.plMong.plMult.plMymr.plOrya.plPhlp.plShrd.plSind.plSinh.plSyrc.plTagb.plTakr.plTaml.plTelu.plThaa.plTirh.plYi.plZinh.plZyyy.plTermY.plUIdeoY.plUpperY.plWBEX.plExtend.plFO.plHL.plKA.plLE.plMB.plML.plMN.plNU.plXX.plXIDCY.plXIDSY.plversionutf8.pmutf8_heavy.plvendor_perlwarnings.pm/usr/lib//usr/lib/.build-id/a2//usr/lib/.build-id/e0//usr/lib64//usr/lib64/perl5//usr/lib64/perl5/CORE//usr/lib64/perl5/auto//usr/lib64/perl5/auto/re//usr/lib64/perl5/vendor_perl//usr/share/doc//usr/share/doc/perl-libs//usr/share/licenses//usr/share/licenses/perl-libs//usr/share/man/man3//usr/share//usr/share/perl5//usr/share/perl5/unicore//usr/share/perl5/unicore/To//usr/share/perl5/unicore/lib//usr/share/perl5/unicore/lib/Age//usr/share/perl5/unicore/lib/Alpha//usr/share/perl5/unicore/lib/Bc//usr/share/perl5/unicore/lib/BidiC//usr/share/perl5/unicore/lib/BidiM//usr/share/perl5/unicore/lib/Blk//usr/share/perl5/unicore/lib/Bpt//usr/share/perl5/unicore/lib/CE//usr/share/perl5/unicore/lib/CI//usr/share/perl5/unicore/lib/CWCF//usr/share/perl5/unicore/lib/CWCM//usr/share/perl5/unicore/lib/CWKCF//usr/share/perl5/unicore/lib/CWL//usr/share/perl5/unicore/lib/CWT//usr/share/perl5/unicore/lib/CWU//usr/share/perl5/unicore/lib/Cased//usr/share/perl5/unicore/lib/Ccc//usr/share/perl5/unicore/lib/CompEx//usr/share/perl5/unicore/lib/DI//usr/share/perl5/unicore/lib/Dash//usr/share/perl5/unicore/lib/Dep//usr/share/perl5/unicore/lib/Dia//usr/share/perl5/unicore/lib/Dt//usr/share/perl5/unicore/lib/Ea//usr/share/perl5/unicore/lib/E�x�������������8$�����X�(
������������+��$;����������������+�,�*��=>?ABCDEFHIJKMNPQSTUVWXYZ\]_`abdeghjklmnoqrstvwyz|}~��������������������������������������������������������������������}~�������������3456789:;<=>KLOPQefghijklmnopqrstuvwxyz{|}~��������������������
()*/012HIJKLMZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~������������������������������������������������������������������������������������������������	

 !"#$'()*+,CDEFGJKLMNOPQRSTUVWX[\]^_`abcdefghijklmnopqrstuvwz{|}~��������������������������������������������������;BCHIJKLMNcde�����	

'()./256789:;xy��������	

vwz{���x�������������`�����X@�(
������������f�����$v����������������feg�ion in login 
acquisition of controlling terminal).- fix permissions problem with vipw & shadow files, again (doh!)- added patch from Olaf Kirch to fix possible pwent structure overwriting- fdisk patch from arjan- Don't include cfdisk, since it appears to be an even bigger pile of junk than fdisk? :)- don't require usermode- Incorporate kbdrate back in.- revert the patch that calls setsid() in login that we had reverted
  locally but got integrated upstream (#46223)- correct s390x patch- Add my megapatch (various bugs)
- Include pivot_root (#44828)- make shadow files 0400, not 0600- fix permissions problem with vipw & shadow files- update to 2.11f, remove any merged patches
- add s390x patches for somewhat larger swap- added --verbose patch to mkcramfs; it's much quieter by default now- removed warning about starting partitions on cylinder 0 -- swap version2
  makes it unnecessary- Fix up s390x support- Fix up login for real (a console session should be the controlling tty)
  by reverting to 2.10s code (#36839, #36840, #39237)
- Add man page for agetty (#39287)
- 2.11b, while at it- /sbin/nologin from OpenBSD added.- Fix up login - exiting immediately even if the password is correct
  is not exactly a nice feature.
- Make definite plans to kill people who update login without checking
  if the new version works ;)- upgraded to 2.11a (kbdrate moved to kbd, among other things)
- turned off ALLOW_VCS_USE
- modified mkcramfs to not use a large number of file descriptors
- include mkfs.bfs- changed Requires: kernel >= 2.2.12-7 to Conflicts: kernel < 2.2.12-7
  (fixes a initscripts -> util-linux -> kernel -> initscripts prereq loop)- patched mkcramfs to use the PAGE_SIZE from asm/page.h instead of hard
  coding 4096 (fixes mkcramfs on alpha...)- added mkcramfs (from linux/scripts/mkcramfs)- fixed bug #29131, where ipc.info didn't have an info dir entry,
  added the dir entry to ipc.texi (Patch58)- use lang finder script
- install info files- reverted login patch; seems to cause problems
- added agetty- updated kill man page
- added patch to fix vipw race
- updated vipw to edit /etc/shadow and /etc/gshadow, if appropriate
- added patch to disassociate login from tty, session, and pgrp- fixed problem w/ empty extended partitions
- added patch to fix the date in the more man page
- set OPT to pass optimization flags to make rather then RPM_OPT_FLAG
- fixed fdisk -l /Proc/partitions parsing
- updated to 2.10s- danish translations added- fix segfault in login in btmp patch (#24025)- ported to s390- update to 2.10p
- update patch37 to newer fdisk version- update to 2.10o
-  fdformat: fixed to work with kernel 2.4.0test6 (Marek Wojtowicz)
-  login: not installed suid
-  getopt: by default install aux files in /usr/share/misc
- update to 2.10n:
-  added blockdev.8
-  change to elvtune (andrea)
-  fixed overrun in agetty (vii@penguinpowered.com)
-  shutdown: prefer umounting by mount point (rgooch)
-  fdisk: added plan9
-  fdisk: remove empty links in chain of extended partitions
-  hwclock: handle both /dev/rtc and /dev/efirtc (Bill Nottingham)
-  script: added -f (flush) option (Ivan Schreter)
-  script: added -q (quiet) option (Per Andreas Buer)
-  getopt: updated to version 1.1.0 (Frodo Looijaard)
-  Czech messages (Jiri Pavlovsky)
- login.1 man page had not /var/spool/mail path (#16998).
- sln.8 man page (but not executable) included (#10601).
- teach fdisk 0xde(Dell), 0xee(EFI GPT), 0xef(EFI FAT) partitions (#17610).- rebuild to cope with glibc locale binary incompatibility, again- setfdprm should open with O_WRONLY, not 3.- fdformat should open with O_WRONLY, not 3.- make 'look' look in /usr/share/dict- put /usr/local/sbin:/usr/local/bin in root's path- rebuild to cope with glibc locale binary incompatibility- automatic rebuild- enable hwclock to use /dev/efirtc on ia64 (gettext is fun. :( )- move cfdisk to /usr/sbin, it depends on /usr stuff
- add rescuept- point more at the correct path to vi (for "v"), Bug #10882- FHS packaging changes.- modify PAM setup to�x�����������������X!��(
����������,X�$<����������������,X-X+X��x��������������������XΜ(
�
���x������!�$�����������������!�!�!�xt//usr/share/perl5/unicore/lib/GCB//usr/share/perl5/unicore/lib/Gc//usr/share/perl5/unicore/lib/GrBase//usr/share/perl5/unicore/lib/Hex//usr/share/perl5/unicore/lib/Hst//usr/share/perl5/unicore/lib/Hyphen//usr/share/perl5/unicore/lib/IDC//usr/share/perl5/unicore/lib/IDS//usr/share/perl5/unicore/lib/Ideo//usr/share/perl5/unicore/lib/In//usr/share/perl5/unicore/lib/InPC//usr/share/perl5/unicore/lib/InSC//usr/share/perl5/unicore/lib/Jg//usr/share/perl5/unicore/lib/Jt//usr/share/perl5/unicore/lib/Lb//usr/share/perl5/unicore/lib/Lower//usr/share/perl5/unicore/lib/Math//usr/share/perl5/unicore/lib/NFCQC//usr/share/perl5/unicore/lib/NFDQC//usr/share/perl5/unicore/lib/NFKCQC//usr/share/perl5/unicore/lib/NFKDQC//usr/share/perl5/unicore/lib/Nt//usr/share/perl5/unicore/lib/Nv//usr/share/perl5/unicore/lib/PCM//usr/share/perl5/unicore/lib/PatSyn//usr/share/perl5/unicore/lib/Perl//usr/share/perl5/unicore/lib/QMark//usr/share/perl5/unicore/lib/SB//usr/share/perl5/unicore/lib/SD//usr/share/perl5/unicore/lib/STerm//usr/share/perl5/unicore/lib/Sc//usr/share/perl5/unicore/lib/Scx//usr/share/perl5/unicore/lib/Term//usr/share/perl5/unicore/lib/UIdeo//usr/share/perl5/unicore/lib/Upper//usr/share/perl5/unicore/lib/WB//usr/share/perl5/unicore/lib/XIDC//usr/share/perl5/unicore/lib/XIDS/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������������XÜ(
������������}!�$m����������������}!|!~!�perl-devel (bug #1129443)
- Remove perl-ExtUtils-Manifest dependency on perl-devel (bug #1129443)- Do not filter FCGI dependency, CGI is non-core now- Remove bundled perl-IPC-SysV (bug #1308527)- Fix CVE-2016-2381 (ambiguous environment variables handling) (bug #1313702)- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Remove bundled Math-BigInt (bug #1277203)- 5.22.1 bump (see <http://search.cpan.org/dist/perl-5.22.1/pod/perldelta.pod>
  for release notes)- Rebuild to utilize perl(:VERSION) dependency symbol- Do not own IO::Socket::IP manual page by perl-IO- Sub-package Attribute-Handlers
- Sub-package Devel-Peek
- Sub-package Devel-SelfStubber
- Sub-package SelfLoader
- Sub-package IO
- Sub-package Errno
- Correct perl-Digest-SHA dependencies
- Correct perl-Pod-Perldoc dependencies
- Move utf8 and dependencies to perl-libs
- Correct perl-devel and perl-CPAN dependencies
- Sub-package IPC-SysV
- Sub-package Test
- Sub-package utilities (splain) into perl-utils
- Provide perl version in perl(:VERSION) dependency symbol- Sub-package Memoize
- Sub-package Net-Ping
- Sub-package Pod-Html- Disable hardening due to some run-time failures (bug #1238804)- Sub-package bignum
- Sub-package Math-BigRat
- Sub-package Math-BigInt-FastCalc
- Sub-package Math-Complex
- Remove bundled perl-Config-Perl-V (bug #1238203)
- Remove bundled perl-MIME-Base64 (bug #1238222)
- Remove bundled perl-PerlIO-via-QuotedPrint (bug #1238229)
- Remove bundled perl-Pod-Escapes (bug #1238237)
- Remove bundled perl-Term-Cap (bug #1238248)
- Remove bundled perl-Text-Balanced (bug #1238269)
- Remove bundled perl-libnet (bug #1238689)
- Remove bundled perl-perlfaq (bug #1238703)
- Remove bundled perl-Unicode-Normalize (bug #1238730)
- Remove bundled perl-Unicode-Collate (bug #1238760)- Store distribution's linker and compiler flags to more Config's options
  in order to apply them when linking executable programs (bug #1238804)
- Sub-package Config-Perl-V (bug #1238203)
- Sub-package MIME-Base64 (bug #1238222)
- Sub-package PerlIO-via-QuotedPrint (bug #1238229)
- Update Pod-Escapes metadata (bug #1238237)
- Sub-package Term-Cap (bug #1238248)
- Sub-package Text-Balanced (bug #1238269)
- Sub-package libnet (bug #1238689)
- Sub-package perlfaq (bug #1238703)
- Sub-package Unicode-Normalize (bug #1238730)
- Sub-package Unicode-Collate (bug #1238760)
- Sub-package Math-BigInt
- Do not provide Net/libnet.cfg (bug #1238689)
- Revert downstream change in Net::Config default configuration
- Move libnetcfg tool from perl-devel into perl-libnetcfg sub-package- Subpackage "open" module in order to keep deprecated "encoding" module
  optional (bug #1228378)
- Control building dual-lived sub-packages by perl_bootstrap macro
- Make PadlistNAMES() lvalue again (bug #1231165)
- Make magic vtable writable as a work-around for Coro (bug #1231165)
- Explain file break-down into RPM packages in perl package description- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- Stop providing old perl(MODULE_COMPAT_5.20.*)- Move ok and Test::Use::ok to perl-Test-Simple- Move bin/encguess to perl-Encode- 5.22.0 bump (see <http://search.cpan.org/dist/perl-5.22.0/pod/perldelta.pod>
  for release notes)
- Update sub-packages and erase the removed modules from the core
- Clean patches, not needed with new version
- Update patches to work with new version- Sub-package perl-CGI-Fast and perl-Module-Build-Deprecated
- Add missing dual-life modules to perl-core- Bump to make koji happy- Correct license tags of the main package, CGI, Compress-Raw-Zlib,
  Digest-MD5, Test-Simple and Time-Piece
- Package a Pod-Html license clarification email- Sub-package Text-Tabs+Wrap (bug #910798)- Add systemtap probes for new dtrace markers- Move perl(:MODULE_COMPAT_*) symbol and include directories to perl-libs
  package (bug #1174951)- Rebuilt for Fedora 23 Change
  https://fedoraproject.org/wiki/Changes/Harden_all_packages_with_position-independent_code- Provide 5.20.2 MODULE_COMPAT
- Clean list of provided files
- Update�x��������������������Xț(
��������،JX�$Z����������������JXIXKX�sole app to using pkexec, so we will work better
with policykit.
- Add missing import to fix system-config-selinux startup
- Add comment to pamd files about pam_rootok.so
- Fix sepolicy generate to not comment out the first line- Add --root/-r flag to sepolicy manpage,
- This allows us to generate man pages on the fly in the selinux-policy build- Fix newrole to retain cap_audit_write when compiled with namespace, also
do not drop capabilities when run as root.- Fix man page generation and public_content description- Revert some changes which are causing the wrong policy version file to be created
- Switch sandbox to start using openbox rather then matchbox
- Make sepolgen a symlink to sepolicy
- update translations- Fix empty system-config-selinux.png, again- Fix empty system-config-selinux.png- Update to upstream
        * setfiles: estimate percent progress
        * load_policy: make link at the destination directory
        * Rebuild polgen.glade with glade-3
        * sepolicy: new command to unite small utilities
        * sepolicy: Update Makefiles and po files
        * sandbox: use sepolicy to look for sandbox_t
        * gui: switch to use sepolicy
        * gui: sepolgen: use sepolicy to generate
        * semanage: use sepolicy for boolean dictionary
        * add po file configuration information
        * po: stop running update-po on all
        * semanage: seobject verify policy types before allowing you to assign them.
        * gui: Start using Popen, instead of os.spawnl
        * sandbox: Copy /var/tmp to /tmp as they are the same inside
        * qualifier to shred content
        * semanage: Fix handling of boolean_sub names when using the -F flag
        * semanage: man: roles instead of role
        * gui: system-config-selinux: Catch no DISPLAY= error
        * setfiles: print error if no default label found
        * semanage: list logins file entries in semanage login -l
        * semanage: good error message is sepolgen python module missing
        * gui: system-config-selinux: do not use lokkit
        * secon: add support for setrans color information in prompt output
        * restorecond: remove /etc/mtab from default list
        * gui: If you are not able to read enforcemode set it to False
        * genhomedircon: regenerate genhomedircon more often
        * restorecond: Add /etc/udpatedb.conf to restorecond.conf
        * genhomedircon generation to allow spec file to pass in SEMODULE_PATH
        * fixfiles: relabel only after specific date
        * po: update translations
        * sandbox: seunshare: do not reassign realloc value
        * seunshare: do checking on setfsuid
        * sestatus: rewrite to shut up coverity- Reorginize sepolicy so all get_all functions are in main module
- Add -B capability to fixfiles onboot and fixfiles restore, basically searches for all files created since the last boot.- Update to latest patches from eparis/Upstream
- fixfiles onboot will write any flags handed to it to /.autorelabel.
-   * Patch sent to initscripts to have fedora-autorelabel pass flags back to fixfiles restore
-   * This should allow fixfiles -F onboot, to force a hard relabel.
- Add -p to show progress on full relabel.-  Additional changes for bash completsion and generate man page to match the w
-  Add newtype as a new qualifier to sepolicy generate.  This new mechanism wil
-  a policy write to generate types after the initial policy has been written a
-  will autogenerate all of the interfaces.
-  I also added a -w options to allow policy writers from the command line to s
-  the writable directories of files.
-
-  Modify network.py to include interface definitions for newly created port type
-  Standardize of te_types just like all of the other templates.

-  Change permissive domains creation to raise exception if sepolgen is not ins
-  get_te_results no longer needs or uses the opts parameter.
-  The compliler was complaining so I just removed the option.
-  Start returning analysis data for audit2allow- Update Translations
- Fix hand�x��������������������X��(
������8�����e�$u����������������edf�891)- fix #214891 - add mount.conf and MTAB_LOCK_DIR= option- upgrade to 2.16
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.16/v2.16-ReleaseNotes
- enable built-in libuuid (replacement for the old uuid stuff from e2fsprogs)
- new commands switch_root, uuidgen and uuidd (subpackage)- upgrade to 2.15.1- set BuildRequires: e2fsprogs-devel
- add Requires: e2fsprogs-devel to libblkid-devel- upgrade to 2.15.1-rc1
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.15/v2.15-ReleaseNotes
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.15/v2.15.1-rc1-ChangeLog 
- merged patches:
  util-linux-ng-2.14-login-remote.patch
  util-linux-ng-2.14-fdisk-4k-I.patch
  util-linux-ng-2.14-fdisk-4k-II.patch
  util-linux-ng-2.14-fdisk-4k-III.patch
  util-linux-ng-2.14-dmesg-r.patch
  util-linux-ng-2.14-flock-segfaults.patch
  util-linux-ng-2.14-renice-n.patch
- new commands: lscpu, ipcmk
- remove support for "managed" and "kudzu" mount options
- cleanup spec file
- enable built-in libblkid (replacement for the old blkid from e2fsprogs)- fix #490769 - post scriptlet failed (thanks to Dan Horak)- fix some nits in mount.tmpfs- fix #491175 - mount of tmpfs FSs fail at boot- fix #489672 - flock segfaults when file name is not given (upstream)
- fix #476964 - Mount /var/tmp with tmpfs creates denials
- fix #487227 - fdisk 4KiB hw sectors support (upstream)
- fix #477303 - renice doesn't support -n option (upstream)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add -r option to dmesg(1)- fix typo in spec file- upgrade to stable 2.14.2
  ftp://ftp.kernel.org/pub/linux/utils/util-linux-ng/v2.14/v2.14.2-ReleaseNotes- fix #480413 - util-linux-ng doesn't include scriptreplay
- fix #479002 - remove dependency on ConsoleKit-libs
- upgrade to 2.14.2-rc2- upgrade to 2.14.2-rc1
- refresh old patches- fix #472502 - problem with fdisk and use +sectors for the end of partition- fix #465761 -  mount manpage is missing uid/gid mount options for tmpfs
- refresh util-linux-ng-2.14-mount-file_t.patch (fuzz=0)- remove obsolete pam-console support- upgrade to stable 2.14.1- upgrade to 2.14.1-rc1
- refresh old patches- update util-linux-ng-2.14-mount-file_t.patch to make
  the SELinux warning optional (verbose mode is required)- fix #390691 - mount should check selinux context on mount, and warn on file_t- upgrade to stable util-linux-ng release- upgrade to 2.14-rc3
- remove arch(8) (deprecated in favor of uname(1) or arch(1) from coreutils)
- add a new command ldattach(8)
- cfdisk(8) linked with libncursesw- fix audit log injection attack via login- fix location of the command raw(8)- fix 244383 - libblkid uses TYPE="swsuspend" for S1SUSPEND/S2SUSPEND- fix 439984 - backport mkswap -U- clean up sparc conditionals- Autorebuild for GCC 4.3- upgrade to new upstream release
- fix #427874 - util-linux-ng gets "excess command line argument" on update- update to upstream 2.13.1-rc2- Fix pam files so that pam_keyinit happens after pam_selinux.so- remove viwp and vigr (in favour of shadow-utils)- update to the latest upstream stable branch
  (commit: fda9d11739ee88c3b2f22a73f12ec019bd3b8335)- fix #354791 - blockdev command calls the blkpg ioctl with a wrong data structure- fix mount -L | -U segfault
- fix script die on SIGWINCH- update to the latest upstream stable branch- upgrade to stable util-linux-ng release- add release number to util-linux Provides and increment setarch Obsoletes
- fix #254114 - spec typo
- upgrade to floppy-0.16
- add BuildRequires: popt-devel- Obsolete a sufficiently high enough version of setarch- fix #253664 - util-linux-ng fails to build on sparc (patch by Dennis Gilmore)
- rebase to new GIT snapshot- fix obsoletes field- util-linux-ng includes setarch(1), define relevat Obsoletes+Provides- port "blockdev --rmpart" patch from util-linux
- use same Provides/Obsoletes setting like in util-linux- fix #252046 - review Request: util-linux-ng (util-linux replacement)- rebase to util-linux-ng (new util-linux upstream fork,
		based on util-linux �x�������������p������Xa�(
xx�����������d�$�����������������d�d�d��x�������������������XМ(
��������@������!�$�����������������!�!�!�%&	PR	RRR
RRRRRRRRRR
RRRRRRRRRRRRRRRP
RRPPPRPPutf-847889973a68c85c49b3591062ac45e9141e379d82f5daea417cefa9e4961da2d?���0��3!�^���P,��*����%�h�>w
	*����%�ݿ�i<������W���S����Um�HP�e��މ���� ~�3� �"NDd�e��kF=f��]}�����d	x�?�#~]3X�x��`I�ƾh���̵��P��4(�	)q��O�jPX&Ad��3�nmJ(9D�bK�����~�V��t�����	���B�0M�V�B�<~����j��A�G�j���B��
��e��,wـI��֨���KݍI'k �����QՎ��CT�w%��@���+�R=�lH~�^;3x�c�4wf7��Ҝ?������
�~�(>r�?tǔ�H~��1"�u	T��#�@A"Ė�A�;��<�z�RȦ�W^Xu<�N*	�k��g��D�@H|f�Hm:�,y��(pd"5�'��7�o�����i�#�N��;Dl�*7�6�b
6��_=�W�w{_��b|E,��Kn
/��Nh�a���8�yX,+�b�y%"	G�'8�O�C����3�_at��o뗲�2�Јx�������������`������X	�(
��������8�����Z�$J����������������ZY[�.2-1bash-completioncoreutilse2fsprogsfilesysteminitscriptssysvinit-tools1:2.1-18.201.41.8-539.79-42.88-144.14.3e��@e��e���d��@d%y�c�&@c��cn9@co�b�V�b�@b'E@a�Z@a�Z@a�q@a��@a�L�`�
@`�_��_��^��@^��]��@]��@]��@]��@]�q�]��]��@]y@]nU�]H@]@1@\�]@\��\~d�\��\��[�s�[qr�[m~@[j�@[b�@[M�@[��[�@Z�2@Z�I@Z�
�Z��@Z}�@Zc/@ZL�Y�@Y��Y�d�Y�d�Y��Y�@Y�@Y���Y�a�Y���Yy�Yp�@Y1S@Y;@X� @X���X���XW�X!�@X`@W�S�W�@W��@W�@W^�@WX@W�@V���V�n@V�3�V���V��VLh@VA�@V7P@U�|@U�@Ŭ�U�5@U�c@U���U�@UB@T�s@T��@T��T�[@T��@T���Tw@TJ?@T�S��@S��S��S�@S�R@S��@S���S��S�P@S��Sp��Sp��Sj @SX��R�>�R��R�@Rg�@REs@R-�@R-�@Q�M�Q��@Q��@Q�(@Q��@Qy�Qk�Qk�Qg�@QeT@QR�@QR�@QLG�Q$��Q#i@QE�QQ@P�D�P��@P�@P�*�P�d@P�d@Puc@Pl(�PH�@P,�P��O؀�O�t@Ou�@OG{�O3�@O1@O�On@Nˎ�N��@N�
@N[@NK�@N7�N�@M��M��Mt�MS�@MQ0@MO�M>�@M>�@M6�@M$]@L��Lk�@LZ��LV�@L+1�L_�L0�K�@K��@K�q�Kz��Kz��KuB�KG@KG@K&(�K�@K�@K
y@J�U�J�T�J��J��@Ję�J��@J�0@J�#�J�/@J�@Jyt@Jq�@Jm��Jj�J/�@J,�@J'�@IԨ�IÅ@IÅ@I�3�I�2�I��@I��I��Ix_�IO�@I&��H�HǶ�HǶ�H�@H�n�Hj@HM@H1k�H
�@H;�H��G�u@G�:�G��G��G{|�G_�@G_�@G[�G(n@G��G�F�@F��@F�%@Fɂ@Fɂ@Fɂ@Fɂ@F��F�G�F6@E�c@E�&�E�1@E��@E�<�E�@E..@E��E-@E
��D�@D�q@D��D��DȪ�DȪ�D�Y@D��@D�{�D��@D���D�A@D�L�D��@D�4�D��@D�W@DtJ�DtJ�DWI�DU�@D�D�D�@C�R@C�@C��@C�C�@C�g@C�f@C�q�C���CoA�Cb�C_o�CW��CW��CS�@CFc@CFc@C>�C�@BӰ�B�i�Bx�@Bv@Bv@Bl�BR}�BK�@BC�@B8�B@Aʳ@A���A��@A��@A�@Anj@Am�Am�Am�Aju�Ac�@AZ��AYR@AH.�AH.�A4h@A-�A
@A
@A
@A!@@�@��@��@�c@@���@�@@�@`&�@\2@@V�@@V�@@R��@R��@PT�@O@@O@@K�@?1@@9�@@5��@,�@@+j�@�@@@@@@��?�C@?��@?�@?�Y@?r�?j�?a�@?a�@?Xz�?Xz�?W)@?7�@?&a�?x�>�@>��@>��@>��@>��@>�\�>�h@>�9@>�D�>pr�>Z	@>Sq�>K��>>Y�>>Y�>=@>7�@>.��>"�@>"�@=��=�x@=��=�1@=���=0@=o^@=Q�=Jt@=>��==E@=;�=!��=O�=�@=�@=�@=@=�=�@<��<�M�<�5�<�K�<��@<��@<��<���<���<��<{x�<U=@<,^�<)��<��;��@;֭@;֭@;�[�;ʼn�;��;�f@;��;g�@;eL@;eL@;]c@;\�;M�@;L?�;-�@;(�@;
T�:�1@:��@:�_@:�$�:�0@:�R�:�F@:��:�E@:�P�:��@:�8�:�@:mr@:b�@:4��:�9�@9��@9��@9��9x;@9x;@9u�@9m�@9i��9`�@9SQ@9:D�96P@9
q�8���8�d@8��@8���8�(�8��8��@8�@8�m�8��8���8�>�8���8y�8L��8L��83�@8(�8 #�8�@7��@7�@7�r@7�}�7�,@7�@7�+@7��7��7�Y@7��7��7so@7O�7�7�7�@7=@7@6�k@6�v�6�%@6�%@6��6��@6�0�6��@6��6�@6���6�9@6��6��6��6i @6f}@6R��68X�6#@�6!�@6?�5��5�J@5�@5���5�R�5�@5r��5K
�5@~�5/[@4���4��4�a�4��@4M�4GS@4>�43��4*R@4��3�Z�3�@3\�@3�@3�@Karel Zak <kzak@redhat.com> 2.32.1-46Karel Zak <kzak@redhat.com> 2.32.1-45Karel Zak <kzak@redhat.com> 2.32.1-44Karel Zak <kzak@redhat.com> 2.32.1-43Karel Zak <kzak@redhat.com> 2.32.1-42Karel Zak <kzak@redhat.com> 2.32.1-41Karel Zak <kzak@redhat.com> 2.32.1-40Karel Zak <kzak@redhat.com> 2.32.1-39Karel Zak <kzak@redhat.com> 2.32.1-38Karel Zak <kzak@redhat.com> 2.32.1-37Karel Zak <kzak@redhat.com> 2.32.1-36Karel Zak <kzak@redhat.com> 2.32.1-35Karel Zak <kzak@redhat.com> 2.32.1-34Karel Zak <kzak@redhat.com> 2.32.1-32Karel Zak <kzak@redhat.com> 2.32.1-31Karel Zak <kzak@redhat.com> 2.32.1-30Karel Zak <kzak@redhat.com> 2.32.1-29Karel Zak <kzak@redhat.com> 2.32.1-28Karel Zak <kzak@redhat.com> 2.32.1-27Karel Zak <kzak@redhat.com> 2.32.1-26Karel Zak <kzak@redhat.com> 2.32.1-25Karel Zak <kzak@redhat.com> 2.32.1-24Karel Zak <kzak@redhat.com> 2.32.1-23Karel Zak <kzak@redhat.com> 2.32.1-22Karel Zak <kzak@redhat.com> 2.32.1-21Karel Zak <kzak@redhat.com> 2.32.1-20Karel Zak <kzak@redhat.com> 2.32.1-19Karel Zak <kzak@redhat.com> 2.32.1-18Karel Zak <kzak@redhat.com> 2.32.1-17Karel Zak <kzak@redhat.com> 2.32.1-16Karel Zak <kzak@redhat.com> 2.32.1-15Karel Zak <kzak@redhat.com> 2.32.1-14Karel Zak <kzak@redhat.com> 2.32.1-13Karel Zak <kzak@redhat.com> 2.32.1-12Karel Zak <kzak@redhat.com> 2.32.1-11Karel Zak <kzak@redhat.com> 2.32.1-10Karel Zak <kzak@redhat.com> 2.32.1-9Karel Zak <kzak@redhat.com> 2.32.1-8Karel Zak <kzak@redhat.com> 2.32.1-7Karel Zak <kzak@redhat.com> 2.32.1-6Karel Zak <kzak@redhat.com> 2.32.1-5Karel Zak <kzak@redhat.com> 2.32.1-4Karel Zak <kzak@redhat.com> 2.32�x��������������~�����X
��(
@�0�����j!�$z����������������j!i!k!�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�h�/�0002a493355b43906837880a890423afeaa18d5160a17aee38b2a6875f6c84051217e58ecd8813258b91e0ce751512b2e801088f9f2de365deea30bbb6d982195e12cb83261b1211566f33ca6aea19c21af7bfc98e4fbe7ba3fac64b42b6cb0586566c442af0dbf737012cc0b216c1fce96a9b0715db645f38ee0853b84d263e65f304c5bf83cc76c1a77938634647ff424df4695aa96510a5b8374248a0b3ebd528e7debd6f73d7eebd396f77ad6da8590f37d842224dc4b5ad018e57795c548e6beb9ca0ffbc4b9c6550d56f622ecd33d5635ee8af9a8f269fd81f40fb6801d77d235e41d54594865151f4751e835c5a82322b0e87ace266567c3391a4b91299317729e6e86fb05b52a0f9b3718e218ce997047797b59904efd26b37857de210db59f88dbbb767a69296efd376988cfca1183b24b92cdbd7f787cc64d242be4bc371bb2990cbed47ba1c81070770c651d16ca1a7a2ddcbb14b0c07f592d6a82b18763bb5bb7a5b86b305b1fb80be3748bdfe55eaa31d4975451f197f040d2113e178e702e62cea402a4fd4ab55d95ed96b327ee00d7c295bd3bdf1d16f390293c4afdabb6672b0b10bdc5df0a60344b7ca526730be538e6302f787cf44447e035a7f9eb8a0f582d3aaa76f4bbdf06b9ddc64bec0d28cf3424720189d1719ffeb62cc3ee22a592bc673e07158927d1a6536075d33258fc67ff91e3f720cf46389a96f0a1a1ed78e0e9c525434b5779b2e2baa8f976dfa2f78771282fa08d88d612127d4889032e55d82522e4a0c19793bda8aa8da14ecb3c696d17c83e6be139b3aa6e1b8d37c0a4c5aa77b7e168662831a4645912e446ca399280c0eb63760c2ac59e73fb56a2c7c6cffdf9bc81b8aa674163f566a3dc31dd9e6e2f9164d2cd3f3ca4956db2c06118d64f3e1b9ff13a900251b996e7b36d258114ae70400a59759481802353cd19d999d3be7e6c09a9f60e8d9d558f1666bcd1c4f94303913c52e0d693e9205f1d4074370386fcc221497af51becc603fcaab4ce3524713b6009477f536f63016d901aeb1a4c820ad291e30e72ee9eb9ac1dfb6294a8a9bccdfc4f159c5c68328114ff17cd520451714a72ff48657287e5fe2f64344980695b8e6fbfd6daa6e5980cb2106874b57e9c0ee2c25cc661c5995eb4bd57107778f6b034da09260ed5ac6c7d5d7b2aa1bc7408033137a3772070fa454cba49150e6741f74341097cd0866cb1576f91090ce1c1c738ca1097f61fc5029bac250195a5de69f2de664c672fc31903346398ec7e17182c0bb7d53e30e8a53af820a0fa302bdcfb95c3fd5de9233a74cbae7b41f7a654f49a626b46a330a656abfa292739feab128f956084e0e39c41f2d96770d82c5a19406748c79abf94a1900a5130d56b5544a4c27576cc31221165bff58e1b5a561460fe8cdfc7024e0e9d9b6d0a2496bd121229abf81d9ae94cb00cfa5f3a762ead03b5b5e8420a76956416898e8cc2ff0a6df0f5e8fb03da6f9744e0c48ce53f192f0681919940c1c7653b436c6e253571cb0e37911b5297029ab15e84a5fbfeb0772808295b9fa494833517d8b8a5ae2668056d4a0929c0a5668ddd73e1db86b2f65d8e97d539f6e9252ae377a78fc7d45c877b14c66b70b3a6ad7f4b356c243b36d5336522685f4bb3c4a7a20eb52cb5d0c031df4b1f6d73e9458c6126fb0d32112095defdc7493ce9a93ff6056d845723c3d1d870aa76be71acf88adb6d787331e0acafbdc71b20d886fb18118edc06e9dd3c2caf54b4a69025d6fe4f9ddb9f641b1cd96d4e1afedd62eb13d1a66fb080fdda29c8bfd5284dea1adb53e54498fcaff3d155ce3bfa6d3ff22ae0527262dcf28dc58e5b5fee4eb3eeac2ef1e70591d53b8935c12ee526de09b3c9d11f4fdcc5dab9e321e6ca2e03ae785b87ea36b948248bc167445c1afd8edf627297a334cbeffc8b70bfeeea09c963c1d348807139ccc7e1c7e88c8e6213270dd4ab9bdb3af3022defba94d4500e994a271d961d87281122df30704b07c18f557e61215819a7310ba704e1cbbe4e76c0cb3f44bdf44a2edcc5b5a62a0e7f9118d929a7258addd91fe2faab7d72f5ddfa7e8a3412a3f07f2ea731eb084f752f6aefce375686ab5f386b61a08787b1d3ea1ec5ccd0e29814a223290540a041528c9d2145ffe337f280ce79705fd687869b2a4ab1cada3bb900a876093bd153e6ad752f3ec7273856d73fd172b25d0c4881caf38cf363221314ce2f245e60482d4678157b28f0228666b6601e8056b554ceabb7a34e0b5228c2ed37442c459ce917c03e3c2484b0e676dc47886be13794021447cebfc5ee2f3625068b368af06bcc5814c22b66d3ce0089b300c2ffa4f554685fe4d39e66b01ca7e14b990d54bd864b829987d9bdd5859e7226544e00695f2e7ee3c73611d9c1e4ec412ee408da6856d471d4cccb88cd9873344c03c8cbd7a769b328167810ca91d69ac59ed1052ed5f02565001b62651c31b22234be370291de6f23da36763f17acabf42e1a1442840e5ae6ff68e691f9f9aeeb5c0f4c67cc9cd572819b04841ed5c51461ad0a1c0a49455b43c11eef2e93bede22ab15c9f8b1aa57be20fe6f4e6dcc90102f4eb4abe1e66bf3f�x�������������Pn�����X՜(
ؓ������0�����q�$a����������������qpr�mlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)shadow-utilssystemd-unitssystemd-unitssystemd-unitstrousers-lib(x86-64)0.3.15-2.el83.0.4-14.6.0-14.0-15.2-10.3.15-2.el84.14.3e/�_�:�\���\��@[m~@[a��[U�@Z}�@Y�@Yy�X���V���U�@Ud`@S��S�P@St�@S(5@R���R�Q�B@Q�3�Q#@Pa��P?U�P;a@P�@O��On@M���MS�@MR��K��Ko��Kb�J��@JlE@J�J{�I��@I�2�Is�IG�@IG�@H�5@H���HF��HE2@G��Gfd�Ga�G_�@GMX@GMX@G8@@D���D�n@Štěpán Horáček <shoracek@redhat.com> - 0.3.15-2Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.15-1Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-4Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-3Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-2Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.14-1Jerry Snitselaar <jsnitsel@redhat.com> - 0.3.13-11Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-10Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-9Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-8Peter Robinson <pbrobinson@fedoraproject.org> 0.3.13-7Fedora Release Engineering <releng@fedoraproject.org> - 0.3.13-6Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-5Tomáš Mráz <tmraz@redhat.com> 0.3.13-4Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.13-2Steve Grubb <sgrubb@redhat.com> 0.3.13-1Steve Grubb <sgrubb@redhat.com> 0.3.11.2-3Peter Robinson <pbrobinson@fedoraproject.org> 0.3.11.2-2Steve Grubb <sgrubb@redhat.com> 0.3.11.2-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.10-4Steve Grubb <sgrubb@redhat.com> 0.3.10-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.10-2Steve Grubb <sgrubb@redhat.com> 0.3.10-1Steve Grubb <sgrubb@redhat.com> 0.3.9-4Steve Grubb <sgrubb@redhat.com> 0.3.9-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.9-2Steve Grubb <sgrubb@redhat.com> 0.3.9-1Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.6-2Steve Grubb <sgrubb@redhat.com> 0.3.6-1Miloš Jakubíček <xjakub@fi.muni.cz> - 0.3.4-5Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.4-4Miloš Jakubíček <xjakub@fi.muni.cz> - 0.3.4-3Steve Grubb <sgrubb@redhat.com> 0.3.4-2Steve Grubb <sgrubb@redhat.com> 0.3.4-1Tomas Mraz <tmraz@redhat.com> - 0.3.1-19Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.1-18Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-17Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-16Milos Jakubicek <xjakub@fi.muni.cz> - 0.3.1-15Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 0.3.1-14Tomas Mraz <tmraz@redhat.com> - 0.3.1-13David Woodhouse <David.Woodhouse@intel.com> - 0.3.1-12David Woodhouse <David.Woodhouse@intel.com> - 0.3.1-11Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-10Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-9Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-8Emily Ratliff <ratliff@austin.ibm.com> - 0.3.1-7Fedora Release Engineering <rel-eng@fedoraproject.org> - 0.3.1-6Kent Yoder <kyoder@users.sf.net> - 0.3.1-5Kent Yoder <kyoder@users.sf.net> - 0.3.1-4Kent Yoder <kyoder@users.sf.net> - 0.3.1-3Kent Yoder <kyoder@users.sf.net> - 0.3.1-2Kent Yoder <kyoder@users.sf.net> - 0.3.1-1Kent Yoder <kyoder@users.sf.net> - 0.3.1Kent Yoder <kyoder@users.sf.net> - 0.2.6-1Kent Yoder <kyoder@users.sf.net> - 0.2.6-1- Fix home directory of the tss user
  Resolves: RHEL-9099- Rebase to 0.3.15
- Fix CVE-2020-24330 CVE-2020-24331 CVE-2020-24332
resolves: rhbz#1725782 rhbz#1877517 rhbz#1882402 rhbz#1882414- Fix annocheck warnings
resolves: rhbz#1624181- Add initial CI gating support
- Fix covscan reported issues
resolves: rhbz#1602719- release mutex in error path for obj_context_set_machine_name
resolves: rhbz#1614915- Rebase to 3.14 release
resolves: rhbz#1614915- Rebuild with correct source checksum.- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_�x��������������]�����X�(
��������������d�$W�����������������d�d�d�g��g�|g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g�|g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g�|g��g��g�|g��g��g�|g��g��g��g��g��g�}g��g��g��g��g��g��g�}g��g��g��g�}g��g��g��g��g��g��g��g��g�|g��g��g�|g��g��g��g�|g�|g�}g�}g��g�}g�}g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g�}g��g��g��g��g��g��g��g�|g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g�}g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g�}g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g��g��g�~g�~g�~g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g��g�~g��g��g��g��g�~g�~g�~g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�~g�~g��g��g��g��g��g��g��g�~g�~g��g��g�~g��g�~g��g��g��g��g��g�~g�~g�~g�~g��g��g��g��g��g�~g��g��g��g��g��g��g�g��g��g��g�g��g��g�g��g��g��g��g��g��g��g��g��g��g�g�g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g�g��g��g��g��g��g��g��g��g��g�g��g��g�g��g�g��g��g��g��g��g��g��g��g�g�g�g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�g��g�g��g��g��g��g��g��g��g��g��g��g��g�g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g��g�x����������M�����XI{�(
��������0�������$r��������������������.4-13WANG Chao <chaowang@redhat.com> - 2.0.4-12Baoquan He <bhe@redhat.com> -2.0.4-11Baoquan He <bhe@redhat.com> - 2.0.4-10Baoquan He <bhe@redhat.com> - 2.0.4-9Baoquan He <bhe@redhat.com> - 2.0.4-8Baoquan He <bhe@redhat.com> - 2.0.4-7Baoquan He <bhe@redhat.com> - 2.0.4-6Baoquan He <bhe@redhat.com> - 2.0.4-5Baoquan He <bhe@redhat.com> - 2.0.4-4Baoquan He <bhe@redhat.com> - 2.0.4-3Baoquan He <bhe@redhat.com> - 2.0.4-2Baoquan He <bhe@redhat.com> - 2.0.4-1Baoquan He <bhe@redhat.com> - 2.0.3-71Baoquan He <bhe@redhat.com> - 2.0.3-70Baoquan He <bhe@redhat.com> - 2.0.3-69Baoquan He <bhe@redhat.com> - 2.0.3-68Baoquan He <bhe@redhat.com> - 2.0.3-67Dave Young <ruyang@redhat.com> - 2.0.3-66Dave Young <ruyang@redhat.com> - 2.0.3-65Dave Young <ruyang@redhat.com> - 2.0.3-64Dave Young <ruyang@redhat.com> - 2.0.3-63Dave Young <ruyang@redhat.com> - 2.0.3-62Dave Young <ruyang@redhat.com> - 2.0.3-61Dave Young <ruyang@redhat.com> - 2.0.3-60Dave Young <ruyang@redhat.com> - 2.0.3-59Dave Young <ruyang@redhat.com> - 2.0.3-58Dave Young <ruyang@redhat.com> - 2.0.3-57Dave Young <ruyang@redhat.com> - 2.0.3-56Dave Young <ruyang@redhat.com> - 2.0.3-55Dave Young <ruyang@redhat.com> - 2.0.3-54Dave Young <ruyang@redhat.com> - 2.0.3-53Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.3-52Dave Young <ruyang@redhat.com> - 2.0.3-51Dave Young <ruyang@redhat.com> - 2.0.3-50Dave Young <ruyang@redhat.com> - 2.0.3-49Dave Young <ruyang@redhat.com> - 2.0.3-48Dave Young <ruyang@redhat.com> - 2.0.3-47Dave Young <ruyang@redhat.com> - 2.0.3-46Dave Young <ruyang@redhat.com> - 2.0.3-45Dave Young <dyoung@redhat.com> - 2.0.3-44Cong Wang <xiyou.wangcong@gmail.com> - 2.0.3-43Cong Wang <xiyou.wangcong@gmail.com> - 2.0.3-42Cong Wang <xiyou.wangcong@gmail.com> - 2.0.3-41Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-40Dave Young <ruyang@redhat.com> - 2.0.2-39Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-38Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-37Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-36Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-35Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-34Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-33Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-32Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-31Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-30Tom Callaway <spot@fedoraproject.org> - 2.0.2-29Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-28Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-27Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-26Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-25Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-24Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-23Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-22Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-21Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-20Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-19Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-18Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-17Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-16Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-15Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-14Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-13Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-12Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-11Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-10Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-9Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-8Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-7Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-6Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-5Cong Wang <xiyou.wangcong@gmail.com> - 2.0.2-4Neil Horman <nhorman@redhat.com> - 2.0.2-3Neil Horman <nhorman@redhat.com> - 2.0.2-2Neil Horman <nhorman@redhat.com> - 2.0.2-1Neil Horman <nhorman@redhat.com> - 2.0.0-47Neil Horman <nhorman@redhat.com> - 2.0.0-46Neil Horman <nhorman@redhat.com> - 2.0.0-45Neil Horman <nhorman@redhat.com> - 2.0.0-44Neil Horman <nhorman@redhat.com> - 2.0.0-43Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 2.0.0-42Neil Horman <nhorman@redhat.com> - 2.0.0-41jkeating - 2.0.0-40Neil Horman <nhor�x��������������<�����X!�(
`>����G�����$�����������������J�?�d����	�	?�(�,�D�H�S�^�f�	��������

	

,
T
^

�
�

4P
x��O(u8|9�:	$BwG�
H�
I�
X�Y�Z[\
]@
^�	b
�d�e�f�l�t�
u$
vLw�
x
y@�l�p�v�����o�
G���
�g�h�Clibgudev2324.el8GObject-based wrapper library for libudevThis library makes it much simpler to use libudev from programs
already using GObject. It also makes it possible to easily use libudev
from other programming languages, such as Javascript, because of
GObject introspection support.]�86build.cloudlinux.com=CloudLinuxCloudLinuxLGPLv2+CloudLinux Packaging Team <packager@cloudlinux.com>Unspecifiedhttps://wiki.gnome.org/Projects/libgudevlinuxx86_64+h�@�g�A�A�������A큤A큤]�86]�86]�86]�84]�86]�86]�86Y��]�86UU��b6e26e8d150f17a0885d5a5be26bad004e21a104eca8bbf14233b4199a1e730378686337a16949a2758bea1e9fd63891359791b3db17dc54f2bbb15f33e009c24e5a0a7315a15a2aba35a30a64612f1bf6fbe6c9e9bed326d971ae81ca9743a0dc626520dcd53a22f727af3ee42c770e56c97a64fe3adb063799d8ab032fe551../../../../usr/lib64/libgudev-1.0.so.0.2.0libgudev-1.0.so.0.2.0�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibgudev-232-4.el8.src.rpm��������������������������������libgudevlibgudev(x86-64)libgudev-1.0.so.0()(64bit)libgudev1@@@@@@@@@



@libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libpthread.so.0()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)3.0.4-14.6.0-14.0-15.2-14.14.2[O+�Z�S�Zz�@Zu�@Y�K�Y�@Yx�@X��@V�=@U�a@Uj��Bastien Nocera <bnocera@redhat.com> - 232-4Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 232-3Fedora Release Engineering <releng@fedoraproject.org> - 232-3Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 232-2Kalev Lember <klember@redhat.com> - 232-1Fedora Release Engineering <releng@fedoraproject.org> - 230-6Fedora Release Engineering <releng@fedoraproject.org> - 230-5Fedora Release Engineering <releng@fedoraproject.org> - 230-4Fedora Release Engineering <releng@fedoraproject.org> - 230-3Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 230-2Zbigniew Jędrzejewski-Szmek <zbyszek@in.waw.pl> - 230-1+ libgudev-232-4
- Remove umockdev dependency- Pull in patch from upstream to fix build- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Update to 232
- Enable self tests- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- Rebuilt for https://fedorapro�x�������������0,�����X��(
��������xq������0Y�$ ����������������0Y1Y0X��x�������������������Xo�(
������0�����wd�$g����������������wdxdvd�6.3ssl.gzBN_get_rfc3526_prime_6144.3ssl.gzBN_get_rfc3526_prime_8192.3ssl.gzBN_get_word.3ssl.gzBN_hex2bn.3ssl.gzBN_is_bit_set.3ssl.gzBN_is_odd.3ssl.gzBN_is_one.3ssl.gzBN_is_prime.3ssl.gzBN_is_prime_ex.3ssl.gzBN_is_prime_fasttest.3ssl.gzBN_is_prime_fasttest_ex.3ssl.gzBN_is_word.3ssl.gzBN_is_zero.3ssl.gzBN_lebin2bn.3ssl.gzBN_lshift.3ssl.gzBN_lshift1.3ssl.gzBN_mask_bits.3ssl.gzBN_mod.3ssl.gzBN_mod_add.3ssl.gzBN_mod_exp.3ssl.gzBN_mod_inverse.3ssl.gzBN_mod_mul.3ssl.gzBN_mod_mul_montgomery.3ssl.gzBN_mod_mul_reciprocal.3ssl.gzBN_mod_sqr.3ssl.gzBN_mod_sqrt.3ssl.gzBN_mod_sub.3ssl.gzBN_mod_word.3ssl.gzBN_mpi2bn.3ssl.gzBN_mul.3ssl.gzBN_mul_word.3ssl.gzBN_new.3ssl.gzBN_nnmod.3ssl.gzBN_num_bits.3ssl.gzBN_num_bits_word.3ssl.gzBN_num_bytes.3ssl.gzBN_one.3ssl.gzBN_print.3ssl.gzBN_print_fp.3ssl.gzBN_priv_rand.3ssl.gzBN_priv_rand_range.3ssl.gzBN_pseudo_rand.3ssl.gzBN_pseudo_rand_range.3ssl.gzBN_rand.3ssl.gzBN_rand_range.3ssl.gzBN_rshift.3ssl.gzBN_rshift1.3ssl.gzBN_secure_new.3ssl.gzBN_security_bits.3ssl.gzBN_set_bit.3ssl.gzBN_set_word.3ssl.gzBN_sqr.3ssl.gzBN_sub.3ssl.gzBN_sub_word.3ssl.gzBN_swap.3ssl.gzBN_to_ASN1_ENUMERATED.3ssl.gzBN_to_ASN1_INTEGER.3ssl.gzBN_to_montgomery.3ssl.gzBN_ucmp.3ssl.gzBN_value_one.3ssl.gzBN_with_flags.3ssl.gzBN_zero.3ssl.gzBUF_MEM_free.3ssl.gzBUF_MEM_grow.3ssl.gzBUF_MEM_grow_clean.3ssl.gzBUF_MEM_new.3ssl.gzBUF_MEM_new_ex.3ssl.gzBUF_reverse.3ssl.gzCERTIFICATEPOLICIES_free.3ssl.gzCERTIFICATEPOLICIES_new.3ssl.gzCMS_ContentInfo_free.3ssl.gzCMS_ContentInfo_new.3ssl.gzCMS_ContentInfo_print_ctx.3ssl.gzCMS_ReceiptRequest_create0.3ssl.gzCMS_ReceiptRequest_free.3ssl.gzCMS_ReceiptRequest_get0_values.3ssl.gzCMS_ReceiptRequest_new.3ssl.gzCMS_RecipientInfo_decrypt.3ssl.gzCMS_RecipientInfo_encrypt.3ssl.gzCMS_RecipientInfo_kekri_get0_id.3ssl.gzCMS_RecipientInfo_kekri_id_cmp.3ssl.gzCMS_RecipientInfo_ktri_cert_cmp.3ssl.gzCMS_RecipientInfo_ktri_get0_signer_id.3ssl.gzCMS_RecipientInfo_set0_key.3ssl.gzCMS_RecipientInfo_set0_pkey.3ssl.gzCMS_RecipientInfo_type.3ssl.gzCMS_SignerInfo_cert_cmp.3ssl.gzCMS_SignerInfo_get0_signature.3ssl.gzCMS_SignerInfo_get0_signer_id.3ssl.gzCMS_SignerInfo_set1_signer_cert.3ssl.gzCMS_SignerInfo_sign.3ssl.gzCMS_add0_cert.3ssl.gzCMS_add0_crl.3ssl.gzCMS_add0_recipient_key.3ssl.gzCMS_add1_ReceiptRequest.3ssl.gzCMS_add1_cert.3ssl.gzCMS_add1_crl.3ssl.gzCMS_add1_recipient_cert.3ssl.gzCMS_add1_signer.3ssl.gzCMS_compress.3ssl.gzCMS_decrypt.3ssl.gzCMS_encrypt.3ssl.gzCMS_final.3ssl.gzCMS_get0_RecipientInfos.3ssl.gzCMS_get0_SignerInfos.3ssl.gzCMS_get0_content.3ssl.gzCMS_get0_eContentType.3ssl.gzCMS_get0_signers.3ssl.gzCMS_get0_type.3ssl.gzCMS_get1_ReceiptRequest.3ssl.gzCMS_get1_certs.3ssl.gzCMS_get1_crls.3ssl.gzCMS_set1_eContentType.3ssl.gzCMS_sign.3ssl.gzCMS_sign_receipt.3ssl.gzCMS_uncompress.3ssl.gzCMS_verify.3ssl.gzCMS_verify_receipt.3ssl.gzCONF_modules_finish.3ssl.gzCONF_modules_free.3ssl.gzCONF_modules_load.3ssl.gzCONF_modules_load_file.3ssl.gzCONF_modules_unload.3ssl.gzCRL_DIST_POINTS_free.3ssl.gzCRL_DIST_POINTS_new.3ssl.gzCRYPTO_EX_dup.3ssl.gzCRYPTO_EX_free.3ssl.gzCRYPTO_EX_new.3ssl.gzCRYPTO_THREAD_lock_free.3ssl.gzCRYPTO_THREAD_lock_new.3ssl.gzCRYPTO_THREAD_read_lock.3ssl.gzCRYPTO_THREAD_run_once.3ssl.gzCRYPTO_THREAD_unlock.3ssl.gzCRYPTO_THREAD_write_lock.3ssl.gzCRYPTO_atomic_add.3ssl.gzCRYPTO_clear_free.3ssl.gzCRYPTO_clear_realloc.3ssl.gzCRYPTO_free.3ssl.gzCRYPTO_free_ex_data.3ssl.gzCRYPTO_free_ex_index.3ssl.gzCRYPTO_get_alloc_counts.3ssl.gzCRYPTO_get_ex_data.3ssl.gzCRYPTO_get_ex_new_index.3ssl.gzCRYPTO_get_mem_functions.3ssl.gzCRYPTO_malloc.3ssl.gzCRYPTO_mem_ctrl.3ssl.gzCRYPTO_mem_debug_pop.3ssl.gzCRYPTO_mem_debug_push.3ssl.gzCRYPTO_mem_leaks.3ssl.gzCRYPTO_mem_leaks_cb.3ssl.gzCRYPTO_mem_leaks_fp.3ssl.gzCRYPTO_memcmp.3ssl.gzCRYPTO_new_ex_data.3ssl.gzCRYPTO_realloc.3ssl.gzCRYPTO_secure_allocated.3ssl.gzCRYPTO_secure_clear_free.3ssl.gzCRYPTO_secure_free.3ssl.gzCRYPTO_secure_malloc.3ssl.gzCRYPTO_secure_malloc_done.3ssl.gzCRYPTO_se�x������������� �����X��(
P1����(����v!�$f����������������v!u!w!�<ppisar@redhat.com> - 4:5.24.0-375Petr Pisar <ppisar@redhat.com> - 4:5.24.0-374Petr Pisar <ppisar@redhat.com> - 4:5.24.0-373Petr Pisar <ppisar@redhat.com> - 4:5.24.0-372Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-371Petr Pisar <ppisar@redhat.com> - 4:5.24.0-370Petr Pisar <ppisar@redhat.com> - 4:5.24.0-369Petr Pisar <ppisar@redhat.com> - 4:5.24.0-368Petr Pisar <ppisar@redhat.com> - 4:5.24.0-367Petr Pisar <ppisar@redhat.com> - 4:5.24.0-366Petr Pisar <ppisar@redhat.com> - 4:5.24.0-365Petr Pisar <ppisar@redhat.com> - 4:5.24.0-364Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-363Jitka Plesnikova <jplesnik@redhat.com> - 4:5.24.0-362Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.6-361Petr Pisar <ppisar@redhat.com> - 4:5.22.1-360Petr Pisar <ppisar@redhat.com> - 4:5.22.1-359Petr Pisar <ppisar@redhat.com> - 4:5.22.1-358Petr Pisar <ppisar@redhat.com> - 4:5.22.1-357Fedora Release Engineering <releng@fedoraproject.org> - 4:5.22.1-356Petr Pisar <ppisar@redhat.com> - 4:5.22.1-355Jitka Plesnikova <jplesnik@redhat.com> - 5.22.1-354Petr Pisar <ppisar@redhat.com> - 4:5.22.0-353Petr Pisar <ppisar@redhat.com> - 4:5.22.0-352Petr Pisar <ppisar@redhat.com> - 4:5.22.0-351Petr Pisar <ppisar@redhat.com> - 4:5.22.0-350Petr Pisar <ppisar@redhat.com> - 4:5.22.0-349Petr Pisar <ppisar@redhat.com> - 4:5.22.0-348Petr Pisar <ppisar@redhat.com> - 4:5.22.0-347Petr Pisar <ppisar@redhat.com> - 4:5.22.0-346Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.22.0-345Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-244Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-243Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-242Jitka Plesnikova <jplesnik@redhat.com> - 4:5.22.0-241Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-328Petr Šabata <contyk@redhat.com> - 4:5.20.2-327Petr Šabata <contyk@redhat.com> - 4:5.20.2-326Petr Pisar <ppisar@redhat.com> - 4:5.20.2-325Lubomir Rintel <lkundrak@v3.sk> - 4:5.20.2-324Petr Pisar <ppisar@redhat.com> - 4:5.20.2-323Till Maas <opensource@till.name> - 4:5.20.2-322Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-321Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.2-320Petr Pisar <ppisar@redhat.com> - 4:5.20.1-319Petr Pisar <ppisar@redhat.com> - 4:5.20.1-318Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-317Petr Pisar <ppisar@redhat.com> - 4:5.20.1-316Petr Pisar <ppisar@redhat.com> - 4:5.20.1-315Petr Pisar <ppisar@redhat.com> - 4:5.20.1-314Petr Pisar <ppisar@redhat.com> - 4:5.20.1-313Petr Pisar <ppisar@redhat.com> - 4:5.20.1-312Petr Pisar <ppisar@redhat.com> - 4:5.20.1-311Petr Pisar <ppisar@redhat.com> - 4:5.20.1-310Petr Šabata <contyk@redhat.com> - 4:5.20.1-309Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.1-308Petr Pisar <ppisar@redhat.com> - 4:5.20.0-307Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-306Jitka Plesnikova <jplesnik@redhat.com> - 4:5.20.0-305Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-304Petr Pisar <ppisar@redhat.com> - 4:5.18.2-303Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-302Petr Pisar <ppisar@redhat.com> - 4:5.18.2-301Petr Pisar <ppisar@redhat.com> - 4:5.18.2-300Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.2-299Petr Pisar <ppisar@redhat.com> - 4:5.18.2-298Petr Pisar <ppisar@redhat.com> - 4:5.18.2-297Petr Pisar <ppisar@redhat.com> - 4:5.18.2-296Petr Pisar <ppisar@redhat.com> - 4:5.18.2-295Petr Pisar <ppisar@redhat.com> - 4:5.18.2-294Petr Pisar <ppisar@redhat.com> - 4:5.18.2-293Petr Pisar <ppisar@redhat.com> - 4:5.18.2-292Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.2-291Petr Pisar <ppisar@redhat.com> - 4:5.18.1-290Petr Pisar <ppisar@redhat.com> - 4:5.18.1-289Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-288Jitka Plesnikova <jplesnik@redhat.com> - 4:5.18.1-287Fedora Release Engineering <rel-eng@lists.fedoraproject.org> - 4:5.18.0-286Petr Pisar <ppisar@redhat.com> - 4:5.18.0-285Petr Pisar <ppisar@redhat.com> - 4:5.18.0-284Petr Pisar <ppisar@redhat.com> - 4:5.18.0-283Petr Pisar <ppisar@redhat.com> - 4:5.18.0-282�x�������������X������XG|�(
�5�����{������jd�����$z����������������jdkdid�its.3ssl.gzRSA_set0_crt_params.3ssl.gzRSA_set0_factors.3ssl.gzRSA_set0_key.3ssl.gzRSA_set0_multi_prime_params.3ssl.gzRSA_set_default_method.3ssl.gzRSA_set_ex_data.3ssl.gzRSA_set_flags.3ssl.gzRSA_set_method.3ssl.gzRSA_sign.3ssl.gzRSA_sign_ASN1_OCTET_STRING.3ssl.gzRSA_size.3ssl.gzRSA_test_flags.3ssl.gzRSA_verify.3ssl.gzRSA_verify_ASN1_OCTET_STRING.3ssl.gzSCRYPT_PARAMS_free.3ssl.gzSCRYPT_PARAMS_new.3ssl.gzSCT_LIST_free.3ssl.gzSCT_LIST_print.3ssl.gzSCT_LIST_validate.3ssl.gzSCT_free.3ssl.gzSCT_get0_extensions.3ssl.gzSCT_get0_log_id.3ssl.gzSCT_get0_signature.3ssl.gzSCT_get_log_entry_type.3ssl.gzSCT_get_signature_nid.3ssl.gzSCT_get_source.3ssl.gzSCT_get_timestamp.3ssl.gzSCT_get_validation_status.3ssl.gzSCT_get_version.3ssl.gzSCT_new.3ssl.gzSCT_new_from_base64.3ssl.gzSCT_print.3ssl.gzSCT_set0_extensions.3ssl.gzSCT_set0_log_id.3ssl.gzSCT_set0_signature.3ssl.gzSCT_set1_extensions.3ssl.gzSCT_set1_log_id.3ssl.gzSCT_set1_signature.3ssl.gzSCT_set_log_entry_type.3ssl.gzSCT_set_signature_nid.3ssl.gzSCT_set_source.3ssl.gzSCT_set_timestamp.3ssl.gzSCT_set_version.3ssl.gzSCT_validate.3ssl.gzSCT_validation_status_string.3ssl.gzSHA1.3ssl.gzSHA1_Final.3ssl.gzSHA1_Init.3ssl.gzSHA1_Update.3ssl.gzSHA224.3ssl.gzSHA224_Final.3ssl.gzSHA224_Init.3ssl.gzSHA224_Update.3ssl.gzSHA256.3ssl.gzSHA256_Final.3ssl.gzSHA256_Init.3ssl.gzSHA256_Update.3ssl.gzSHA384.3ssl.gzSHA384_Final.3ssl.gzSHA384_Init.3ssl.gzSHA384_Update.3ssl.gzSHA512.3ssl.gzSHA512_Final.3ssl.gzSHA512_Init.3ssl.gzSHA512_Update.3ssl.gzSMIME_read_CMS.3ssl.gzSMIME_read_PKCS7.3ssl.gzSMIME_write_CMS.3ssl.gzSMIME_write_PKCS7.3ssl.gzSSL_CIPHER_description.3ssl.gzSSL_CIPHER_find.3ssl.gzSSL_CIPHER_get_auth_nid.3ssl.gzSSL_CIPHER_get_bits.3ssl.gzSSL_CIPHER_get_cipher_nid.3ssl.gzSSL_CIPHER_get_digest_nid.3ssl.gzSSL_CIPHER_get_handshake_digest.3ssl.gzSSL_CIPHER_get_id.3ssl.gzSSL_CIPHER_get_kx_nid.3ssl.gzSSL_CIPHER_get_name.3ssl.gzSSL_CIPHER_get_protocol_id.3ssl.gzSSL_CIPHER_get_version.3ssl.gzSSL_CIPHER_is_aead.3ssl.gzSSL_CIPHER_standard_name.3ssl.gzSSL_COMP_add_compression_method.3ssl.gzSSL_COMP_free_compression_methods.3ssl.gzSSL_COMP_get0_name.3ssl.gzSSL_COMP_get_compression_methods.3ssl.gzSSL_COMP_get_id.3ssl.gzSSL_CONF_CTX_clear_flags.3ssl.gzSSL_CONF_CTX_free.3ssl.gzSSL_CONF_CTX_new.3ssl.gzSSL_CONF_CTX_set1_prefix.3ssl.gzSSL_CONF_CTX_set_flags.3ssl.gzSSL_CONF_CTX_set_ssl.3ssl.gzSSL_CONF_CTX_set_ssl_ctx.3ssl.gzSSL_CONF_cmd.3ssl.gzSSL_CONF_cmd_argv.3ssl.gzSSL_CONF_cmd_value_type.3ssl.gzSSL_CTX_add0_chain_cert.3ssl.gzSSL_CTX_add1_chain_cert.3ssl.gzSSL_CTX_add1_to_CA_list.3ssl.gzSSL_CTX_add_client_CA.3ssl.gzSSL_CTX_add_client_custom_ext.3ssl.gzSSL_CTX_add_custom_ext.3ssl.gzSSL_CTX_add_extra_chain_cert.3ssl.gzSSL_CTX_add_server_custom_ext.3ssl.gzSSL_CTX_add_session.3ssl.gzSSL_CTX_build_cert_chain.3ssl.gzSSL_CTX_callback_ctrl.3ssl.gzSSL_CTX_check_private_key.3ssl.gzSSL_CTX_clear_chain_certs.3ssl.gzSSL_CTX_clear_extra_chain_certs.3ssl.gzSSL_CTX_clear_mode.3ssl.gzSSL_CTX_clear_options.3ssl.gzSSL_CTX_config.3ssl.gzSSL_CTX_ct_is_enabled.3ssl.gzSSL_CTX_ctrl.3ssl.gzSSL_CTX_dane_clear_flags.3ssl.gzSSL_CTX_dane_enable.3ssl.gzSSL_CTX_dane_mtype_set.3ssl.gzSSL_CTX_dane_set_flags.3ssl.gzSSL_CTX_decrypt_session_ticket_fn.3ssl.gzSSL_CTX_disable_ct.3ssl.gzSSL_CTX_enable_ct.3ssl.gzSSL_CTX_flush_sessions.3ssl.gzSSL_CTX_free.3ssl.gzSSL_CTX_generate_session_ticket_fn.3ssl.gzSSL_CTX_get0_CA_list.3ssl.gzSSL_CTX_get0_chain_certs.3ssl.gzSSL_CTX_get0_param.3ssl.gzSSL_CTX_get0_security_ex_data.3ssl.gzSSL_CTX_get_cert_store.3ssl.gzSSL_CTX_get_ciphers.3ssl.gzSSL_CTX_get_client_CA_list.3ssl.gzSSL_CTX_get_client_cert_cb.3ssl.gzSSL_CTX_get_default_passwd_cb.3ssl.gzSSL_CTX_get_default_passwd_cb_userdata.3ssl.gzSSL_CTX_get_default_read_ahead.3ssl.gzSSL_CTX_get_ex_data.3ssl.gzSSL_CTX_get_info_callback.3ssl.gzSSL_CTX_get_keylog_callback.3ssl.gzSSL_CTX_get_max_cert_list.3ssl.gzSSL_CTX_get_max_early_data.3ssl.gzSSL_CTX_get_max_proto_version.3ssl.gzSSL_CTX_get_min_proto_vers�x����������������X2�(
��������P'�������d�$[�����������������d�d�d����������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������x�������������x������X�(
P.���8�����G��$W����������������G�H�F��d1a16c27c56e40ff94ea316daa75d0e35a22afe2008f0044e0c3770a3cdd730363609137b9ad0a7899b555e0942ece823e760e08530cba2f13b8bc1abc64e2395058508dc460895a78e7986b103815c651512c098ae53d59ce4304040811f1e3301608edf268f649a8ffc259d9e77b4fbca1c350c2b005f49e35fb444760c3950ab1210214ab80a5fbe4107bc7682ec7e48d48b25b67b0b75925d96b7bc6ccd94e332ca0b3597d13c034130e6bba8b9229acfa20f13a4c5e2a14726eb46f8cfb3c91ec01a757b7945d538b6a42edb855580cb23b50dc259e6b84ecbc04139ad157a559a6850925f02fcf5ae176264972f40e6f08c00100ba75ad5b0c0493cfcd4f6e534a57455453b0cde818a7fd60790b81633a323cdca6a6a9cf56edc5ae1fcfc8e77af7d16e0ee29ac2a1717d8bcf6e1300b09ed57ec4117c0b3b97ff3b51803cf3011d715656917b5acabd569bfc5ee6a95ea9033ae4b1887afb4802f440786d9d72ed729513fbbe36bcfb6a41d70f1e90da59b554c7cdb5f82b12f669aecd41116a2cc9501250eb70431f3b909a9a22a348159e91f14f42187f533afce1dfe8e158b0069fd58dd2772b3a4d4ae416c6c2243abdd41b9a8fee9b55dec588eea893a2714351e7f1f5b09a79ba85e4a899d070c814fbc3a824a337b62875815374a0fb5245d975e68e5a2a56dad858a88287a99295159678488ce84f9626c9f7797d00423169e711d2dcaa2ba01270b7e8f6a73672751bbe44746d601d5c06035b21656d091904fbf355e4e2bfea64de702ee3888df6e0bd10baa1458acfb3649aee1184a2dd28d5bedcc31e5d0cc0dd7c6922a0242fa8adf185cf4487a8a0c840554a6f3194943252aa5a3a9afd57e7c21dd49b8cde337e8d9ac730d8c6ce3f23e881e79d775d14871a6e92f4e5901d44cfd205f743245ddb126f031b2aa68f4610b40fcea789468e454d20b4f4296a5d49bcf55786459c3fe30655fc20e136d1b51961e6132cc42c1afbd6d94d1fa5888160634fd79a49262169f1534a5731e800ae85a472633b64d5aa2f86d930881fcdef53eee786658fa8fc80809f03253a431c1e7a64b1fd60933e42aa83db3f5a2ebc830ead61968179f2b37db76613a6a95171b17818b305ee4eea4407831aa17a9221e315f4fe241e80dea655267111b59ef1e17368d1f970020f1932d304723152287c5def42ea0516de51cb06ae2a7fbbaca1b3f363327919104d7f68fe9fdfacb774f081eec4013d89c38c4cdb800556c640c2ede43b5a3dca1f20206fb1b4fa3b3b5e77f39491a13345f10bbf2a59a8597098911949dc0e08acf5b3aa7730f16c111fe617d7a74c5477815af4810364bc33f572726badb303b7793dc898672bfcc2be6772747e221bb5ac6a0581d480244c8fc9092fbdfeac4210584b0c8554205d079073003562f8a1499ef4f9e48632753863d2604ff9f0c2dafa2fa62522d2021e1af85186b6958d7130478a57bcd77f568beedd206e56189a13bb311740c9e4cf8c38cc30640d947cadf6bcfb02b034e02cdf5dadda0a80260b3d47b0fe35506e4a2b2b0fc8921010c0e4cebf9e8bdc9776056fdf8b89b5afb39432c532c19feff14c4c9f6263a2360f949cfa80d47aa6033a3ded0c7e084dddc68c746399c8848298370e796bdd357c4248b224b3d32c793f71b047dc1c8a201b11636f042e221f51792e98fa0ac66e0d07937e287ea56b4429fbb4215d64c31107bceb1c9e6cd22d85a692ba63d2b12a9e4e6866ffa0be93409195bf59b2ee80d048f455105b4a665330beae53ead0b863a8cb4c7b9cb41f64db8263a76b5d803a5330acdee9e968ace8cf90322f629ffb0f541225e6499000be08d110a2da980f3e857f7bbd5647ddf5549546430326cf5f6773aea0b6b6c9c91089bb2043f2747510415efe68884c06ef81c34fc1707a460d861592975543ebfa8a7436972f62363b4a2a57f81e8a5eddcfd4331753c5596118f5e6405de7ddf806dafea8a0f2cda0de441bb18d5a8f4c044b3b7562a5a0cac9d4ce56ae9e06ca6f8c06318f1d60ac2e8f84d27f340306d8b2588ccacfadf52815dcb093f1d07cc5740493ef8b96799c0836534434a56c0f3b4856e150e1376a4f3a6bb811aa5d2b398277ea71ea5695e7ebf4c5097ab84f308c5ed222c0efe0c0234a1d9f9e1d850ee0538cd4eb1273f9452c89d6fe8948ba7b403c3f684968ae0a1c12f4b18adeca9e333ae17dbe45a17d8799a4207e3780ae2bd52914f40d97b9b48afe3cd739197ecec6983d10ec8e2a1c65bd768e4510ac54719b2af2c9783826f3fb7ff36f1049db7e6e2cd92cd0e8c6cec6518e92cd982159a8bfc2db3c81f387012fe53c173796c8bba680735df4d5329af4a8f96abcfeff56037f4be5d7e82fa2f719a3bd486186b8a4a910b88bd8a503ee4f077b3c36fdc8e450fda74f899bacbc887c24fe374c2d2c0e6c673684dce91a9900a274502f574b935e7f4f89489dcfbcdc6ae8ea727fbb6026fd6030901ccc709a99e05aee2932e466b928758add67d30be9d6cb5974c7ed3f6200f0d805f0e67c41b123123e891dfb98272c1c7cfe17cfecfafd12a59e5df8a185315b38cd303ae7d0d5a3fca946e1a4d989df7e761cf0c82f025f92253a9f8d283c203a80357167c9915c8121b669fe5c783845b4f38e30ee938088a7431126388158736d379e321d09b2f7b950be7d9d8447af6ec48a2516e8ad8a796373e6f89224d587767de5719578845efa4c02436199bfaf2daa2ef7353075ed9d9377d8e12924f67a42d39fa8605229b57f78df30fb7fbd74c6c5cd06b12�x��������������������X�(
��������������V�$�����������������V%�V�//usr/share/perl5/Pod//usr/share/perl5/Search//usr/share/perl5/Term//usr/share/perl5/Text//usr/share/perl5/Thread//usr/share/perl5/Tie//usr/share/perl5/Time//usr/share/perl5/Unicode//usr/share/perl5/User//usr/share/perl5/encoding//usr/share/perl5/overload//usr/share/perl5/pod//usr/share/perl5/warnings/-O2 -g -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu�x�������������h������X��(
� ����������/��$?����������������/�0�.��t temporarily to build new GDBM- Correct perl-CGI list of Provides
- Make tests optional
- Correct perl-ExtUtils-ParseXS Provides
- Correct perl-Locale-Codes Provides
- Correct perl-Module-CoreList version
- Automate perl-Test-Simple-tests Requires version- Make gdbm support optional to bootstrap with new gdbm
- Split Carp into standalone sub-package to dual-live with newer versions
  (bug #736768)- Split Locale::Codes into standalone sub-package to dual-live with newer
  versions (bug #717863)- perl needs to own vendorarch/auto directory- Move xsubpp to ExtUtils::ParseXS (#728393)- fix Compress-Raw-Bzip2 pacakging
- ensure that we never bundle bzip2 or zlib- remove from provides MODULE_COMPAT 5.12.*- Have perl-Module-Build explicitly require perl(CPAN::Meta) >= 2.110420,
  needed for creation of MYMETA files by Build.PL; the dual-life version of
  the package already has this dependency- Temporarily provide 5.12.* MODULE_COMPAT- fix escaping of the __provides_exclude_from macro- Parse-CPAN-Meta explicitly requires CPAN::Meta::YAML and JSON::PP
- Exclude CPAN::Meta* from CPAN sub-package
- Don't try to normalize CPAN-Meta, JSON-PP, and Parse-CPAN-Meta versions;
  their dual-life packages aren't and have much higher numbers already- update macros -> add %perl_bootstrap 1 and example for readability
- add into Module::Build dependency on perl-devel (contains macros.perl)
- create new sub-package macros, because we need macros in minimal buildroot- remove from macros BSD, because there exists BSD::Resources- remove old MODULE_COMPATs- move ptargrep to Archive-Tar sub-package
- fix version numbers in last two changelog entries- add provide for perl(:MODULE_COMPAT_5.14.1)- update to 5.14.1 - no new modules, just serious bugfixes and doc
- switch off fork test, which is failing only on koji- try to update to latest ExtUtils::MakeMaker, no luck -> rebuild with current 
  version, fix bug RT#67618 in modules- filter even Mac:: requires, polish filter again for correct installation
- add sub-package Compress-Raw-Bzip2, solve Bzip2 conflicts after install
- and add IO::Uncompress::Bunzip2 correctly into IO-Compress- Perl 5.14 mass rebuild, bump release, remove releases in subpackages- Perl 5.14 mass rebuild- Perl 5.14 mass rebuild- add new sub-packages, remove BR in them- arm can't do parallel builds
- add require EE::MM into IPC::Cmd 711486- test build of released 5.14.0
- remove Class::ISA from sub-packages
- patches 8+ are part of new release
- remove vendorarch/auto/Compress/Zlib- add provides UNIVERSAL and DB back into perl- Remove rpath-make patch because we use --enable-new-dtags linker option- 692900 - lc launders tainted flag, RT #87336- Cwd.so go to the PathTools sub-package- sub-package Path-Tools- sub-package Scalar-List-Utils- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Document ExtUtils::ParseXS upgrade in local patch tracking- update ExtUtils::ParseXS to 2.2206 (current) to fix Wx build- Make %global perl_default_filter lazy
- Do not hard-code tapsetdir path- added systemtap tapset to make use of systemtap-sdt-devel
- added an example systemtap script- stable update 5.12.3
- add COMPAT- 463773 revert change. txt files are needed for example by UCD::Unicode,
 PDF::API2,...- required systemtap-sdt-devel on request in 661553- create sub-package for CGI 3.49- Sub-package perl-Class-ISA (bug #651317)- Make perl(ExtUtils::ParseXS) version 4 digits long (bug #650882)- 643447 fix redefinition of constant C in h2ph (visible in git send mail,
  XML::Twig test suite)
- remove ifdef for s390- Package Test-Simple tests to dual-live with standalone package (bug #640752)- remove removal of NDBM- Consolidate Requires filtering
- Consolidate libperl.so* Provides- filter useless requires, provide libperl.so- Reformat perl-threads description
- Fix threads directories ownership- sub-package threads- add vendor path, clean paths in Configure in spec file
- create sub-package threads-shared- Do not leak when destroying thread (RT #77352, �x�������������������X��(
x����(�����n!�$~����������������n!m!o!�2217db821298733b0c4b31adedaeb875e4256be86ccbacf38e1b8545eb3b683afe5c623a98ef4a5a2cc139c2da85027884f9998a75f04c8efc02b36e23ecccb724a4bced7a0538caab1a99f951b9fc7830eb262c8b3ed30919c1ef2ac2c1530c5734a8f94f0839ce9d4debe4ef304c4004ebca58269b749062367a9801b324a794df4f15fb3495e020c2ea5e192eb7e0629d1005fdede840d2fda8a349f122c63453737b3c5cbe31f17c3bc7b63f35172166e7c017903fffe10928eac9d9edcd67aa44d2bc5f1254a86b325ecdb675ea5936c00134258ec473000a46f9dbb01564061bff36f02aa576688b336a4da41df9ff225adf990d004034c885b94c7b4f2fc2cda8b2588331eecbcdd71d95d89b64a7ccc39872cd5a6a55b1d63a4a96f50554f15098ed039a382e8bd5ec7d302535256ce11041d1d4c1479edecc293960e1836e1531ad52dd96b4d2c15f3e40421e66f85ce08887a4a1f135aee858247e4ecaeb214aab18645db2dc271897a7bceb2f0229f34f67d3c2125f4228457728689c0fb654559b71b69584977c5470eb8d36e3021da6e397dadcdce8e4ca5ad799967c7d42b415632f66cbb36e0d599cfe2e227d8dad5d741e23a3a1fe770658ec8770332d5628245d98014cd7cfe0fe91a4d2a0fb12799b1501b2b32ddb7d38818ba7fabccc1b9d0cd6d0e64386c09f20e7e3e9a772b5f8984d57c1ff52eb448cae3f87d44c3be93c227c4cd1be88cd6673725fae7c2b3e6a4d7ad739b4f8c0617b0d9c20fc75687e31dc1b93a55f10f04b9ca9b61e9e1396d87a40adb30cc8dc1a4947e6e6550208932d5eb1d38ec300e92704f922284f9165b691eed8e3b081611314fd1cbd57a2b4b3725b02c31a8fb04cceafc0c99dfef6595983c3bbc47885630bc8cfb18d352c774e8d5fa39996460d07fd8f22bc330d8eeab675cf27ce3bd492e8c7e4ed2ea4df203544e5838aaad6d5779c1041efd5ee7d78b0bee1863f05eca4f1e8ac8d56d50b512153f3f407756a4e5374637f7934723ebb9ca79556cc67709f02b2416771e4ea582351936959ead016820a93d180bb97c3821e3fffbb94d217c3bf721825aadc279a31490d68ccf4a918211a6b247d74d9b7edd07f90363e46847048104137872a9336e05fc1456c31042a96584ff80dea0ff17a4fcd491f9c2ace34b98f5b86b5ac6a43160f846119b0fb849e9070eb1259d0b920fad097d12f01c8000d72e0a12f2a756e9f64dd575e438116d48d811a04bd072d49c420f83413dadfcc366baa93018e4f605fc25813a2fe14734355b534e1de73b10c109271da60982ea0adcd5c71ea95b675cf98b4904ef0db95291e974751abdd36f90666615b78ce45476225aadb87bbc9a58dcdcb06517072cd997b7bcde23c88ef4bc764d2c43acd6c48044cdef5049f436a089e6a6a8b38d5d651ba34b4906c67838c10bb8cb4635267f2441ce69034379ba619d9b4e003e82332f5c6ea00ae084f26c3e7f7391dd8410b6bb6f47c43f683db8818f686461d342feb22282ead8ba6288c38df710d64ee619711710d1c37f2c97f17b050f111db26568b35802afaa0c1dd5ac35fcb458f6c6aeaec0993c97a30df076b50c333bea42beaa6d7e5536fbe2ec1f4cc6fdac5c3ce8b3e15b06b3f34203d719acbae5560c501fc51cfee1522cdcef874e6161738d3e72054aafd892c3990287185e4d30eb31e7331609b6a2b9d1a8a07ef73240b271681b3cbbde2ac2e4cf43ca7c2beed36bf5d040c924ce20e98b0ae0f02a8cc2e8cf01bad2b829b7c4cab3f9ce148a3455396663e3ac1ec56d022283fc9d65814c5f105b07dd6a22b403d260b955a6ecda30c54db7ab6681d259b70233ba4c0189829aac943fc8c60d61ce2e89c84e561b9b227ec8ce10b862330ea45f1acd6d6a65305d2247204b620a957305d1017f8a7fa030ed66a3dfb392268f6a53464c3167d925b758bc9c2753a65c27c4cdea987221181ce668071202ea4550d173ed912dda51152795e4cd44becdedde9166a9a3158a6c4dcef0f1f5a3344a5254a3d6958dc40cb2b4799b35fe539bc0994ef8a4ad60ef2718a66d1632aba9d26c0ee6ca22acfedf5d219f0543df72db8b1d06434a1781a3800569cbcbe13cdcd5f39d0e5468f9ce7bb3c6ac597b44942a90f58561c10c3cc76b2d0825a3faf1e12c87b9fb0311c0d007a956bb1a814696ac861b12f433fc1198e960b5df18ce93f5e4352a7e80981b5d0c4efbb58d974286896e3b4277e1e85cfb42bec57958e843c7e8c766f5e56a50cd7e85bf61162ee3db28b6bb9466f3e1cb31eb2a676d51dff6c19d107de4c5adbea622d40e3ea668fd1424291cc26021569d17985b031c84a0075778bcc0e0b81eee5789e40aaed71dbd06533f2f9fe6475c1251f77ecf26737a3e04f666728d34b9566e0029287bfdfefe0b7afc5d64faffc757ee00bddf6a9cee2f5a1b7e0a4aa59951f8ad9eda5a956e9dc583c26df829d1ee27cad076fc8d613381859f706de3d9acb104a3064b1e8bbb5f122389d848db6cdbc3c55d9f76ee49f5afe754a58ef084fa2637c5cd532cd9de7481225fac328548cceb39b1916940e7c0c913144669f8597f454bc4ba80a236c6f7f795203c51896323b921fc863f4543be874e05644d0bd3a0c8d95369c68252c64c50f0ed6f628df163d0f86cf9f7a9ce1e33c150c0c3856607244f3d37a3f398e61ebe725c766f7e6bac4eed24c03a445eb4c612a42575501279e9707b8931f337b7ddb9048f751c2f4b179f874ea2938eb638e2f33bbccbf9f147f2724841064cdc8d0e9e2740811�x�������������X������X:�(
��������������$k�����������������������tional support for managed_irq
  Resolves: rhbz#1797025- profiles: renamed sst profile to intel-sst
  related: rhbz#1743879- Add accelerator-performance profile
- Resolves: rhbz#1795604- tuned-profiles-nfv-host: added ncat requirement
  resolves: rhbz#1779117- profiles: define variables before use
  resolves: rhbz#1788102- new release
  - rebased tuned to latest upstream
    related: rhbz#1738250
  - sap-hana: updated tuning
    resolves: rhbz#1779821
  - latency-performance: updated tuning
    resolves: rhbz#1779759- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1738250
  - cpu: fixed checking if EPB is supported
    resolves: rhbz#1690929
  - scheduler: fixed IRQ SMP affinity verification to respect ignore_missing
    resolves: rhbz#1729936
  - realtime: enabled ktimer_lockless_check
    resolves: rhbz#1734096
  - plugins: support cpuinfo_regex and uname_regex matching
    resolves: rhbz#1748965
  - sysctl: made reapply_sysctl ignore configs from /usr
    resolves: rhbz#1759597
  - added support for multiple include directives
    resolves: rhbz#1760390
  - realtime: added nowatchdog kernel command line option
    resolves: rhbz#1767614- used C-states in latency specification
  related: rhbz#1737628- plugin_cpu: latency can be now specified as C-state
  resolves: rhbz#1737628- new release
  - rebased tuned to latest upstream
    related: rhbz#1685585- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1685585
  - sap-netweaver: changed values of kernel.shmall and kernel.shmmax to RHEL-8 defaults
    resolves: rhbz#1708418
  - sap-netweaver: changed value of kernel.sem to RHEL-8 default
    resolves: rhbz#1701394
  - sap-hana-vmware: dropped profile
    resolves: rhbz#1715541
  - s2kb function: fixed to be compatible with python3
    resolves: rhbz#1684122
  - do fallback to the powersave governor (balanced and powersave profiles)
    resolves: rhbz#1679205
  - added support for negation of CPU list
    resolves: rhbz#1676588
  - switched from sysctl tool to own implementation
    resolves: rhbz#1666678
  - realtime-virtual-host: added tsc-deadline=on to qemu cmdline
    resolves: rhbz#1554458
  - fixed handling of devices that have been removed and re-attached
    resolves: rhbz#1677730- Fixed disk plugin to correctly match devices with python3
  Resolves: rhbz#1676513- Updated mssql tuning
  Resolves: rhbz#1660178- Fix excessive CPU usage in the scheduler plugin
- Resolves: rhbz#1659140- Added workaround for s390x zipl not supporting multiple initrds
  Related: rhbz#1576435- Added support for BLS
  Resolves: rhbz#1576435- Reworked setup_kvm_mod_low_latency to count with kernel changes
  Resolves: rhbz#1653819- realtime-virtual-guest/host: start/stop rt-entsk daemon on
  initialization/shutdown
  resolves: rhbz#1619822- Disable ksm once, re-enable it on full rollback
  Resolves: rhbz#1652076- Make python3-dmidecode a weak dependency as it's x86_64 only
- Resolves: rhbz#1565598- Fix rules for profile recommendation
- Resolves: rhbz#1565598- use online CPUs for cpusets calculations instead of present CPUs
  resolves: rhbz#1613832- Fix a traceback in tuned-gui- tuned-adm: Fix a traceback when run without action specified- used python intepreter path from the rpm macro- new release
  - rebased tuned to latest upstream
    related: rhbz#1546598
  - IRQ affinity handled by scheduler plugin
    resolves: rhbz#1590937- new release
  - rebased tuned to latest upstream
    resolves: rhbz#1546598
  - script: show stderr output in the log
  - realtime-virtual-host: script.sh: add error checking
  - man: improved tuned-profiles-cpu-partitioning.7
  - bootloader: check if grub2_cfg_file_name is None in _remove_grub2_tuning()
  - plugin_scheduler: whitelist/blacklist processed also for thread names
  - bootloader: patch all GRUB2 config files
  - profiles: added mssql profile
  - tuned-adm: print log excerpt when changing profile
  - cpu-partitioning: use no_balance_cores instead of no_rebalance_cores
  - sysctl: support assignment modifiers as�x�������������І�����X�(
�>���������gd�$w����������������gdhdfd�0_alpn_selected.3ssl.gzSSL_get0_chain_certs.3ssl.gzSSL_get0_dane_authority.3ssl.gzSSL_get0_dane_tlsa.3ssl.gzSSL_get0_next_proto_negotiated.3ssl.gzSSL_get0_param.3ssl.gzSSL_get0_peer_CA_list.3ssl.gzSSL_get0_peer_scts.3ssl.gzSSL_get0_peername.3ssl.gzSSL_get0_security_ex_data.3ssl.gzSSL_get0_session.3ssl.gzSSL_get0_verified_chain.3ssl.gzSSL_get1_curves.3ssl.gzSSL_get1_groups.3ssl.gzSSL_get1_session.3ssl.gzSSL_get1_supported_ciphers.3ssl.gzSSL_get_SSL_CTX.3ssl.gzSSL_get_all_async_fds.3ssl.gzSSL_get_changed_async_fds.3ssl.gzSSL_get_cipher.3ssl.gzSSL_get_cipher_bits.3ssl.gzSSL_get_cipher_list.3ssl.gzSSL_get_cipher_name.3ssl.gzSSL_get_cipher_version.3ssl.gzSSL_get_ciphers.3ssl.gzSSL_get_client_CA_list.3ssl.gzSSL_get_client_ciphers.3ssl.gzSSL_get_client_random.3ssl.gzSSL_get_current_cipher.3ssl.gzSSL_get_default_passwd_cb.3ssl.gzSSL_get_default_passwd_cb_userdata.3ssl.gzSSL_get_default_timeout.3ssl.gzSSL_get_early_data_status.3ssl.gzSSL_get_error.3ssl.gzSSL_get_ex_data.3ssl.gzSSL_get_ex_data_X509_STORE_CTX_idx.3ssl.gzSSL_get_extms_support.3ssl.gzSSL_get_fd.3ssl.gzSSL_get_info_callback.3ssl.gzSSL_get_key_update_type.3ssl.gzSSL_get_max_cert_list.3ssl.gzSSL_get_max_early_data.3ssl.gzSSL_get_max_proto_version.3ssl.gzSSL_get_min_proto_version.3ssl.gzSSL_get_mode.3ssl.gzSSL_get_num_tickets.3ssl.gzSSL_get_options.3ssl.gzSSL_get_peer_cert_chain.3ssl.gzSSL_get_peer_certificate.3ssl.gzSSL_get_peer_signature_nid.3ssl.gzSSL_get_peer_signature_type_nid.3ssl.gzSSL_get_peer_tmp_key.3ssl.gzSSL_get_pending_cipher.3ssl.gzSSL_get_psk_identity.3ssl.gzSSL_get_psk_identity_hint.3ssl.gzSSL_get_quiet_shutdown.3ssl.gzSSL_get_rbio.3ssl.gzSSL_get_read_ahead.3ssl.gzSSL_get_record_padding_callback_arg.3ssl.gzSSL_get_recv_max_early_data.3ssl.gzSSL_get_rfd.3ssl.gzSSL_get_secure_renegotiation_support.3ssl.gzSSL_get_security_callback.3ssl.gzSSL_get_security_level.3ssl.gzSSL_get_selected_srtp_profile.3ssl.gzSSL_get_server_random.3ssl.gzSSL_get_server_tmp_key.3ssl.gzSSL_get_servername.3ssl.gzSSL_get_servername_type.3ssl.gzSSL_get_session.3ssl.gzSSL_get_shared_ciphers.3ssl.gzSSL_get_shared_curve.3ssl.gzSSL_get_shared_group.3ssl.gzSSL_get_shared_sigalgs.3ssl.gzSSL_get_shutdown.3ssl.gzSSL_get_sigalgs.3ssl.gzSSL_get_signature_nid.3ssl.gzSSL_get_signature_type_nid.3ssl.gzSSL_get_srtp_profiles.3ssl.gzSSL_get_ssl_method.3ssl.gzSSL_get_state.3ssl.gzSSL_get_time.3ssl.gzSSL_get_timeout.3ssl.gzSSL_get_tlsext_status_ocsp_resp.3ssl.gzSSL_get_tlsext_status_type.3ssl.gzSSL_get_tmp_key.3ssl.gzSSL_get_verify_callback.3ssl.gzSSL_get_verify_depth.3ssl.gzSSL_get_verify_mode.3ssl.gzSSL_get_verify_result.3ssl.gzSSL_get_version.3ssl.gzSSL_get_wbio.3ssl.gzSSL_get_wfd.3ssl.gzSSL_has_matching_session_id.3ssl.gzSSL_has_pending.3ssl.gzSSL_in_accept_init.3ssl.gzSSL_in_before.3ssl.gzSSL_in_connect_init.3ssl.gzSSL_in_init.3ssl.gzSSL_is_dtls.3ssl.gzSSL_is_init_finished.3ssl.gzSSL_is_server.3ssl.gzSSL_key_update.3ssl.gzSSL_library_init.3ssl.gzSSL_load_client_CA_file.3ssl.gzSSL_load_error_strings.3ssl.gzSSL_new.3ssl.gzSSL_peek.3ssl.gzSSL_peek_ex.3ssl.gzSSL_pending.3ssl.gzSSL_psk_client_cb_func.3ssl.gzSSL_psk_find_session_cb_func.3ssl.gzSSL_psk_server_cb_func.3ssl.gzSSL_psk_use_session_cb_func.3ssl.gzSSL_read.3ssl.gzSSL_read_early_data.3ssl.gzSSL_read_ex.3ssl.gzSSL_renegotiate.3ssl.gzSSL_renegotiate_abbreviated.3ssl.gzSSL_renegotiate_pending.3ssl.gzSSL_rstate_string.3ssl.gzSSL_rstate_string_long.3ssl.gzSSL_select_current_cert.3ssl.gzSSL_select_next_proto.3ssl.gzSSL_session_reused.3ssl.gzSSL_set0_CA_list.3ssl.gzSSL_set0_chain.3ssl.gzSSL_set0_chain_cert_store.3ssl.gzSSL_set0_rbio.3ssl.gzSSL_set0_security_ex_data.3ssl.gzSSL_set0_verify_cert_store.3ssl.gzSSL_set0_wbio.3ssl.gzSSL_set1_chain.3ssl.gzSSL_set1_chain_cert_store.3ssl.gzSSL_set1_client_sigalgs.3ssl.gzSSL_set1_client_sigalgs_list.3ssl.gzSSL_set1_curves.3ssl.gzSSL_set1_curves_list.3ssl.gzSSL_set1_groups.3ssl.gzSSL_set1_groups_list.3ssl.gzSSL_set1_host.3ssl.gzSSL_set1_param.3ssl.gz�x�������������Hv�����X��(
xu����������W�$k�����������������W�W�W�ns@usemail.com>Jason Spangler <jasons@usemail.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>Erik Troan <ewt@redhat.com>- Resolves: #1711119 - netstat says "packetes" instead of "packets"
- Resolves: #1670355 - Exit code on wrong parameter is zero for many net-tools binaries
- Resolves: #1807989 - The output of `route -A inet6` does not display properly when the 'Use' column output is over 6 digits- Resolves: #1607010 - Please review important issues found by covscan- Resolves: 1557470 - netstat -i cut's interface names
- Resolves: 1566084 - netstat -agn only shows 10 character interface name for IPv4 addressing- Escape macros in %changelog- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Link mii-diag with $RPM_LD_FLAGS- removing dependencies on systemd-units from spec file- Resolves: #1478868 - netstat(8) portion on Timer needs writing- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Resolves: #1414765 - ifconfig inaccurately rounds exabytes- fix build on linux-4.8- latest upstream snapshot- just few nitpicks :)- latest upstream snapshot
- adding HAVE_PLIP_TOOLS=1, HAVE_SERIAL_TOOLS=1, HAVE_ARP_TOOLS=1 into net-tools-config.h and net-tools-config.make
- commenting out "%{buildroot}%{_mandir}/man8/rarp.8*" and its language alternatives in spec
- adding "rm -rf %{buildroot}%{_mandir}/pt/man5" in spec- Rebuilt for https://fedoraproject.org/wiki/Fedora_24_Mass_Rebuild- ether-wake: add interface into message (#1149502)
- latest upstream snapshot (ipx.patch & sctp-statistics.patch merged)- latest upstream snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_23_Mass_Rebuild- latest upstream snapshot- latest upstream snapshot (#1162284)- ether-wake: apply Debian's hardening patch- latest upstream snapshot (#1149405)- Enable bluetooth- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- fix license handling- latest upstream snapshot- __global_ldflags -> RPM_LD_FLAGS, optflags -> RPM_OPT_FLAGS- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- output sctp endpoints without -a parameter (#1063913)- remake sctp-quiet.patch (#1063906#c7)- make sctp quiet on systems without sctp (#1063906)- move ifconfig and route back to sbin (#1045445)- make mii-diag compile with -Werror=format-security (#1037218)- latest snapshot (#1021109)- use different compiler/linker flags macros- install binaries into /usr/bin and /usr/sbin (#1016674)- latest snapshot- remove %ifarch alpha condition from %prep
- improve sctp-statistics.patch (#982638#c10)- latest snapshot- amend ether-wake-interfaces.patch- use all interfaces instead of default (#1003875)
- reverted all changes on ether-wake.c and put original file- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- latest snapshot- latest snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- latest snapshot (#579855)- fix URL- match actual license- few man page fixes- the git snapshot we ship is actually much more a
  2.0 pre-release then 1.60 post-release- compile without STRIP (Metricom radio) support- upstream git snapshot- Sparc and s390 arches need to use -fPIE- compile with PIE and full RELRO flags (#853193)- fixed building with kernel-3.6- use new systemd-rpm macros (#850225)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- fixes for #834110 and #836258 merged upstream- compile without Token ring support (http://lwn.net/Articles/497397/)- better SCTP support (#826676)- don't require hostname package- Do not show interface metric in 'ifconfig', 'ifconfig -s' and 'netstat -i'.
  Spare place is used for interface name so trim_iface.patch is no longer needed.
- No need to convert man pages to utf-8 as upstream ship them in utf-8 now.- SELinux patch merged upstream
- several page fixes merged upstr�x��������������e�����X��(
��������H�����V�$b�����������������V�V�G:L?6(d����	�	7�������������	E�]������	(
X��
H� ��D��(�8�/9�/:=/G+(H+�I+�X,Y,\,4],�^.b/Id0�e0�f0�l0�t0�u1v1|w4xx4�y58(�5��5��5��6$686<�7�8�
9�9��:$:(:@g:Dh:HCkeyutils1.5.109.el8Linux Key Management UtilitiesUtilities to control the kernel key management facility and to provide
a mechanism by which the kernel call back to user space to get a key
instantiated.a`L�b389c026f4f3�AlmaLinuxAlmaLinuxGPLv2+ and LGPLv2+AlmaLinux Packaging Team <packager@almalinux.org>System Environment/Basehttp://people.redhat.com/~dhowells/keyutils/linuxx86_64��H %ba���FMA
���A큤A��A�A�A�A����A큤A��A큤����������a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�a`L�Xɪ�a`L�a`L�a`L�Xɪ�a`L�a`L�a`L�a`L�a`L�87f286e86f12eb096e98663649116d375439ea0c689883ce9a3aa3a210b611cca84d85575981ffd06db4df92b7544c96fd65fe8995be420bffa3f212a2770d226ae0756f059490fd0d2b74fa6ed4bbeb6e17ff5c23873c4816f1fc2583498ebdb31ce842cfb9e4d33f0c1ac2d17f5b2b4d5339356d060ea429374b39a8254501f128299d9fa838f3bd786510636cfe4673289a6cc99b7f5bffb752de03d4ec84a38d3de7932c6ba13193bd985e0bc9918f8a514fc201fd23de018a172fd5c44cf46409d4822b2457b39bbd0e7881eecb396130eb8320b7748fa7e9488970aa6de165d124adc3c6aa8cfeeaeb1921f67a8d9237cdf5f3a0e314813e2c714dab798088282b174126315d30c3be1d6325f2273c77602cd9138fd681eb2210937199d3bc30f3b8c9514809ca0e8998cb3f07a3f8f4e2db1f0583c942dddae6be07077935d283a2226a429c19794c0a0f1692cef6fff911b141f993c5b9bd7a2b257a06fa8235cb56c199f08a9bfec73b95c9853e816ba85d023022b262eaacff57ba../../../../usr/bin/keyctl../../../../usr/sbin/request-key../../../../usr/sbin/key.dns_resolver�rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkeyutils-1.5.10-9.el8.src.rpm������������������������������������������������������������������������������������������������config(keyutils)keyutilskeyutils(x86-64)@@@@@@@@@@@@@@@@@@@@



@/bin/shconfig(keyutils)keyutils-libslibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libkeyutils.so.1()(64bit)libkeyutils.so.1(KEYUTILS_0.3)(64bit)libkeyutils.so.1(KEYUTILS_1.0)(64bit)libkeyutils.so.1(KEYUTILS_1.3)(64bit)libkeyutils.so.1(KEYUTILS_1.4)(64bit)libkeyutils.so.1(KEYUTILS_1.5)(64bit)libkeyutils.so.1(KEYUTILS_1.6)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)libresolv.so.2(GLIBC_2.9)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesH�x�������������(U�����Xu�(
�@�������z������qd�$a����������������qdrdpd�_set_ec_param_enc.3ssl.gzEVP_PKEY_CTX_set_ec_paramgen_curve_nid.3ssl.gzEVP_PKEY_CTX_set_ecdh_cofactor_mode.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_md.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_outlen.3ssl.gzEVP_PKEY_CTX_set_ecdh_kdf_type.3ssl.gzEVP_PKEY_CTX_set_hkdf_md.3ssl.gzEVP_PKEY_CTX_set_mac_key.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_bits.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_primes.3ssl.gzEVP_PKEY_CTX_set_rsa_keygen_pubexp.3ssl.gzEVP_PKEY_CTX_set_rsa_mgf1_md.3ssl.gzEVP_PKEY_CTX_set_rsa_oaep_md.3ssl.gzEVP_PKEY_CTX_set_rsa_padding.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_md.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_mgf1_md.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_keygen_saltlen.3ssl.gzEVP_PKEY_CTX_set_rsa_pss_saltlen.3ssl.gzEVP_PKEY_CTX_set_scrypt_N.3ssl.gzEVP_PKEY_CTX_set_scrypt_maxmem_bytes.3ssl.gzEVP_PKEY_CTX_set_scrypt_p.3ssl.gzEVP_PKEY_CTX_set_scrypt_r.3ssl.gzEVP_PKEY_CTX_set_signature_md.3ssl.gzEVP_PKEY_CTX_set_tls1_prf_md.3ssl.gzEVP_PKEY_METHOD.3ssl.gzEVP_PKEY_asn1_add0.3ssl.gzEVP_PKEY_asn1_add_alias.3ssl.gzEVP_PKEY_asn1_copy.3ssl.gzEVP_PKEY_asn1_find.3ssl.gzEVP_PKEY_asn1_find_str.3ssl.gzEVP_PKEY_asn1_free.3ssl.gzEVP_PKEY_asn1_get0.3ssl.gzEVP_PKEY_asn1_get0_info.3ssl.gzEVP_PKEY_asn1_get_count.3ssl.gzEVP_PKEY_asn1_new.3ssl.gzEVP_PKEY_asn1_set_check.3ssl.gzEVP_PKEY_asn1_set_ctrl.3ssl.gzEVP_PKEY_asn1_set_free.3ssl.gzEVP_PKEY_asn1_set_get_priv_key.3ssl.gzEVP_PKEY_asn1_set_get_pub_key.3ssl.gzEVP_PKEY_asn1_set_item.3ssl.gzEVP_PKEY_asn1_set_param.3ssl.gzEVP_PKEY_asn1_set_param_check.3ssl.gzEVP_PKEY_asn1_set_private.3ssl.gzEVP_PKEY_asn1_set_public.3ssl.gzEVP_PKEY_asn1_set_public_check.3ssl.gzEVP_PKEY_asn1_set_security_bits.3ssl.gzEVP_PKEY_asn1_set_set_priv_key.3ssl.gzEVP_PKEY_asn1_set_set_pub_key.3ssl.gzEVP_PKEY_asn1_set_siginf.3ssl.gzEVP_PKEY_assign_DH.3ssl.gzEVP_PKEY_assign_DSA.3ssl.gzEVP_PKEY_assign_EC_KEY.3ssl.gzEVP_PKEY_assign_POLY1305.3ssl.gzEVP_PKEY_assign_RSA.3ssl.gzEVP_PKEY_assign_SIPHASH.3ssl.gzEVP_PKEY_base_id.3ssl.gzEVP_PKEY_bits.3ssl.gzEVP_PKEY_check.3ssl.gzEVP_PKEY_cmp.3ssl.gzEVP_PKEY_cmp_parameters.3ssl.gzEVP_PKEY_copy_parameters.3ssl.gzEVP_PKEY_decrypt.3ssl.gzEVP_PKEY_decrypt_init.3ssl.gzEVP_PKEY_derive.3ssl.gzEVP_PKEY_derive_init.3ssl.gzEVP_PKEY_derive_set_peer.3ssl.gzEVP_PKEY_encrypt.3ssl.gzEVP_PKEY_encrypt_init.3ssl.gzEVP_PKEY_free.3ssl.gzEVP_PKEY_gen_cb.3ssl.gzEVP_PKEY_get0_DH.3ssl.gzEVP_PKEY_get0_DSA.3ssl.gzEVP_PKEY_get0_EC_KEY.3ssl.gzEVP_PKEY_get0_RSA.3ssl.gzEVP_PKEY_get0_asn1.3ssl.gzEVP_PKEY_get0_engine.3ssl.gzEVP_PKEY_get0_hmac.3ssl.gzEVP_PKEY_get0_poly1305.3ssl.gzEVP_PKEY_get0_siphash.3ssl.gzEVP_PKEY_get1_DH.3ssl.gzEVP_PKEY_get1_DSA.3ssl.gzEVP_PKEY_get1_EC_KEY.3ssl.gzEVP_PKEY_get1_RSA.3ssl.gzEVP_PKEY_get_default_digest_nid.3ssl.gzEVP_PKEY_get_raw_private_key.3ssl.gzEVP_PKEY_get_raw_public_key.3ssl.gzEVP_PKEY_id.3ssl.gzEVP_PKEY_keygen.3ssl.gzEVP_PKEY_keygen_init.3ssl.gzEVP_PKEY_meth_add0.3ssl.gzEVP_PKEY_meth_copy.3ssl.gzEVP_PKEY_meth_find.3ssl.gzEVP_PKEY_meth_free.3ssl.gzEVP_PKEY_meth_get0.3ssl.gzEVP_PKEY_meth_get0_info.3ssl.gzEVP_PKEY_meth_get_check.3ssl.gzEVP_PKEY_meth_get_cleanup.3ssl.gzEVP_PKEY_meth_get_copy.3ssl.gzEVP_PKEY_meth_get_count.3ssl.gzEVP_PKEY_meth_get_ctrl.3ssl.gzEVP_PKEY_meth_get_decrypt.3ssl.gzEVP_PKEY_meth_get_derive.3ssl.gzEVP_PKEY_meth_get_digest_custom.3ssl.gzEVP_PKEY_meth_get_digestsign.3ssl.gzEVP_PKEY_meth_get_digestverify.3ssl.gzEVP_PKEY_meth_get_encrypt.3ssl.gzEVP_PKEY_meth_get_init.3ssl.gzEVP_PKEY_meth_get_keygen.3ssl.gzEVP_PKEY_meth_get_param_check.3ssl.gzEVP_PKEY_meth_get_paramgen.3ssl.gzEVP_PKEY_meth_get_public_check.3ssl.gzEVP_PKEY_meth_get_sign.3ssl.gzEVP_PKEY_meth_get_signctx.3ssl.gzEVP_PKEY_meth_get_verify.3ssl.gzEVP_PKEY_meth_get_verify_recover.3ssl.gzEVP_PKEY_meth_get_verifyctx.3ssl.gzEVP_PKEY_meth_new.3ssl.gzEVP_PKEY_meth_remove.3ssl.gzEVP_PKEY_meth_set_check.3ssl.gzEVP_PKEY_meth_set_cleanup.3ssl.gzEVP_PKEY_meth_set_copy.3ssl.gzEVP_PKEY_meth_set_ctrl.3ssl.gzEVP_PKEY_meth_set_decrypt.3ssl.gzEVP_PKEY_meth_set_derive.3ssl.gzEVP_PKEY_meth_set_digest_c�x��������������D�����X�(
@s������(!�d�$Z�����������������d�d�d��x�������������4�����X��(
 1������P'������,��$<����������������,�-�+��d config option -Dinc_version_list=none (#448735)
- use perl_archname consistently
- cleanup of usage of *_lib macros in %install- 449577 rebuild for FTBFS- 448392 upstream fix for assertion- sparc64 breaks with the rpath hack patch applied- 447142 upgrade CGI to 3.37 (this actually happened in -21 in rawhide.)- sparc64 fails two tests under mysterious circumstances. we need to get the
  rest of the tree moving, so we temporarily disable the tests on that arch.- create the vendor_perl/%{perl_version}/%{perl_archname}/auto directory 
  in %{_libdir} so we own it properly- fix CPANPLUS-Dist-Build Provides/Obsoletes (bz 437615)
- bump version on Module-CoreList subpackage- forgot to create the auto directory for multilib vendor_perl dirs- own multilib vendor_perl directories
- mark Module::CoreList patch in patchlevel.h- 437817: RFE: Upgrade Module::CoreList to 2.14- xsubpp now lives in perl-devel instead of perl.- back out Archive::Extract patch, causing odd test failure- add missing lzma test file- conditionalize multilib patch report in patchlevel.h
- Update Archive::Extract to 0.26
- Update Module::Load::Conditional to 0.24- only do it once, and do it for all our patches- note 32891 in patchlevel.h- get rid of bad conflicts on perl-File-Temp- use /usr/local for sitelib/sitearch dirs
- patch 32891 for significant performance improvement- Add perl-File-Temp provides/obsoletes/conflicts (#433836),
  reported by Bill McGonigle <bill@bfccomputing.com>
- escape the macros in Jan 30 entry- Autorebuild for GCC 4.3- disable some futime tests in t/io/fs.t because they started failing on x86_64
  in the Fedora builders, and no one can figure out why. :/- create %{_prefix}/lib/perl5/vendor_perl/%{perl_version}/auto and own it
  in base perl (resolves bugzilla 214580)- Update Sys::Syslog to 0.24, to fix test failures- add some BR for tests- 5.10.0 final
- clear out all the unnecessary patches (down to 8 patches!)
- get rid of super perl debugging mode
- add new subpackages- first attempt at building 5.10.0perlperl-suidperl�x��������������#�����X��(
������� ���������$Z��������������������urity -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -fexceptions -fstack-protector-strong -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -m64 -mtune=generic -fasynchronous-unwind-tables -fstack-clash-protection -fcf-protectioncpioxz2x86_64-redhat-linux-gnu	

 !!"#$%&'()********************ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=7e9ab2694d74d7806909a3870baeb6eae6ec0329, stripped, too many notes (256)ELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=32c1394bd094b3d348d5c499c7e0a469c30d254b, stripped, too many notes (256)POSIX shell script, ASCII text executableELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=041a454fb24bb87f4a680a9e44e4210f7aff9b30, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=8f493b78bb8c2a6c9ec3871bb0f664c3bb01c128, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2e4e511446305fac8274d5928a72d82fd53e3285, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=2b77967f6069c312b906edcd699b8e115de3a5d1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=cf985a1ded20cf35f4d74d8e2ab1e09449881623, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=245354ef87a746eb3951f578a1e74ce4a5ca73bc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=0772c98b0f3d47f44fd5e5360553af0301a899e9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]�x�������������������X ��(
x��������
����V�$c�����������������V�V�V�avePrefix)rpmlib(PayloadIsXz)rtld(GNU_HASH)1.5.10-9.el81.5.10-9.el83.0.4-14.6.0-14.0-15.2-14.14.3`��`��@\�f�Z}�@Zz�@Zu�@Y�@Yx�@X�,�U��@S�#@S?�RN��RL
�R7�N��N��N�T@N^"@NC�@N.�@N%q�Mx�@Ml�MP�L�K�g@K�g@K��@K���D��D��D[>@D[>@DY�C�+�C�B�C��@C��@C}�@C|p�B��B�<�BӰ�BӰ�BӰ�BӰ�David Howells <dhowells@redhat.com> - 1.5.10-9David Howells <dhowells@redhat.com> - 1.5.10-8David Howells <dhowells@redhat.com> - 1.5.10-7Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 1.5.10-6Fedora Release Engineering <releng@fedoraproject.org> - 1.5.10-5Igor Gnatenko <ignatenkobrain@fedoraproject.org> - 1.5.10-4Fedora Release Engineering <releng@fedoraproject.org> - 1.5.10-3Fedora Release Engineering <releng@fedoraproject.org> - 1.5.10-2David Howells <dhowells@redhat.com> - 1.5.10-1Adam Jackson <ajax@redhat.com> 1.5.9-7Tom Callaway <spot@fedoraproject.org> - 1.5.9-3David Howells <dhowells@redhat.com> - 1.5.9-1David Howells <dhowells@redhat.com> - 1.5.8-1David Howells <dhowells@redhat.com> - 1.5.7-1David Howells <dhowells@redhat.com> - 1.5.6-1David Howells <dhowells@redhat.com> - 1.5.5-1David Howells <dhowells@redhat.com> - 1.5.4-1David Howells <dhowells@redhat.com>David Howells <dhowells@redhat.com>David Howells <dhowells@redhat.com> - 1.5.3-1David Howells <dhowells@redhat.com> - 1.5.2-1David Howells <dhowells@redhat.com> - 1.5.1-1David Howells <dhowells@redhat.com> - 1.5-1David Howells <dhowells@redhat.com> - 1.4-4Diego Elio Pettenò <flameeyes@hosting.flameeyes.eu> - 1.4-3David Howells <dhowells@redhat.com> - 1.4-2David Howells <dhowells@redhat.com> - 1.4-1David Howells <dhowells@redhat.com> - 1.3-3David Howells <dhowells@redhat.com> - 1.3-2David Howells <dhowells@redhat.com> - 1.3-1David Howells <dhowells@redhat.com> - 1.2-1David Howells <dhowells@redhat.com> - 1.1-4David Howells <dhowells@redhat.com> - 1.1-3David Howells <dhowells@redhat.com> - 1.1-2David Howells <dhowells@redhat.com> - 1.1-1David Howells <dhowells@redhat.com> - 1.0-2David Howells <dhowells@redhat.com> - 1.0-1David Howells <dhowells@redhat.com> - 1.0-1David Howells <dhowells@redhat.com> - 0.3-4David Howells <dhowells@redhat.com> - 0.3-3David Howells <dhowells@redhat.com> - 0.3-2David Howells <dhowells@redhat.com> - 0.3-1David Howells <dhowells@redhat.com> - 0.2-2David Howells <dhowells@redhat.com> - 0.2-1David Howells <dhowells@redhat.com> - 0.1-3David Howells <dhowells@redhat.com> - 0.1-2David Howells <dhowells@redhat.com> - 0.1-1- Fix potential strcat overflow found by Coverity in CI test (#1661674).- Fix TTL handling on DNS lookups (#1661674).- Fix testsuite for rhel-8 (#1681963).- Escape macros in %changelog- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Switch to %ldconfig_scriptlets- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Include sys/types.h in keyutils.h.
- The dns resolver needs limits.h.
- Overhaul of all manual pages.
- Some manual pages moved to Linux man-pages project.
- Add Diffie-Helman keyctl function.- Pass ldflags into the build so hardening works- Fix license handling- Add manpages for get_persistent.
- Fix memory leaks in keyctl_describe/read/get_security_alloc().
- Use keyctl_describe_alloc in dump_key_tree_aux rather than open coding it.
- Exit rather than returning from act_xxx() functions.
- Fix memory leak in dump_key_tree_aux.
- Only get the groups list if we need it.
- Don't trust sscanf's %n argument.
- Use the correct path macros in the specfile.
- Avoid use realloc when the memory has no content.
- Fix a bunch of issues in key.dns_resolver.
- Fix command table searching in keyctl utility.
- Fix a typo in the permissions mask constants.
- Improve the keyctl_read manpage.
- Add man7 pages describing various keyrings concepts.- New lib symbols should go in a new library minor version.- Provide a utility function to find a key by type and name.
- Allow keyctl commands to take a type+name arg instead �x�����������`�����X0�(
�_��������%��$5����������������%�&�V�odlib.podperlmodstyle.podperlmroapi.podperlnetware.podperlnewmod.podperlnumber.podperlobj.podperlootut.podperlop.podperlopenbsd.podperlopentut.podperlos2.podperlos390.podperlos400.podperlpacktut.podperlperf.podperlplan9.podperlpod.podperlpodspec.podperlpolicy.podperlport.podperlpragma.podperlqnx.podperlre.podperlreapi.podperlrebackslash.podperlrecharclass.podperlref.podperlreftut.podperlreguts.podperlrepository.podperlrequick.podperlreref.podperlretut.podperlriscos.podperlrun.podperlsec.podperlsolaris.podperlsource.podperlstyle.podperlsub.podperlsymbian.podperlsyn.podperlsynology.podperlthrtut.podperltie.podperltoc.podperltodo.podperltooc.podperltoot.podperltrap.podperltru64.podperltw.podperlunicode.podperlunicook.podperlunifaq.podperluniintro.podperluniprops.podperlunitut.podperlvar.podperlvms.podperlvos.podperlwin32.podperlxs.podperlxstut.podperlxstypemap.podsigtrap.pmsort.pmsubs.pmvars.pmvmsish.pmwarningsregister.pm/usr/bin//usr/lib//usr/lib/.build-id//usr/lib/.build-id/00//usr/lib/.build-id/07//usr/lib/.build-id/0b//usr/lib/.build-id/10//usr/lib/.build-id/11//usr/lib/.build-id/14//usr/lib/.build-id/16//usr/lib/.build-id/18//usr/lib/.build-id/1b//usr/lib/.build-id/20//usr/lib/.build-id/2f//usr/lib/.build-id/30//usr/lib/.build-id/31//usr/lib/.build-id/32//usr/lib/.build-id/36//usr/lib/.build-id/3c//usr/lib/.build-id/42//usr/lib/.build-id/44//usr/lib/.build-id/45//usr/lib/.build-id/4e//usr/lib/.build-id/50//usr/lib/.build-id/57//usr/lib/.build-id/5c//usr/lib/.build-id/5f//usr/lib/.build-id/63//usr/lib/.build-id/64//usr/lib/.build-id/66//usr/lib/.build-id/78//usr/lib/.build-id/7a//usr/lib/.build-id/7f//usr/lib/.build-id/80//usr/lib/.build-id/82//usr/lib/.build-id/84//usr/lib/.build-id/87//usr/lib/.build-id/8e//usr/lib/.build-id/95//usr/lib/.build-id/96//usr/lib/.build-id/98//usr/lib/.build-id/a1//usr/lib/.build-id/a2//usr/lib/.build-id/a9//usr/lib/.build-id/af//usr/lib/.build-id/b2//usr/lib/.build-id/b4//usr/lib/.build-id/b5//usr/lib/.build-id/b7//usr/lib/.build-id/c2//usr/lib/.build-id/c9//usr/lib/.build-id/cc//usr/lib/.build-id/ce//usr/lib/.build-id/d0//usr/lib/.build-id/da//usr/lib/.build-id/e0//usr/lib/.build-id/ee//usr/lib/.build-id/ef//usr/lib/.build-id/ff//usr/lib64/perl5//usr/lib64/perl5/B//usr/lib64/perl5/File//usr/lib64/perl5/Hash//usr/lib64/perl5/Hash/Util//usr/lib64/perl5/I18N//usr/lib64/perl5/PerlIO//usr/lib64/perl5/Sys//usr/lib64/perl5/Tie//usr/lib64/perl5/Tie/Hash//usr/lib64/perl5/asm-generic//usr/lib64/perl5/asm//usr/lib64/perl5/auto//usr/lib64/perl5/auto/B//usr/lib64/perl5/auto/Fcntl//usr/lib64/perl5/auto/File//usr/lib64/perl5/auto/File/DosGlob//usr/lib64/perl5/auto/File/Glob//usr/lib64/perl5/auto/GDBM_File//usr/lib64/perl5/auto/Hash//usr/lib64/perl5/auto/Hash/Util//usr/lib64/perl5/auto/Hash/Util/FieldHash//usr/lib64/perl5/auto/I18N//usr/lib64/perl5/auto/I18N/Langinfo//usr/lib64/perl5/auto/NDBM_File//usr/lib64/perl5/auto/ODBM_File//usr/lib64/perl5/auto/Opcode//usr/lib64/perl5/auto/POSIX//usr/lib64/perl5/auto/PerlIO//usr/lib64/perl5/auto/PerlIO/encoding//usr/lib64/perl5/auto/PerlIO/mmap//usr/lib64/perl5/auto/PerlIO/scalar//usr/lib64/perl5/auto/PerlIO/via//usr/lib64/perl5/auto/SDBM_File//usr/lib64/perl5/auto/Sys//usr/lib64/perl5/auto/Sys/Hostname//usr/lib64/perl5/auto/Tie//usr/lib64/perl5/auto/Tie/Hash//usr/lib64/perl5/auto/Tie/Hash/NamedCapture//usr/lib64/perl5/auto/arybase//usr/lib64/perl5/auto/attributes//usr/lib64/perl5/auto/mro//usr/lib64/perl5/bits//usr/lib64/perl5/bits/types//usr/lib64/perl5/gnu//usr/lib64/perl5/linux//usr/lib64/perl5/sys//usr/share/man/man1//usr/share/man/man3//usr/share/perl5//usr/share/perl5/B//usr/share/perl5/Class//usr/share/perl5/Config//usr/share/perl5/DBM_Filter//usr/share/perl5/ExtUtils//usr/share/perl5/ExtUtils/Constant//usr/share/perl5/File//usr/share/perl5/Getopt//usr/share/perl5/I18N//usr/share/perl5/I18N/LangTags//usr/share/perl5/IPC//usr/share/perl5/Net�x��������������������X"q�(
@������y������ud�$e����������������udvdtd�_g.3ssl.gzDSA_get0_key.3ssl.gzDSA_get0_p.3ssl.gzDSA_get0_pqg.3ssl.gzDSA_get0_priv_key.3ssl.gzDSA_get0_pub_key.3ssl.gzDSA_get0_q.3ssl.gzDSA_get_default_method.3ssl.gzDSA_get_ex_data.3ssl.gzDSA_get_ex_new_index.3ssl.gzDSA_meth_dup.3ssl.gzDSA_meth_free.3ssl.gzDSA_meth_get0_app_data.3ssl.gzDSA_meth_get0_name.3ssl.gzDSA_meth_get_bn_mod_exp.3ssl.gzDSA_meth_get_finish.3ssl.gzDSA_meth_get_flags.3ssl.gzDSA_meth_get_init.3ssl.gzDSA_meth_get_keygen.3ssl.gzDSA_meth_get_mod_exp.3ssl.gzDSA_meth_get_paramgen.3ssl.gzDSA_meth_get_sign.3ssl.gzDSA_meth_get_sign_setup.3ssl.gzDSA_meth_get_verify.3ssl.gzDSA_meth_new.3ssl.gzDSA_meth_set0_app_data.3ssl.gzDSA_meth_set1_name.3ssl.gzDSA_meth_set_bn_mod_exp.3ssl.gzDSA_meth_set_finish.3ssl.gzDSA_meth_set_flags.3ssl.gzDSA_meth_set_init.3ssl.gzDSA_meth_set_keygen.3ssl.gzDSA_meth_set_mod_exp.3ssl.gzDSA_meth_set_paramgen.3ssl.gzDSA_meth_set_sign.3ssl.gzDSA_meth_set_sign_setup.3ssl.gzDSA_meth_set_verify.3ssl.gzDSA_new.3ssl.gzDSA_new_method.3ssl.gzDSA_print.3ssl.gzDSA_print_fp.3ssl.gzDSA_security_bits.3ssl.gzDSA_set0_key.3ssl.gzDSA_set0_pqg.3ssl.gzDSA_set_default_method.3ssl.gzDSA_set_ex_data.3ssl.gzDSA_set_flags.3ssl.gzDSA_set_method.3ssl.gzDSA_sign.3ssl.gzDSA_sign_setup.3ssl.gzDSA_size.3ssl.gzDSA_test_flags.3ssl.gzDSA_verify.3ssl.gzDSAparams_dup.3ssl.gzDSAparams_print.3ssl.gzDSAparams_print_fp.3ssl.gzDTLS_client_method.3ssl.gzDTLS_get_data_mtu.3ssl.gzDTLS_method.3ssl.gzDTLS_server_method.3ssl.gzDTLS_set_timer_cb.3ssl.gzDTLS_timer_cb.3ssl.gzDTLSv1_2_client_method.3ssl.gzDTLSv1_2_method.3ssl.gzDTLSv1_2_server_method.3ssl.gzDTLSv1_client_method.3ssl.gzDTLSv1_listen.3ssl.gzDTLSv1_method.3ssl.gzDTLSv1_server_method.3ssl.gzECDH_get_ex_data.3ssl.gzECDH_get_ex_new_index.3ssl.gzECDH_set_ex_data.3ssl.gzECDSA_SIG_free.3ssl.gzECDSA_SIG_get0.3ssl.gzECDSA_SIG_get0_r.3ssl.gzECDSA_SIG_get0_s.3ssl.gzECDSA_SIG_new.3ssl.gzECDSA_SIG_set0.3ssl.gzECDSA_do_sign.3ssl.gzECDSA_do_sign_ex.3ssl.gzECDSA_do_verify.3ssl.gzECDSA_sign.3ssl.gzECDSA_sign_ex.3ssl.gzECDSA_sign_setup.3ssl.gzECDSA_size.3ssl.gzECDSA_verify.3ssl.gzECPARAMETERS_free.3ssl.gzECPARAMETERS_new.3ssl.gzECPKPARAMETERS_free.3ssl.gzECPKPARAMETERS_new.3ssl.gzECPKParameters_print.3ssl.gzECPKParameters_print_fp.3ssl.gzEC_GF2m_simple_method.3ssl.gzEC_GFp_mont_method.3ssl.gzEC_GFp_nist_method.3ssl.gzEC_GFp_nistp224_method.3ssl.gzEC_GFp_nistp256_method.3ssl.gzEC_GFp_nistp521_method.3ssl.gzEC_GFp_simple_method.3ssl.gzEC_GROUP_check.3ssl.gzEC_GROUP_check_discriminant.3ssl.gzEC_GROUP_clear_free.3ssl.gzEC_GROUP_cmp.3ssl.gzEC_GROUP_copy.3ssl.gzEC_GROUP_dup.3ssl.gzEC_GROUP_free.3ssl.gzEC_GROUP_get0_cofactor.3ssl.gzEC_GROUP_get0_generator.3ssl.gzEC_GROUP_get0_order.3ssl.gzEC_GROUP_get0_seed.3ssl.gzEC_GROUP_get_asn1_flag.3ssl.gzEC_GROUP_get_basis_type.3ssl.gzEC_GROUP_get_cofactor.3ssl.gzEC_GROUP_get_curve.3ssl.gzEC_GROUP_get_curve_GF2m.3ssl.gzEC_GROUP_get_curve_GFp.3ssl.gzEC_GROUP_get_curve_name.3ssl.gzEC_GROUP_get_degree.3ssl.gzEC_GROUP_get_ecparameters.3ssl.gzEC_GROUP_get_ecpkparameters.3ssl.gzEC_GROUP_get_order.3ssl.gzEC_GROUP_get_pentanomial_basis.3ssl.gzEC_GROUP_get_point_conversion_form.3ssl.gzEC_GROUP_get_seed_len.3ssl.gzEC_GROUP_get_trinomial_basis.3ssl.gzEC_GROUP_have_precompute_mult.3ssl.gzEC_GROUP_method_of.3ssl.gzEC_GROUP_new.3ssl.gzEC_GROUP_new_by_curve_name.3ssl.gzEC_GROUP_new_curve_GF2m.3ssl.gzEC_GROUP_new_curve_GFp.3ssl.gzEC_GROUP_new_from_ecparameters.3ssl.gzEC_GROUP_new_from_ecpkparameters.3ssl.gzEC_GROUP_order_bits.3ssl.gzEC_GROUP_precompute_mult.3ssl.gzEC_GROUP_set_asn1_flag.3ssl.gzEC_GROUP_set_curve.3ssl.gzEC_GROUP_set_curve_GF2m.3ssl.gzEC_GROUP_set_curve_GFp.3ssl.gzEC_GROUP_set_curve_name.3ssl.gzEC_GROUP_set_generator.3ssl.gzEC_GROUP_set_point_conversion_form.3ssl.gzEC_GROUP_set_seed.3ssl.gzEC_KEY_check_key.3ssl.gzEC_KEY_clear_flags.3ssl.gzEC_KEY_copy.3ssl.gzEC_KEY_decoded_from_explicit_params.3ssl.gzEC_KEY_dup.3ssl.gzEC_KEY_free.3ssl.gzEC_KEY_generate_key.3ssl.gzEC_KEY_get0_engine.3ssl.gz��������x�������������X��������������������P�����d������������������������������e��������K8�!#